Fix some typos (found by codespell) (#969)
Signed-off-by: Stefan Weil <sw@weilnetz.de>
This commit is contained in:
@@ -87,7 +87,7 @@ if ($page == 'showinfo') {
|
|||||||
$hits = $cache['num_hits'] . @sprintf(" (%.1f%%)", $cache['num_hits'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
|
$hits = $cache['num_hits'] . @sprintf(" (%.1f%%)", $cache['num_hits'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
|
||||||
$misses = $cache['num_misses'] . @sprintf(" (%.1f%%)", $cache['num_misses'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
|
$misses = $cache['num_misses'] . @sprintf(" (%.1f%%)", $cache['num_misses'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
|
||||||
|
|
||||||
// Fragementation: (freeseg - 1) / total_seg
|
// Fragmentation: (freeseg - 1) / total_seg
|
||||||
$nseg = $freeseg = $fragsize = $freetotal = 0;
|
$nseg = $freeseg = $fragsize = $freetotal = 0;
|
||||||
for ($i = 0; $i < $mem['num_seg']; $i ++) {
|
for ($i = 0; $i < $mem['num_seg']; $i ++) {
|
||||||
$ptr = 0;
|
$ptr = 0;
|
||||||
|
|||||||
@@ -22,7 +22,7 @@ require './lib/init.php';
|
|||||||
|
|
||||||
if ($action == 'reset' && function_exists('opcache_reset') && $userinfo['change_serversettings'] == '1') {
|
if ($action == 'reset' && function_exists('opcache_reset') && $userinfo['change_serversettings'] == '1') {
|
||||||
opcache_reset();
|
opcache_reset();
|
||||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "reseted OPcache");
|
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "reset OPcache");
|
||||||
header('Location: ' . $linker->getLink(array(
|
header('Location: ' . $linker->getLink(array(
|
||||||
'section' => 'opcacheinfo',
|
'section' => 'opcacheinfo',
|
||||||
'page' => 'showinfo'
|
'page' => 'showinfo'
|
||||||
|
|||||||
@@ -127,7 +127,7 @@ if ($action == 'delete') {
|
|||||||
|
|
||||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed api::api_keys");
|
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed api::api_keys");
|
||||||
|
|
||||||
// select all my (accessable) certificates
|
// select all my (accessible) certificates
|
||||||
$keys_stmt_query = "SELECT ak.*, c.loginname, a.loginname as adminname
|
$keys_stmt_query = "SELECT ak.*, c.loginname, a.loginname as adminname
|
||||||
FROM `" . TABLE_API_KEYS . "` ak
|
FROM `" . TABLE_API_KEYS . "` ak
|
||||||
LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `ak`.`customerid`
|
LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `ak`.`customerid`
|
||||||
|
|||||||
@@ -123,7 +123,7 @@ class FroxlorInstall
|
|||||||
if ((isset($_POST['installstep']) && $_POST['installstep'] == '1') || (isset($_GET['check']) && $_GET['check'] == '1')) {
|
if ((isset($_POST['installstep']) && $_POST['installstep'] == '1') || (isset($_GET['check']) && $_GET['check'] == '1')) {
|
||||||
$pagetitle = $this->_lng['install']['title'];
|
$pagetitle = $this->_lng['install']['title'];
|
||||||
if ($this->_checkPostData()) {
|
if ($this->_checkPostData()) {
|
||||||
// ceck data and create userdata etc.etc.etc.
|
// check data and create userdata etc.etc.etc.
|
||||||
$result = $this->_doInstall();
|
$result = $this->_doInstall();
|
||||||
} elseif (isset($_GET['check']) && $_GET['check'] == '1') {
|
} elseif (isset($_GET['check']) && $_GET['check'] == '1') {
|
||||||
// gather data
|
// gather data
|
||||||
@@ -739,7 +739,7 @@ class FroxlorInstall
|
|||||||
}
|
}
|
||||||
|
|
||||||
if ($tables_exist) {
|
if ($tables_exist) {
|
||||||
// tell whats going on
|
// tell what's going on
|
||||||
$content .= $this->_status_message('begin', $this->_lng['install']['backup_old_db']);
|
$content .= $this->_status_message('begin', $this->_lng['install']['backup_old_db']);
|
||||||
|
|
||||||
// create temporary backup-filename
|
// create temporary backup-filename
|
||||||
|
|||||||
@@ -23,7 +23,7 @@ $lng['requirements']['notfound'] = 'not found';
|
|||||||
$lng['requirements']['notinstalled'] = 'not installed';
|
$lng['requirements']['notinstalled'] = 'not installed';
|
||||||
$lng['requirements']['activated'] = 'enabled';
|
$lng['requirements']['activated'] = 'enabled';
|
||||||
$lng['requirements']['phpversion'] = 'PHP version >= 7.0';
|
$lng['requirements']['phpversion'] = 'PHP version >= 7.0';
|
||||||
$lng['requirements']['newerphpprefered'] = 'Good, but php-7.1 is prefered.';
|
$lng['requirements']['newerphpprefered'] = 'Good, but php-7.1 is preferred.';
|
||||||
$lng['requirements']['phppdo'] = 'PHP PDO extension and PDO-MySQL driver...';
|
$lng['requirements']['phppdo'] = 'PHP PDO extension and PDO-MySQL driver...';
|
||||||
$lng['requirements']['phpsession'] = 'PHP session-extension...';
|
$lng['requirements']['phpsession'] = 'PHP session-extension...';
|
||||||
$lng['requirements']['phpctype'] = 'PHP ctype-extension...';
|
$lng['requirements']['phpctype'] = 'PHP ctype-extension...';
|
||||||
@@ -39,7 +39,7 @@ $lng['requirements']['phpjson'] = 'PHP json-extension...';
|
|||||||
$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
|
$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
|
||||||
$lng['requirements']['zipdescription'] = 'The auto-update feature requires the zip extension.';
|
$lng['requirements']['zipdescription'] = 'The auto-update feature requires the zip extension.';
|
||||||
$lng['requirements']['openbasedir'] = 'open_basedir...';
|
$lng['requirements']['openbasedir'] = 'open_basedir...';
|
||||||
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the coresponding php.ini';
|
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the corresponding php.ini';
|
||||||
$lng['requirements']['mysqldump'] = 'MySQL dump tool';
|
$lng['requirements']['mysqldump'] = 'MySQL dump tool';
|
||||||
$lng['requirements']['mysqldumpmissing'] = 'Automatic backup of possible existing database is not possible. Please install mysql-client tools';
|
$lng['requirements']['mysqldumpmissing'] = 'Automatic backup of possible existing database is not possible. Please install mysql-client tools';
|
||||||
$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';
|
$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';
|
||||||
|
|||||||
@@ -2505,7 +2505,7 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.9.30')) {
|
|||||||
showUpdateStep("Updating from 0.9.30 to 0.9.31-dev1", true);
|
showUpdateStep("Updating from 0.9.30 to 0.9.31-dev1", true);
|
||||||
lastStepStatus(0);
|
lastStepStatus(0);
|
||||||
|
|
||||||
showUpdateStep("Removing unsused tables");
|
showUpdateStep("Removing unused tables");
|
||||||
Database::query("DROP TABLE IF EXISTS `ipsandports_docrootsettings`;");
|
Database::query("DROP TABLE IF EXISTS `ipsandports_docrootsettings`;");
|
||||||
Database::query("DROP TABLE IF EXISTS `domain_docrootsettings`;");
|
Database::query("DROP TABLE IF EXISTS `domain_docrootsettings`;");
|
||||||
lastStepStatus(0);
|
lastStepStatus(0);
|
||||||
@@ -2856,7 +2856,7 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.9.32-rc1')) {
|
|||||||
Settings::AddNew("system.croncmdline", $croncmdline);
|
Settings::AddNew("system.croncmdline", $croncmdline);
|
||||||
// add task to generate cron.d-file
|
// add task to generate cron.d-file
|
||||||
\Froxlor\System\Cronjob::inserttask('99');
|
\Froxlor\System\Cronjob::inserttask('99');
|
||||||
// silenty add the auto-update setting - we do not want everybody to know and use this
|
// silently add the auto-update setting - we do not want everybody to know and use this
|
||||||
// as it is a very dangerous setting
|
// as it is a very dangerous setting
|
||||||
Settings::AddNew("system.cron_allowautoupdate", 0);
|
Settings::AddNew("system.cron_allowautoupdate", 0);
|
||||||
lastStepStatus(0);
|
lastStepStatus(0);
|
||||||
@@ -3872,7 +3872,7 @@ opcache.interned_strings_buffer');
|
|||||||
|
|
||||||
if (\Froxlor\Froxlor::isDatabaseVersion('201801110')) {
|
if (\Froxlor\Froxlor::isDatabaseVersion('201801110')) {
|
||||||
|
|
||||||
showUpdateStep("Adding php-fpm php PATH setting for envrironment");
|
showUpdateStep("Adding php-fpm php PATH setting for environment");
|
||||||
Settings::AddNew("phpfpm.envpath", '/usr/local/bin:/usr/bin:/bin');
|
Settings::AddNew("phpfpm.envpath", '/usr/local/bin:/usr/bin:/bin');
|
||||||
lastStepStatus(0);
|
lastStepStatus(0);
|
||||||
|
|
||||||
|
|||||||
@@ -19,7 +19,7 @@
|
|||||||
* Function getPreConfig
|
* Function getPreConfig
|
||||||
*
|
*
|
||||||
* outputs various content before the update process
|
* outputs various content before the update process
|
||||||
* can be continued (askes for agreement whatever is being asked)
|
* can be continued (asks for agreement whatever is being asked)
|
||||||
*
|
*
|
||||||
* @param string $current_version
|
* @param string $current_version
|
||||||
* @param int $current_db_version
|
* @param int $current_db_version
|
||||||
|
|||||||
@@ -414,7 +414,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version, $c
|
|||||||
|
|
||||||
if (Settings::Get('system.webserver') == 'apache2') {
|
if (Settings::Get('system.webserver') == 'apache2') {
|
||||||
$has_preconfig = true;
|
$has_preconfig = true;
|
||||||
$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in ordner to use it.<br />';
|
$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in order to use it.<br />';
|
||||||
$description .= '<pre>LoadModule authz_core_module modules/mod_authz_core.so
|
$description .= '<pre>LoadModule authz_core_module modules/mod_authz_core.so
|
||||||
LoadModule authz_host_module modules/mod_authz_host.so</pre><br />';
|
LoadModule authz_host_module modules/mod_authz_host.so</pre><br />';
|
||||||
$question = '<strong>Do you want to enable the Apache-2.4 modification?:</strong> ';
|
$question = '<strong>Do you want to enable the Apache-2.4 modification?:</strong> ';
|
||||||
|
|||||||
@@ -189,7 +189,7 @@ class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
|
|||||||
*/
|
*/
|
||||||
public function listing()
|
public function listing()
|
||||||
{
|
{
|
||||||
// select all my (accessable) certificates
|
// select all my (accessible) certificates
|
||||||
$certs_stmt_query = "SELECT s.*, d.domain, d.letsencrypt, c.customerid, c.loginname
|
$certs_stmt_query = "SELECT s.*, d.domain, d.letsencrypt, c.customerid, c.loginname
|
||||||
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
|
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
|
||||||
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
|
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
|
||||||
@@ -237,7 +237,7 @@ class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
|
|||||||
*/
|
*/
|
||||||
public function listingCount()
|
public function listingCount()
|
||||||
{
|
{
|
||||||
// select all my (accessable) certificates
|
// select all my (accessible) certificates
|
||||||
$certs_stmt_query = "SELECT COUNT(*) as num_certs
|
$certs_stmt_query = "SELECT COUNT(*) as num_certs
|
||||||
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
|
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
|
||||||
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
|
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
|
||||||
|
|||||||
@@ -23,7 +23,7 @@ class CustomerBackups extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Re
|
|||||||
{
|
{
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* check whether backup is enabled systemwide and if accessable for customer (hide_options)
|
* check whether backup is enabled systemwide and if accessible for customer (hide_options)
|
||||||
*
|
*
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
*/
|
*/
|
||||||
|
|||||||
@@ -316,9 +316,9 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
|
|||||||
* @param bool $perlenabled
|
* @param bool $perlenabled
|
||||||
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
||||||
* @param bool $dnsenabled
|
* @param bool $dnsenabled
|
||||||
* optional, wether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
||||||
* @param bool $logviewenabled
|
* @param bool $logviewenabled
|
||||||
* optional, wether to allow acccess to webserver access/error-logs, default 0 (false)
|
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
|
||||||
* @param bool $store_defaultindex
|
* @param bool $store_defaultindex
|
||||||
* optional, whether to store the default index file to customers homedir
|
* optional, whether to store the default index file to customers homedir
|
||||||
* @param int $hosting_plan_id
|
* @param int $hosting_plan_id
|
||||||
@@ -923,9 +923,9 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
|
|||||||
* @param bool $perlenabled
|
* @param bool $perlenabled
|
||||||
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
||||||
* @param bool $dnsenabled
|
* @param bool $dnsenabled
|
||||||
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
||||||
* @param bool $logviewenabled
|
* @param bool $logviewenabled
|
||||||
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
|
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
|
||||||
* @param string $theme
|
* @param string $theme
|
||||||
* optional, change theme
|
* optional, change theme
|
||||||
*
|
*
|
||||||
|
|||||||
@@ -322,7 +322,7 @@ class DirOptions extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable directory options
|
* returns the total number of accessible directory options
|
||||||
*
|
*
|
||||||
* @param int $customerid
|
* @param int $customerid
|
||||||
* optional, admin-only, select directory-protections of a specific customer by id
|
* optional, admin-only, select directory-protections of a specific customer by id
|
||||||
|
|||||||
@@ -305,7 +305,7 @@ class DirProtections extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Res
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable directory protections
|
* returns the total number of accessible directory protections
|
||||||
*
|
*
|
||||||
* @param int $customerid
|
* @param int $customerid
|
||||||
* optional, admin-only, select directory-protections of a specific customer by id
|
* optional, admin-only, select directory-protections of a specific customer by id
|
||||||
|
|||||||
@@ -77,7 +77,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable domains
|
* returns the total number of accessible domains
|
||||||
*
|
*
|
||||||
* @access admin
|
* @access admin
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
|
|||||||
@@ -326,7 +326,7 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable email addresses
|
* returns the total number of accessible email addresses
|
||||||
*
|
*
|
||||||
* @param int $customerid
|
* @param int $customerid
|
||||||
* optional, admin-only, select email addresses of a specific customer by id
|
* optional, admin-only, select email addresses of a specific customer by id
|
||||||
|
|||||||
@@ -79,7 +79,7 @@ class FpmDaemons extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable fpm daemons
|
* returns the total number of accessible fpm daemons
|
||||||
*
|
*
|
||||||
* @access admin
|
* @access admin
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
|
|||||||
@@ -62,7 +62,7 @@ class Ftps extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntit
|
|||||||
|
|
||||||
if (($this->getUserDetail('ftps_used') < $this->getUserDetail('ftps') || $this->getUserDetail('ftps') == '-1') || $this->isAdmin() && $is_defaultuser == 1) {
|
if (($this->getUserDetail('ftps_used') < $this->getUserDetail('ftps') || $this->getUserDetail('ftps') == '-1') || $this->isAdmin() && $is_defaultuser == 1) {
|
||||||
|
|
||||||
// required paramters
|
// required parameters
|
||||||
$path = $this->getParam('path');
|
$path = $this->getParam('path');
|
||||||
$password = $this->getParam('ftp_password');
|
$password = $this->getParam('ftp_password');
|
||||||
|
|
||||||
@@ -512,7 +512,7 @@ class Ftps extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntit
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable ftp accounts
|
* returns the total number of accessible ftp accounts
|
||||||
*
|
*
|
||||||
* @param int $customerid
|
* @param int $customerid
|
||||||
* optional, admin-only, select ftp-users of a specific customer by id
|
* optional, admin-only, select ftp-users of a specific customer by id
|
||||||
|
|||||||
@@ -66,7 +66,7 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable hosting plans
|
* returns the total number of accessible hosting plans
|
||||||
*
|
*
|
||||||
* @access admin
|
* @access admin
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
@@ -182,9 +182,9 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
|
|||||||
* @param bool $perlenabled
|
* @param bool $perlenabled
|
||||||
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
||||||
* @param bool $dnsenabled
|
* @param bool $dnsenabled
|
||||||
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
||||||
* @param bool $logviewenabled
|
* @param bool $logviewenabled
|
||||||
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
|
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
|
||||||
*
|
*
|
||||||
* @access admin
|
* @access admin
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
@@ -309,9 +309,9 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
|
|||||||
* @param bool $perlenabled
|
* @param bool $perlenabled
|
||||||
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
* optional, whether to allow usage of Perl/CGI, default 0 (false)
|
||||||
* @param bool $dnsenabled
|
* @param bool $dnsenabled
|
||||||
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
* optional, either to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
|
||||||
* @param bool $logviewenabled
|
* @param bool $logviewenabled
|
||||||
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
|
* optional, either to allow access to webserver access/error-logs, default 0 (false)
|
||||||
*
|
*
|
||||||
* @access admin
|
* @access admin
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
|
|||||||
@@ -65,7 +65,7 @@ class IpsAndPorts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable ip/port entries
|
* returns the total number of accessible ip/port entries
|
||||||
*
|
*
|
||||||
* @access admin
|
* @access admin
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
|
|||||||
@@ -46,7 +46,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
|
|||||||
*/
|
*/
|
||||||
public function add()
|
public function add()
|
||||||
{
|
{
|
||||||
// required paramters
|
// required parameters
|
||||||
$password = $this->getParam('mysql_password');
|
$password = $this->getParam('mysql_password');
|
||||||
|
|
||||||
// parameters
|
// parameters
|
||||||
@@ -314,7 +314,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
|
|||||||
));
|
));
|
||||||
$id = $result['id'];
|
$id = $result['id'];
|
||||||
|
|
||||||
// paramters
|
// parameters
|
||||||
$password = $this->getParam('mysql_password', true, '');
|
$password = $this->getParam('mysql_password', true, '');
|
||||||
$databasedescription = $this->getParam('description', true, $result['description']);
|
$databasedescription = $this->getParam('description', true, $result['description']);
|
||||||
|
|
||||||
@@ -437,7 +437,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable databases
|
* returns the total number of accessible databases
|
||||||
*
|
*
|
||||||
* @param int $customerid
|
* @param int $customerid
|
||||||
* optional, admin-only, select dbs of a specific customer by id
|
* optional, admin-only, select dbs of a specific customer by id
|
||||||
|
|||||||
@@ -122,7 +122,7 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable php-setting entries
|
* returns the total number of accessible php-setting entries
|
||||||
*
|
*
|
||||||
* @access admin
|
* @access admin
|
||||||
* @throws \Exception
|
* @throws \Exception
|
||||||
|
|||||||
@@ -810,7 +810,7 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the total number of accessable subdomain entries
|
* returns the total number of accessible subdomain entries
|
||||||
*
|
*
|
||||||
* @param int $customerid
|
* @param int $customerid
|
||||||
* optional, admin-only, select (sub)domains of a specific customer by id
|
* optional, admin-only, select (sub)domains of a specific customer by id
|
||||||
|
|||||||
@@ -150,7 +150,7 @@ abstract class BulkAction
|
|||||||
|
|
||||||
/**
|
/**
|
||||||
* reads in the csv import file and returns an array with
|
* reads in the csv import file and returns an array with
|
||||||
* all the entites to be imported
|
* all the entities to be imported
|
||||||
*
|
*
|
||||||
* @param string $separator
|
* @param string $separator
|
||||||
*
|
*
|
||||||
|
|||||||
@@ -402,7 +402,7 @@ class ConfigServicesAction extends \Froxlor\Cli\Action
|
|||||||
} elseif (! file_exists($this->_args["froxlor-dir"])) {
|
} elseif (! file_exists($this->_args["froxlor-dir"])) {
|
||||||
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
|
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
|
||||||
} elseif (! is_readable($this->_args["froxlor-dir"])) {
|
} elseif (! is_readable($this->_args["froxlor-dir"])) {
|
||||||
throw new \Exception("Given froxlor direcotry cannot be read ('" . $this->_args["froxlor-dir"] . "')");
|
throw new \Exception("Given froxlor directory cannot be read ('" . $this->_args["froxlor-dir"] . "')");
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|||||||
@@ -62,7 +62,7 @@ class SwitchServerIpAction extends \Froxlor\Cli\Action
|
|||||||
$ip_list = $this->_args['switch'];
|
$ip_list = $this->_args['switch'];
|
||||||
|
|
||||||
if (empty($ip_list) || is_bool($ip_list)) {
|
if (empty($ip_list) || is_bool($ip_list)) {
|
||||||
throw new \Exception("No paramters given for --switch action.");
|
throw new \Exception("No parameters given for --switch action.");
|
||||||
}
|
}
|
||||||
|
|
||||||
$ips_to_switch = array();
|
$ips_to_switch = array();
|
||||||
@@ -179,7 +179,7 @@ class SwitchServerIpAction extends \Froxlor\Cli\Action
|
|||||||
} elseif (! file_exists($this->_args["froxlor-dir"])) {
|
} elseif (! file_exists($this->_args["froxlor-dir"])) {
|
||||||
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
|
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
|
||||||
} elseif (! is_readable($this->_args["froxlor-dir"])) {
|
} elseif (! is_readable($this->_args["froxlor-dir"])) {
|
||||||
throw new \Exception("Given froxlor direcotry cannot be read ('" . $this->_args["froxlor-dir"] . "')");
|
throw new \Exception("Given froxlor directory cannot be read ('" . $this->_args["froxlor-dir"] . "')");
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|||||||
@@ -55,7 +55,7 @@ class ConfigDaemon
|
|||||||
private $isparsed = false;
|
private $isparsed = false;
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* Sub - area of the full - XML only holding the daemon - data we are interessted in
|
* Sub - area of the full - XML only holding the daemon - data we are interested in
|
||||||
*
|
*
|
||||||
* @var \SimpleXMLElement
|
* @var \SimpleXMLElement
|
||||||
*/
|
*/
|
||||||
|
|||||||
@@ -826,7 +826,7 @@ class Apache extends HttpConfigBase
|
|||||||
// After inserting the AWStats information,
|
// After inserting the AWStats information,
|
||||||
// be sure to build the awstats conf file as well
|
// be sure to build the awstats conf file as well
|
||||||
// and chown it using $awstats_params, #258
|
// and chown it using $awstats_params, #258
|
||||||
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
|
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
|
||||||
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
|
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|||||||
@@ -287,7 +287,7 @@ class ConfigIO
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns a file/direcotry from the settings and checks whether it exists
|
* returns a file/directory from the settings and checks whether it exists
|
||||||
*
|
*
|
||||||
* @param string $group
|
* @param string $group
|
||||||
* settings-group
|
* settings-group
|
||||||
|
|||||||
@@ -287,7 +287,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
|
|||||||
$our_ips = Domain::getIpsOfDomain($domain_id);
|
$our_ips = Domain::getIpsOfDomain($domain_id);
|
||||||
foreach ($loop_domains as $idx => $domain) {
|
foreach ($loop_domains as $idx => $domain) {
|
||||||
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_INFO, "Validating DNS of " . $domain);
|
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_INFO, "Validating DNS of " . $domain);
|
||||||
// ips accordint to NS
|
// ips according to NS
|
||||||
$domain_ips = PhpHelper::gethostbynamel6($domain);
|
$domain_ips = PhpHelper::gethostbynamel6($domain);
|
||||||
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
|
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
|
||||||
// no common ips...
|
// no common ips...
|
||||||
|
|||||||
@@ -678,7 +678,7 @@ class Lighttpd extends HttpConfigBase
|
|||||||
// After inserting the AWStats information,
|
// After inserting the AWStats information,
|
||||||
// be sure to build the awstats conf file as well
|
// be sure to build the awstats conf file as well
|
||||||
// and chown it using $awstats_params, #258
|
// and chown it using $awstats_params, #258
|
||||||
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
|
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
|
||||||
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
|
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|||||||
@@ -1153,7 +1153,7 @@ class Nginx extends HttpConfigBase
|
|||||||
// After inserting the AWStats information,
|
// After inserting the AWStats information,
|
||||||
// be sure to build the awstats conf file as well
|
// be sure to build the awstats conf file as well
|
||||||
// and chown it using $awstats_params, #258
|
// and chown it using $awstats_params, #258
|
||||||
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
|
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
|
||||||
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
|
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|||||||
@@ -94,7 +94,7 @@ class Fcgid
|
|||||||
// Set Binary
|
// Set Binary
|
||||||
$starter_file .= "exec " . $phpconfig['binary'] . " -c " . escapeshellarg($this->getConfigDir()) . "\n";
|
$starter_file .= "exec " . $phpconfig['binary'] . " -c " . escapeshellarg($this->getConfigDir()) . "\n";
|
||||||
|
|
||||||
// remove +i attibute, so starter can be overwritten
|
// remove +i attribute, so starter can be overwritten
|
||||||
if (file_exists($this->getStarterFile())) {
|
if (file_exists($this->getStarterFile())) {
|
||||||
\Froxlor\FileDir::removeImmutable($this->getStarterFile());
|
\Froxlor\FileDir::removeImmutable($this->getStarterFile());
|
||||||
}
|
}
|
||||||
|
|||||||
@@ -69,7 +69,7 @@ class TrafficCron extends \Froxlor\Cron\FroxlorCron
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* TRAFFIC AND DISKUSAGE MESSURE
|
* TRAFFIC AND DISKUSAGE MEASURE
|
||||||
*/
|
*/
|
||||||
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_INFO, 'Traffic run started...');
|
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_INFO, 'Traffic run started...');
|
||||||
$admin_traffic = array();
|
$admin_traffic = array();
|
||||||
|
|||||||
@@ -165,7 +165,7 @@ class Database
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* returns the sql-access data as array using indeces
|
* returns the sql-access data as array using indices
|
||||||
* 'user', 'passwd' and 'host'.
|
* 'user', 'passwd' and 'host'.
|
||||||
* Returns false if not enabled
|
* Returns false if not enabled
|
||||||
*
|
*
|
||||||
|
|||||||
@@ -370,7 +370,7 @@ class FileDir
|
|||||||
* @param
|
* @param
|
||||||
* integer uid The uid which must match the found directories
|
* integer uid The uid which must match the found directories
|
||||||
* @param
|
* @param
|
||||||
* integer gid The gid which must match the found direcotries
|
* integer gid The gid which must match the found directories
|
||||||
* @param
|
* @param
|
||||||
* string value the value for the input-field
|
* string value the value for the input-field
|
||||||
*
|
*
|
||||||
@@ -461,7 +461,7 @@ class FileDir
|
|||||||
* @param int $uid
|
* @param int $uid
|
||||||
* the uid which must match the found directories
|
* the uid which must match the found directories
|
||||||
* @param int $gid
|
* @param int $gid
|
||||||
* the gid which must match the found direcotries
|
* the gid which must match the found directories
|
||||||
*
|
*
|
||||||
* @return array Array of found valid paths
|
* @return array Array of found valid paths
|
||||||
*/
|
*/
|
||||||
|
|||||||
@@ -157,7 +157,7 @@ class FroxlorLogger
|
|||||||
echo "[" . $this->getLogLevelDesc($type) . "] " . $text . PHP_EOL;
|
echo "[" . $this->getLogLevelDesc($type) . "] " . $text . PHP_EOL;
|
||||||
}
|
}
|
||||||
|
|
||||||
// warnings, errors and critical mesages WILL be logged
|
// warnings, errors and critical messages WILL be logged
|
||||||
if (Settings::Get('logger.log_cron') == '0' && $action == \Froxlor\FroxlorLogger::CRON_ACTION && $type > LOG_WARNING) {
|
if (Settings::Get('logger.log_cron') == '0' && $action == \Froxlor\FroxlorLogger::CRON_ACTION && $type > LOG_WARNING) {
|
||||||
return;
|
return;
|
||||||
}
|
}
|
||||||
|
|||||||
@@ -118,7 +118,7 @@ class SImExporter
|
|||||||
if ($_sha != sha1(var_export($_data, true))) {
|
if ($_sha != sha1(var_export($_data, true))) {
|
||||||
throw new \Exception("SHA check of import data failed. Unable to import.");
|
throw new \Exception("SHA check of import data failed. Unable to import.");
|
||||||
}
|
}
|
||||||
// do not import version info - but we need that to possibily update settings
|
// do not import version info - but we need that to possibly update settings
|
||||||
// when there were changes in the variable-name or similar
|
// when there were changes in the variable-name or similar
|
||||||
unset($_data['panel.version']);
|
unset($_data['panel.version']);
|
||||||
unset($_data['panel.db_version']);
|
unset($_data['panel.db_version']);
|
||||||
|
|||||||
@@ -59,20 +59,20 @@ class Crypt
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* Make crypted password from clear text password
|
* Make encrypted password from clear text password
|
||||||
*
|
*
|
||||||
* @author Michal Wojcik <m.wojcik@sonet3.pl>
|
* @author Michal Wojcik <m.wojcik@sonet3.pl>
|
||||||
* @author Michael Kaufmann <mkaufmann@nutime.de>
|
* @author Michael Kaufmann <mkaufmann@nutime.de>
|
||||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||||
*
|
*
|
||||||
* 0 - default crypt (depenend on system configuration)
|
* 0 - default crypt (depends on system configuration)
|
||||||
* 1 - MD5 $1$
|
* 1 - MD5 $1$
|
||||||
* 2 - BLOWFISH $2y$07$
|
* 2 - BLOWFISH $2y$07$
|
||||||
* 3 - SHA-256 $5$ (default)
|
* 3 - SHA-256 $5$ (default)
|
||||||
* 4 - SHA-512 $6$
|
* 4 - SHA-512 $6$
|
||||||
*
|
*
|
||||||
* @param string $password
|
* @param string $password
|
||||||
* Password to be crypted
|
* Password to be encrypted
|
||||||
* @param bool $htpasswd
|
* @param bool $htpasswd
|
||||||
* optional whether to generate a SHA1 password for directory protection
|
* optional whether to generate a SHA1 password for directory protection
|
||||||
*
|
*
|
||||||
|
|||||||
@@ -7,7 +7,7 @@ class Mailer extends \PHPMailer\PHPMailer\PHPMailer
|
|||||||
{
|
{
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* class construtor
|
* class constructor
|
||||||
*
|
*
|
||||||
* @param string $exceptions
|
* @param string $exceptions
|
||||||
* whether to throw exceptions or not
|
* whether to throw exceptions or not
|
||||||
|
|||||||
@@ -77,7 +77,7 @@ class User
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* Function which updates all counters of used ressources in panel_admins and panel_customers
|
* Function which updates all counters of used resources in panel_admins and panel_customers
|
||||||
*
|
*
|
||||||
* @param bool $returndebuginfo
|
* @param bool $returndebuginfo
|
||||||
* Set to true to get an array with debug information
|
* Set to true to get an array with debug information
|
||||||
@@ -237,7 +237,7 @@ class User
|
|||||||
$admin_domains = Database::pexecute_first($admin_domains_stmt, array(
|
$admin_domains = Database::pexecute_first($admin_domains_stmt, array(
|
||||||
"aid" => $admin['adminid']
|
"aid" => $admin['adminid']
|
||||||
));
|
));
|
||||||
// substract the amount of domains that are std-subdomains later when we iterated through all customers and know for sure
|
// subtract the amount of domains that are std-subdomains later when we iterated through all customers and know for sure
|
||||||
$admin['domains_used_new'] = $admin_domains['number_domains'];
|
$admin['domains_used_new'] = $admin_domains['number_domains'];
|
||||||
// set current admin
|
// set current admin
|
||||||
$cur_adm = $admin['adminid'];
|
$cur_adm = $admin['adminid'];
|
||||||
|
|||||||
@@ -388,7 +388,7 @@ exit "$RETVAL"
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -931,7 +931,7 @@ gmysql-password=
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -2228,7 +2228,7 @@ debugger_command =
|
|||||||
# >$config_directory/$process_name.$process_id.log & sleep 5
|
# >$config_directory/$process_name.$process_id.log & sleep 5
|
||||||
#
|
#
|
||||||
# Another possibility is to run gdb under a detached screen session.
|
# Another possibility is to run gdb under a detached screen session.
|
||||||
# To attach to the screen sesssion, su root and run "screen -r
|
# To attach to the screen session, su root and run "screen -r
|
||||||
# <id_string>" where <id_string> uniquely matches one of the detached
|
# <id_string>" where <id_string> uniquely matches one of the detached
|
||||||
# sessions (from "screen -list").
|
# sessions (from "screen -list").
|
||||||
#
|
#
|
||||||
@@ -2642,7 +2642,7 @@ driver = mysql
|
|||||||
# settings, like: host=sql1.host.org host=sql2.host.org
|
# settings, like: host=sql1.host.org host=sql2.host.org
|
||||||
#
|
#
|
||||||
# pgsql:
|
# pgsql:
|
||||||
# For available options, see the PostgreSQL documention for the
|
# For available options, see the PostgreSQL documentation for the
|
||||||
# PQconnectdb function of libpq.
|
# PQconnectdb function of libpq.
|
||||||
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
||||||
# create to pgsql.
|
# create to pgsql.
|
||||||
@@ -3707,7 +3707,7 @@ protocol sieve {
|
|||||||
#
|
#
|
||||||
# If you want UIDL compatibility with other POP3 servers, use:
|
# If you want UIDL compatibility with other POP3 servers, use:
|
||||||
# UW's ipop3d : %08Xv%08Xu
|
# UW's ipop3d : %08Xv%08Xu
|
||||||
# Courier : %f or %v-%u (both might be used simultaneosly)
|
# Courier : %f or %v-%u (both might be used simultaneously)
|
||||||
# Cyrus (<= 2.1.3) : %u
|
# Cyrus (<= 2.1.3) : %u
|
||||||
# Cyrus (>= 2.1.4) : %v.%u
|
# Cyrus (>= 2.1.4) : %v.%u
|
||||||
# Dovecot v0.99.x : %v.%u
|
# Dovecot v0.99.x : %v.%u
|
||||||
@@ -3965,7 +3965,7 @@ Port 21
|
|||||||
# PassivePorts 49152 65534
|
# PassivePorts 49152 65534
|
||||||
|
|
||||||
# If your host was NATted, this option is useful in order to
|
# If your host was NATted, this option is useful in order to
|
||||||
# allow passive tranfers to work. You have to use your public
|
# allow passive transfers to work. You have to use your public
|
||||||
# address and opening the passive ports used on your firewall as well.
|
# address and opening the passive ports used on your firewall as well.
|
||||||
# MasqueradeAddress 1.2.3.4
|
# MasqueradeAddress 1.2.3.4
|
||||||
|
|
||||||
@@ -3990,7 +3990,7 @@ Group nogroup
|
|||||||
# Umask 022 is a good standard umask to prevent new files and dirs
|
# Umask 022 is a good standard umask to prevent new files and dirs
|
||||||
# (second parm) from being group and world writable.
|
# (second parm) from being group and world writable.
|
||||||
Umask 022 022
|
Umask 022 022
|
||||||
# Normally, we want files to be overwriteable.
|
# Normally, we want files to be overwritable.
|
||||||
AllowOverwrite on
|
AllowOverwrite on
|
||||||
|
|
||||||
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
||||||
@@ -4237,7 +4237,7 @@ SQLBackend mysql
|
|||||||
SQLEngine on
|
SQLEngine on
|
||||||
SQLAuthenticate on
|
SQLAuthenticate on
|
||||||
#
|
#
|
||||||
# Use both a crypted or plaintext password
|
# Use both an encrypted or plaintext password
|
||||||
SQLAuthTypes Crypt
|
SQLAuthTypes Crypt
|
||||||
|
|
||||||
SQLAuthenticate users* groups*
|
SQLAuthenticate users* groups*
|
||||||
@@ -4295,7 +4295,7 @@ TLSVerifyClient off
|
|||||||
#TLSRequired on
|
#TLSRequired on
|
||||||
|
|
||||||
# Allow SSL/TLS renegotiations when the client requests them, but
|
# Allow SSL/TLS renegotiations when the client requests them, but
|
||||||
# do not force the renegotations. Some clients do not support
|
# do not force the renegotiations. Some clients do not support
|
||||||
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
||||||
# clients will close the data connection, or there will be a timeout
|
# clients will close the data connection, or there will be a timeout
|
||||||
# on an idle data connection.
|
# on an idle data connection.
|
||||||
@@ -4595,7 +4595,7 @@ aliases: files
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -377,7 +377,7 @@ exit "$RETVAL"
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -905,7 +905,7 @@ gmysql-password=
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -2187,7 +2187,7 @@ debugger_command =
|
|||||||
# >$config_directory/$process_name.$process_id.log & sleep 5
|
# >$config_directory/$process_name.$process_id.log & sleep 5
|
||||||
#
|
#
|
||||||
# Another possibility is to run gdb under a detached screen session.
|
# Another possibility is to run gdb under a detached screen session.
|
||||||
# To attach to the screen sesssion, su root and run "screen -r
|
# To attach to the screen session, su root and run "screen -r
|
||||||
# <id_string>" where <id_string> uniquely matches one of the detached
|
# <id_string>" where <id_string> uniquely matches one of the detached
|
||||||
# sessions (from "screen -list").
|
# sessions (from "screen -list").
|
||||||
#
|
#
|
||||||
@@ -4174,7 +4174,7 @@ Port 21
|
|||||||
# PassivePorts 49152 65534
|
# PassivePorts 49152 65534
|
||||||
|
|
||||||
# If your host was NATted, this option is useful in order to
|
# If your host was NATted, this option is useful in order to
|
||||||
# allow passive tranfers to work. You have to use your public
|
# allow passive transfers to work. You have to use your public
|
||||||
# address and opening the passive ports used on your firewall as well.
|
# address and opening the passive ports used on your firewall as well.
|
||||||
# MasqueradeAddress 1.2.3.4
|
# MasqueradeAddress 1.2.3.4
|
||||||
|
|
||||||
@@ -4199,7 +4199,7 @@ Group nogroup
|
|||||||
# Umask 022 is a good standard umask to prevent new files and dirs
|
# Umask 022 is a good standard umask to prevent new files and dirs
|
||||||
# (second parm) from being group and world writable.
|
# (second parm) from being group and world writable.
|
||||||
Umask 022 022
|
Umask 022 022
|
||||||
# Normally, we want files to be overwriteable.
|
# Normally, we want files to be overwritable.
|
||||||
AllowOverwrite on
|
AllowOverwrite on
|
||||||
|
|
||||||
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
||||||
@@ -4448,7 +4448,7 @@ SQLBackend mysql
|
|||||||
SQLEngine on
|
SQLEngine on
|
||||||
SQLAuthenticate on
|
SQLAuthenticate on
|
||||||
#
|
#
|
||||||
# Use both a crypted or plaintext password
|
# Use both an encrypted or plaintext password
|
||||||
SQLAuthTypes Crypt
|
SQLAuthTypes Crypt
|
||||||
|
|
||||||
SQLAuthenticate users* groups*
|
SQLAuthenticate users* groups*
|
||||||
@@ -4506,7 +4506,7 @@ TLSVerifyClient off
|
|||||||
#TLSRequired on
|
#TLSRequired on
|
||||||
|
|
||||||
# Allow SSL/TLS renegotiations when the client requests them, but
|
# Allow SSL/TLS renegotiations when the client requests them, but
|
||||||
# do not force the renegotations. Some clients do not support
|
# do not force the renegotiations. Some clients do not support
|
||||||
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
||||||
# clients will close the data connection, or there will be a timeout
|
# clients will close the data connection, or there will be a timeout
|
||||||
# on an idle data connection.
|
# on an idle data connection.
|
||||||
@@ -4806,7 +4806,7 @@ aliases: files
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -377,7 +377,7 @@ exit "$RETVAL"
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -905,7 +905,7 @@ gmysql-password=
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -2187,7 +2187,7 @@ debugger_command =
|
|||||||
# >$config_directory/$process_name.$process_id.log & sleep 5
|
# >$config_directory/$process_name.$process_id.log & sleep 5
|
||||||
#
|
#
|
||||||
# Another possibility is to run gdb under a detached screen session.
|
# Another possibility is to run gdb under a detached screen session.
|
||||||
# To attach to the screen sesssion, su root and run "screen -r
|
# To attach to the screen session, su root and run "screen -r
|
||||||
# <id_string>" where <id_string> uniquely matches one of the detached
|
# <id_string>" where <id_string> uniquely matches one of the detached
|
||||||
# sessions (from "screen -list").
|
# sessions (from "screen -list").
|
||||||
#
|
#
|
||||||
@@ -4167,7 +4167,7 @@ Port 21
|
|||||||
# PassivePorts 49152 65534
|
# PassivePorts 49152 65534
|
||||||
|
|
||||||
# If your host was NATted, this option is useful in order to
|
# If your host was NATted, this option is useful in order to
|
||||||
# allow passive tranfers to work. You have to use your public
|
# allow passive transfers to work. You have to use your public
|
||||||
# address and opening the passive ports used on your firewall as well.
|
# address and opening the passive ports used on your firewall as well.
|
||||||
# MasqueradeAddress 1.2.3.4
|
# MasqueradeAddress 1.2.3.4
|
||||||
|
|
||||||
@@ -4192,7 +4192,7 @@ Group nogroup
|
|||||||
# Umask 022 is a good standard umask to prevent new files and dirs
|
# Umask 022 is a good standard umask to prevent new files and dirs
|
||||||
# (second parm) from being group and world writable.
|
# (second parm) from being group and world writable.
|
||||||
Umask 022 022
|
Umask 022 022
|
||||||
# Normally, we want files to be overwriteable.
|
# Normally, we want files to be overwritable.
|
||||||
AllowOverwrite on
|
AllowOverwrite on
|
||||||
|
|
||||||
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
||||||
@@ -4439,7 +4439,7 @@ SQLBackend mysql
|
|||||||
SQLEngine on
|
SQLEngine on
|
||||||
SQLAuthenticate on
|
SQLAuthenticate on
|
||||||
#
|
#
|
||||||
# Use both a crypted or plaintext password
|
# Use both an encrypted or plaintext password
|
||||||
SQLAuthTypes Crypt
|
SQLAuthTypes Crypt
|
||||||
|
|
||||||
SQLAuthenticate users* groups*
|
SQLAuthenticate users* groups*
|
||||||
@@ -4497,7 +4497,7 @@ TLSVerifyClient off
|
|||||||
#TLSRequired on
|
#TLSRequired on
|
||||||
|
|
||||||
# Allow SSL/TLS renegotiations when the client requests them, but
|
# Allow SSL/TLS renegotiations when the client requests them, but
|
||||||
# do not force the renegotations. Some clients do not support
|
# do not force the renegotiations. Some clients do not support
|
||||||
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
||||||
# clients will close the data connection, or there will be a timeout
|
# clients will close the data connection, or there will be a timeout
|
||||||
# on an idle data connection.
|
# on an idle data connection.
|
||||||
@@ -4797,7 +4797,7 @@ aliases: files
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -226,7 +226,7 @@ query = SELECT gid FROM mail_users WHERE email = '%s'
|
|||||||
# FQDN from Froxlor
|
# FQDN from Froxlor
|
||||||
mydomain = <SERVERNAME>
|
mydomain = <SERVERNAME>
|
||||||
|
|
||||||
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
|
# set myhostname to $mydomain because Froxlor already uses a FQDN
|
||||||
myhostname = $mydomain
|
myhostname = $mydomain
|
||||||
|
|
||||||
mydestination = $myhostname,
|
mydestination = $myhostname,
|
||||||
@@ -1536,7 +1536,7 @@ protocol sieve {
|
|||||||
#
|
#
|
||||||
# If you want UIDL compatibility with other POP3 servers, use:
|
# If you want UIDL compatibility with other POP3 servers, use:
|
||||||
# UW's ipop3d : %08Xv%08Xu
|
# UW's ipop3d : %08Xv%08Xu
|
||||||
# Courier : %f or %v-%u (both might be used simultaneosly)
|
# Courier : %f or %v-%u (both might be used simultaneously)
|
||||||
# Cyrus (<= 2.1.3) : %u
|
# Cyrus (<= 2.1.3) : %u
|
||||||
# Cyrus (>= 2.1.4) : %v.%u
|
# Cyrus (>= 2.1.4) : %v.%u
|
||||||
# Dovecot v0.99.x : %v.%u
|
# Dovecot v0.99.x : %v.%u
|
||||||
@@ -1754,7 +1754,7 @@ driver = mysql
|
|||||||
# settings, like: host=sql1.host.org host=sql2.host.org
|
# settings, like: host=sql1.host.org host=sql2.host.org
|
||||||
#
|
#
|
||||||
# pgsql:
|
# pgsql:
|
||||||
# For available options, see the PostgreSQL documention for the
|
# For available options, see the PostgreSQL documentation for the
|
||||||
# PQconnectdb function of libpq.
|
# PQconnectdb function of libpq.
|
||||||
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
||||||
# create to pgsql.
|
# create to pgsql.
|
||||||
@@ -2237,7 +2237,7 @@ ControlsLog /var/log/proftpd/controls.log
|
|||||||
DefaultRoot ~
|
DefaultRoot ~
|
||||||
# Reject rootlogin (just for security)
|
# Reject rootlogin (just for security)
|
||||||
RootLogin off
|
RootLogin off
|
||||||
# Noo need to require valid shell, because user is virtual
|
# No need to require valid shell, because user is virtual
|
||||||
RequireValidShell off
|
RequireValidShell off
|
||||||
</Global>
|
</Global>
|
||||||
|
|
||||||
@@ -2447,7 +2447,7 @@ aliases: files nisplus
|
|||||||
</content>
|
</content>
|
||||||
</file>
|
</file>
|
||||||
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
|
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
|
||||||
<!-- clear group chache -->
|
<!-- clear group cache -->
|
||||||
<command><![CDATA[nscd --invalidate=group]]></command>
|
<command><![CDATA[nscd --invalidate=group]]></command>
|
||||||
</daemon>
|
</daemon>
|
||||||
<!-- Logrotate -->
|
<!-- Logrotate -->
|
||||||
@@ -2457,7 +2457,7 @@ aliases: files nisplus
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -227,7 +227,7 @@ query = SELECT gid FROM mail_users WHERE email = '%s'
|
|||||||
# FQDN from Froxlor
|
# FQDN from Froxlor
|
||||||
mydomain = <SERVERNAME>
|
mydomain = <SERVERNAME>
|
||||||
|
|
||||||
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
|
# set myhostname to $mydomain because Froxlor already uses a FQDN
|
||||||
myhostname = $mydomain
|
myhostname = $mydomain
|
||||||
|
|
||||||
mydestination = $myhostname,
|
mydestination = $myhostname,
|
||||||
@@ -1537,7 +1537,7 @@ protocol sieve {
|
|||||||
#
|
#
|
||||||
# If you want UIDL compatibility with other POP3 servers, use:
|
# If you want UIDL compatibility with other POP3 servers, use:
|
||||||
# UW's ipop3d : %08Xv%08Xu
|
# UW's ipop3d : %08Xv%08Xu
|
||||||
# Courier : %f or %v-%u (both might be used simultaneosly)
|
# Courier : %f or %v-%u (both might be used simultaneously)
|
||||||
# Cyrus (<= 2.1.3) : %u
|
# Cyrus (<= 2.1.3) : %u
|
||||||
# Cyrus (>= 2.1.4) : %v.%u
|
# Cyrus (>= 2.1.4) : %v.%u
|
||||||
# Dovecot v0.99.x : %v.%u
|
# Dovecot v0.99.x : %v.%u
|
||||||
@@ -1755,7 +1755,7 @@ driver = mysql
|
|||||||
# settings, like: host=sql1.host.org host=sql2.host.org
|
# settings, like: host=sql1.host.org host=sql2.host.org
|
||||||
#
|
#
|
||||||
# pgsql:
|
# pgsql:
|
||||||
# For available options, see the PostgreSQL documention for the
|
# For available options, see the PostgreSQL documentation for the
|
||||||
# PQconnectdb function of libpq.
|
# PQconnectdb function of libpq.
|
||||||
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
||||||
# create to pgsql.
|
# create to pgsql.
|
||||||
@@ -2238,7 +2238,7 @@ ControlsLog /var/log/proftpd/controls.log
|
|||||||
DefaultRoot ~
|
DefaultRoot ~
|
||||||
# Reject rootlogin (just for security)
|
# Reject rootlogin (just for security)
|
||||||
RootLogin off
|
RootLogin off
|
||||||
# Noo need to require valid shell, because user is virtual
|
# No need to require valid shell, because user is virtual
|
||||||
RequireValidShell off
|
RequireValidShell off
|
||||||
</Global>
|
</Global>
|
||||||
|
|
||||||
@@ -2449,7 +2449,7 @@ aliases: files nisplus
|
|||||||
</content>
|
</content>
|
||||||
</file>
|
</file>
|
||||||
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
|
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
|
||||||
<!-- clear group chache -->
|
<!-- clear group cache -->
|
||||||
<command><![CDATA[nscd --invalidate=group]]></command>
|
<command><![CDATA[nscd --invalidate=group]]></command>
|
||||||
</daemon>
|
</daemon>
|
||||||
<!-- Logrotate -->
|
<!-- Logrotate -->
|
||||||
@@ -2459,7 +2459,7 @@ aliases: files nisplus
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -375,7 +375,7 @@ exit "$RETVAL"
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -918,7 +918,7 @@ gmysql-password=
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -2058,7 +2058,7 @@ driver = mysql
|
|||||||
# settings, like: host=sql1.host.org host=sql2.host.org
|
# settings, like: host=sql1.host.org host=sql2.host.org
|
||||||
#
|
#
|
||||||
# pgsql:
|
# pgsql:
|
||||||
# For available options, see the PostgreSQL documention for the
|
# For available options, see the PostgreSQL documentation for the
|
||||||
# PQconnectdb function of libpq.
|
# PQconnectdb function of libpq.
|
||||||
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
||||||
# create to pgsql.
|
# create to pgsql.
|
||||||
@@ -3123,7 +3123,7 @@ protocol sieve {
|
|||||||
#
|
#
|
||||||
# If you want UIDL compatibility with other POP3 servers, use:
|
# If you want UIDL compatibility with other POP3 servers, use:
|
||||||
# UW's ipop3d : %08Xv%08Xu
|
# UW's ipop3d : %08Xv%08Xu
|
||||||
# Courier : %f or %v-%u (both might be used simultaneosly)
|
# Courier : %f or %v-%u (both might be used simultaneously)
|
||||||
# Cyrus (<= 2.1.3) : %u
|
# Cyrus (<= 2.1.3) : %u
|
||||||
# Cyrus (>= 2.1.4) : %v.%u
|
# Cyrus (>= 2.1.4) : %v.%u
|
||||||
# Dovecot v0.99.x : %v.%u
|
# Dovecot v0.99.x : %v.%u
|
||||||
@@ -3381,7 +3381,7 @@ Port 21
|
|||||||
# PassivePorts 49152 65534
|
# PassivePorts 49152 65534
|
||||||
|
|
||||||
# If your host was NATted, this option is useful in order to
|
# If your host was NATted, this option is useful in order to
|
||||||
# allow passive tranfers to work. You have to use your public
|
# allow passive transfers to work. You have to use your public
|
||||||
# address and opening the passive ports used on your firewall as well.
|
# address and opening the passive ports used on your firewall as well.
|
||||||
# MasqueradeAddress 1.2.3.4
|
# MasqueradeAddress 1.2.3.4
|
||||||
|
|
||||||
@@ -3406,7 +3406,7 @@ Group nogroup
|
|||||||
# Umask 022 is a good standard umask to prevent new files and dirs
|
# Umask 022 is a good standard umask to prevent new files and dirs
|
||||||
# (second parm) from being group and world writable.
|
# (second parm) from being group and world writable.
|
||||||
Umask 022 022
|
Umask 022 022
|
||||||
# Normally, we want files to be overwriteable.
|
# Normally, we want files to be overwritable.
|
||||||
AllowOverwrite on
|
AllowOverwrite on
|
||||||
|
|
||||||
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
||||||
@@ -3653,7 +3653,7 @@ SQLBackend mysql
|
|||||||
SQLEngine on
|
SQLEngine on
|
||||||
SQLAuthenticate on
|
SQLAuthenticate on
|
||||||
#
|
#
|
||||||
# Use both a crypted or plaintext password
|
# Use both an encrypted or plaintext password
|
||||||
SQLAuthTypes Crypt
|
SQLAuthTypes Crypt
|
||||||
|
|
||||||
SQLAuthenticate users* groups*
|
SQLAuthenticate users* groups*
|
||||||
@@ -3711,7 +3711,7 @@ TLSVerifyClient off
|
|||||||
#TLSRequired on
|
#TLSRequired on
|
||||||
|
|
||||||
# Allow SSL/TLS renegotiations when the client requests them, but
|
# Allow SSL/TLS renegotiations when the client requests them, but
|
||||||
# do not force the renegotations. Some clients do not support
|
# do not force the renegotiations. Some clients do not support
|
||||||
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
||||||
# clients will close the data connection, or there will be a timeout
|
# clients will close the data connection, or there will be a timeout
|
||||||
# on an idle data connection.
|
# on an idle data connection.
|
||||||
@@ -4019,7 +4019,7 @@ aliases: files
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -398,7 +398,7 @@ mail IN A <SERVERIP>
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -927,7 +927,7 @@ gmysql-password=
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -1587,7 +1587,7 @@ sendmail_path = /usr/sbin/sendmail
|
|||||||
# FQDN from Froxlor
|
# FQDN from Froxlor
|
||||||
mydomain = <SERVERNAME>
|
mydomain = <SERVERNAME>
|
||||||
|
|
||||||
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
|
# set myhostname to $mydomain because Froxlor already uses a FQDN
|
||||||
myhostname = $mydomain
|
myhostname = $mydomain
|
||||||
|
|
||||||
mydestination = $myhostname,
|
mydestination = $myhostname,
|
||||||
@@ -3762,7 +3762,7 @@ aliases: files
|
|||||||
</file>
|
</file>
|
||||||
<command><![CDATA[rc-update add nscd default]]></command>
|
<command><![CDATA[rc-update add nscd default]]></command>
|
||||||
<command><![CDATA[/etc/init.d/nscd restart]]></command>
|
<command><![CDATA[/etc/init.d/nscd restart]]></command>
|
||||||
<!-- clear group chache -->
|
<!-- clear group cache -->
|
||||||
<command><![CDATA[nscd --invalidate=group]]></command>
|
<command><![CDATA[nscd --invalidate=group]]></command>
|
||||||
</daemon>
|
</daemon>
|
||||||
<!-- Logrotate -->
|
<!-- Logrotate -->
|
||||||
@@ -3772,7 +3772,7 @@ aliases: files
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -377,7 +377,7 @@ exit "$RETVAL"
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -920,7 +920,7 @@ gmysql-password=
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -2217,7 +2217,7 @@ debugger_command =
|
|||||||
# >$config_directory/$process_name.$process_id.log & sleep 5
|
# >$config_directory/$process_name.$process_id.log & sleep 5
|
||||||
#
|
#
|
||||||
# Another possibility is to run gdb under a detached screen session.
|
# Another possibility is to run gdb under a detached screen session.
|
||||||
# To attach to the screen sesssion, su root and run "screen -r
|
# To attach to the screen session, su root and run "screen -r
|
||||||
# <id_string>" where <id_string> uniquely matches one of the detached
|
# <id_string>" where <id_string> uniquely matches one of the detached
|
||||||
# sessions (from "screen -list").
|
# sessions (from "screen -list").
|
||||||
#
|
#
|
||||||
@@ -2631,7 +2631,7 @@ driver = mysql
|
|||||||
# settings, like: host=sql1.host.org host=sql2.host.org
|
# settings, like: host=sql1.host.org host=sql2.host.org
|
||||||
#
|
#
|
||||||
# pgsql:
|
# pgsql:
|
||||||
# For available options, see the PostgreSQL documention for the
|
# For available options, see the PostgreSQL documentation for the
|
||||||
# PQconnectdb function of libpq.
|
# PQconnectdb function of libpq.
|
||||||
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
||||||
# create to pgsql.
|
# create to pgsql.
|
||||||
@@ -3696,7 +3696,7 @@ protocol sieve {
|
|||||||
#
|
#
|
||||||
# If you want UIDL compatibility with other POP3 servers, use:
|
# If you want UIDL compatibility with other POP3 servers, use:
|
||||||
# UW's ipop3d : %08Xv%08Xu
|
# UW's ipop3d : %08Xv%08Xu
|
||||||
# Courier : %f or %v-%u (both might be used simultaneosly)
|
# Courier : %f or %v-%u (both might be used simultaneously)
|
||||||
# Cyrus (<= 2.1.3) : %u
|
# Cyrus (<= 2.1.3) : %u
|
||||||
# Cyrus (>= 2.1.4) : %v.%u
|
# Cyrus (>= 2.1.4) : %v.%u
|
||||||
# Dovecot v0.99.x : %v.%u
|
# Dovecot v0.99.x : %v.%u
|
||||||
@@ -3954,7 +3954,7 @@ Port 21
|
|||||||
# PassivePorts 49152 65534
|
# PassivePorts 49152 65534
|
||||||
|
|
||||||
# If your host was NATted, this option is useful in order to
|
# If your host was NATted, this option is useful in order to
|
||||||
# allow passive tranfers to work. You have to use your public
|
# allow passive transfers to work. You have to use your public
|
||||||
# address and opening the passive ports used on your firewall as well.
|
# address and opening the passive ports used on your firewall as well.
|
||||||
# MasqueradeAddress 1.2.3.4
|
# MasqueradeAddress 1.2.3.4
|
||||||
|
|
||||||
@@ -3979,7 +3979,7 @@ Group nogroup
|
|||||||
# Umask 022 is a good standard umask to prevent new files and dirs
|
# Umask 022 is a good standard umask to prevent new files and dirs
|
||||||
# (second parm) from being group and world writable.
|
# (second parm) from being group and world writable.
|
||||||
Umask 022 022
|
Umask 022 022
|
||||||
# Normally, we want files to be overwriteable.
|
# Normally, we want files to be overwritable.
|
||||||
AllowOverwrite on
|
AllowOverwrite on
|
||||||
|
|
||||||
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
||||||
@@ -4226,7 +4226,7 @@ SQLBackend mysql
|
|||||||
SQLEngine on
|
SQLEngine on
|
||||||
SQLAuthenticate on
|
SQLAuthenticate on
|
||||||
#
|
#
|
||||||
# Use both a crypted or plaintext password
|
# Use both an encrypted or plaintext password
|
||||||
SQLAuthTypes Crypt
|
SQLAuthTypes Crypt
|
||||||
|
|
||||||
SQLAuthenticate users* groups*
|
SQLAuthenticate users* groups*
|
||||||
@@ -4284,7 +4284,7 @@ TLSVerifyClient off
|
|||||||
#TLSRequired on
|
#TLSRequired on
|
||||||
|
|
||||||
# Allow SSL/TLS renegotiations when the client requests them, but
|
# Allow SSL/TLS renegotiations when the client requests them, but
|
||||||
# do not force the renegotations. Some clients do not support
|
# do not force the renegotiations. Some clients do not support
|
||||||
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
||||||
# clients will close the data connection, or there will be a timeout
|
# clients will close the data connection, or there will be a timeout
|
||||||
# on an idle data connection.
|
# on an idle data connection.
|
||||||
@@ -4584,7 +4584,7 @@ aliases: files
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -388,7 +388,7 @@ exit "$RETVAL"
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -931,7 +931,7 @@ gmysql-password=
|
|||||||
# allow-axfr-ips Allow zonetransfers only to these subnets
|
# allow-axfr-ips Allow zonetransfers only to these subnets
|
||||||
#
|
#
|
||||||
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
|
||||||
# add these entries to the list if any speficied: <AXFRSERVERS>
|
# add these entries to the list if any specified: <AXFRSERVERS>
|
||||||
|
|
||||||
#################################
|
#################################
|
||||||
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
|
||||||
@@ -2228,7 +2228,7 @@ debugger_command =
|
|||||||
# >$config_directory/$process_name.$process_id.log & sleep 5
|
# >$config_directory/$process_name.$process_id.log & sleep 5
|
||||||
#
|
#
|
||||||
# Another possibility is to run gdb under a detached screen session.
|
# Another possibility is to run gdb under a detached screen session.
|
||||||
# To attach to the screen sesssion, su root and run "screen -r
|
# To attach to the screen session, su root and run "screen -r
|
||||||
# <id_string>" where <id_string> uniquely matches one of the detached
|
# <id_string>" where <id_string> uniquely matches one of the detached
|
||||||
# sessions (from "screen -list").
|
# sessions (from "screen -list").
|
||||||
#
|
#
|
||||||
@@ -2642,7 +2642,7 @@ driver = mysql
|
|||||||
# settings, like: host=sql1.host.org host=sql2.host.org
|
# settings, like: host=sql1.host.org host=sql2.host.org
|
||||||
#
|
#
|
||||||
# pgsql:
|
# pgsql:
|
||||||
# For available options, see the PostgreSQL documention for the
|
# For available options, see the PostgreSQL documentation for the
|
||||||
# PQconnectdb function of libpq.
|
# PQconnectdb function of libpq.
|
||||||
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
# Use maxconns=n (default 5) to change how many connections Dovecot can
|
||||||
# create to pgsql.
|
# create to pgsql.
|
||||||
@@ -3707,7 +3707,7 @@ protocol sieve {
|
|||||||
#
|
#
|
||||||
# If you want UIDL compatibility with other POP3 servers, use:
|
# If you want UIDL compatibility with other POP3 servers, use:
|
||||||
# UW's ipop3d : %08Xv%08Xu
|
# UW's ipop3d : %08Xv%08Xu
|
||||||
# Courier : %f or %v-%u (both might be used simultaneosly)
|
# Courier : %f or %v-%u (both might be used simultaneously)
|
||||||
# Cyrus (<= 2.1.3) : %u
|
# Cyrus (<= 2.1.3) : %u
|
||||||
# Cyrus (>= 2.1.4) : %v.%u
|
# Cyrus (>= 2.1.4) : %v.%u
|
||||||
# Dovecot v0.99.x : %v.%u
|
# Dovecot v0.99.x : %v.%u
|
||||||
@@ -3965,7 +3965,7 @@ Port 21
|
|||||||
# PassivePorts 49152 65534
|
# PassivePorts 49152 65534
|
||||||
|
|
||||||
# If your host was NATted, this option is useful in order to
|
# If your host was NATted, this option is useful in order to
|
||||||
# allow passive tranfers to work. You have to use your public
|
# allow passive transfers to work. You have to use your public
|
||||||
# address and opening the passive ports used on your firewall as well.
|
# address and opening the passive ports used on your firewall as well.
|
||||||
# MasqueradeAddress 1.2.3.4
|
# MasqueradeAddress 1.2.3.4
|
||||||
|
|
||||||
@@ -3990,7 +3990,7 @@ Group nogroup
|
|||||||
# Umask 022 is a good standard umask to prevent new files and dirs
|
# Umask 022 is a good standard umask to prevent new files and dirs
|
||||||
# (second parm) from being group and world writable.
|
# (second parm) from being group and world writable.
|
||||||
Umask 022 022
|
Umask 022 022
|
||||||
# Normally, we want files to be overwriteable.
|
# Normally, we want files to be overwritable.
|
||||||
AllowOverwrite on
|
AllowOverwrite on
|
||||||
|
|
||||||
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
|
||||||
@@ -4237,7 +4237,7 @@ SQLBackend mysql
|
|||||||
SQLEngine on
|
SQLEngine on
|
||||||
SQLAuthenticate on
|
SQLAuthenticate on
|
||||||
#
|
#
|
||||||
# Use both a crypted or plaintext password
|
# Use both an encrypted or plaintext password
|
||||||
SQLAuthTypes Crypt
|
SQLAuthTypes Crypt
|
||||||
|
|
||||||
SQLAuthenticate users* groups*
|
SQLAuthenticate users* groups*
|
||||||
@@ -4295,7 +4295,7 @@ TLSVerifyClient off
|
|||||||
#TLSRequired on
|
#TLSRequired on
|
||||||
|
|
||||||
# Allow SSL/TLS renegotiations when the client requests them, but
|
# Allow SSL/TLS renegotiations when the client requests them, but
|
||||||
# do not force the renegotations. Some clients do not support
|
# do not force the renegotiations. Some clients do not support
|
||||||
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
|
||||||
# clients will close the data connection, or there will be a timeout
|
# clients will close the data connection, or there will be a timeout
|
||||||
# on an idle data connection.
|
# on an idle data connection.
|
||||||
@@ -4595,7 +4595,7 @@ aliases: files
|
|||||||
chmod="0644">
|
chmod="0644">
|
||||||
<content><![CDATA[
|
<content><![CDATA[
|
||||||
#
|
#
|
||||||
# Froxlor logrotate snipet
|
# Froxlor logrotate snippet
|
||||||
#
|
#
|
||||||
<CUSTOMER_LOGS>*.log {
|
<CUSTOMER_LOGS>*.log {
|
||||||
missingok
|
missingok
|
||||||
|
|||||||
@@ -265,7 +265,7 @@ if (isset($s) && $s != "" && $nosession != 1) {
|
|||||||
}
|
}
|
||||||
|
|
||||||
/**
|
/**
|
||||||
* Language Managament
|
* Language Management
|
||||||
*/
|
*/
|
||||||
$langs = array();
|
$langs = array();
|
||||||
$languages = array();
|
$languages = array();
|
||||||
@@ -279,7 +279,7 @@ while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
|||||||
$langs[$row['language']][] = $row;
|
$langs[$row['language']][] = $row;
|
||||||
// check for row[iso] cause older froxlor
|
// check for row[iso] cause older froxlor
|
||||||
// versions didn't have that and it will
|
// versions didn't have that and it will
|
||||||
// lead to a lot of undfined variables
|
// lead to a lot of undefined variables
|
||||||
// before the admin can even update
|
// before the admin can even update
|
||||||
if (isset($row['iso'])) {
|
if (isset($row['iso'])) {
|
||||||
$iso[$row['iso']] = $row['language'];
|
$iso[$row['iso']] = $row['language'];
|
||||||
|
|||||||
@@ -923,7 +923,7 @@ $lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Default vHost-settin
|
|||||||
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
|
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
|
||||||
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
|
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
|
||||||
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
|
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
|
||||||
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentification, set this only if you know what it is.';
|
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentication, set this only if you know what it is.';
|
||||||
|
|
||||||
$lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
|
$lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
|
||||||
|
|
||||||
@@ -1598,7 +1598,7 @@ $lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete cer
|
|||||||
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
|
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
|
||||||
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
|
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
|
||||||
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
|
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
|
||||||
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentification, set this only if you know what it is.';
|
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentication, set this only if you know what it is.';
|
||||||
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
|
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
|
||||||
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
|
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
|
||||||
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
|
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
|
||||||
@@ -1608,7 +1608,7 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
|
|||||||
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
|
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
|
||||||
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
|
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
|
||||||
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
|
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
|
||||||
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regulary so avoid storing data in there manually.</div>';
|
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||||
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
|
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
|
||||||
|
|
||||||
// Added in Froxlor 0.9.30
|
// Added in Froxlor 0.9.30
|
||||||
@@ -1914,7 +1914,7 @@ $lng['dnseditor']['records'] = 'záznamy';
|
|||||||
$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
|
$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
|
||||||
$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
|
$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
|
||||||
$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
|
$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
|
||||||
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are prefered, only missing entries will be automatically generated.';
|
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.';
|
||||||
$lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
|
$lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
|
||||||
$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
|
$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
|
||||||
|
|
||||||
@@ -1928,7 +1928,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Select i
|
|||||||
|
|
||||||
// Added in froxlor 0.9.38-rc1
|
// Added in froxlor 0.9.38-rc1
|
||||||
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users';
|
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users';
|
||||||
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Please note: Shell access allows the user to execute various binaries on your system. Use with extrem caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
|
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Please note: Shell access allows the user to execute various binaries on your system. Use with extreme caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
|
||||||
$lng['serversettings']['available_shells']['title'] = 'List of available shells';
|
$lng['serversettings']['available_shells']['title'] = 'List of available shells';
|
||||||
$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.<br><br>Note that the default shell <strong>/bin/false</strong> will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case';
|
$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.<br><br>Note that the default shell <strong>/bin/false</strong> will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case';
|
||||||
$lng['panel']['shell'] = 'Shell';
|
$lng['panel']['shell'] = 'Shell';
|
||||||
@@ -1989,7 +1989,7 @@ $lng['serversettings']['leapiversion']['title'] = "Choose Let's Encrypt ACME imp
|
|||||||
$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
|
$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
|
||||||
$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
|
$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
|
||||||
$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
|
$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
|
||||||
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protcol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
|
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protocol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
|
||||||
$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
|
$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
|
||||||
$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
|
$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
|
||||||
$lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
|
$lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
|
||||||
|
|||||||
@@ -926,7 +926,7 @@ $lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Default vHost-settin
|
|||||||
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
|
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
|
||||||
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
|
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
|
||||||
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
|
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
|
||||||
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentification, set this only if you know what it is.';
|
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentication, set this only if you know what it is.';
|
||||||
|
|
||||||
$lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
|
$lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
|
||||||
|
|
||||||
@@ -1601,7 +1601,7 @@ $lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete cer
|
|||||||
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
|
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
|
||||||
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
|
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
|
||||||
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
|
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
|
||||||
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentification, set this only if you know what it is.';
|
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentication, set this only if you know what it is.';
|
||||||
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
|
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
|
||||||
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
|
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
|
||||||
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
|
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
|
||||||
@@ -1611,7 +1611,7 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
|
|||||||
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
|
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
|
||||||
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
|
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
|
||||||
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
|
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
|
||||||
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regulary so avoid storing data in there manually.</div>';
|
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||||
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
|
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
|
||||||
|
|
||||||
// Added in Froxlor 0.9.30
|
// Added in Froxlor 0.9.30
|
||||||
@@ -1918,7 +1918,7 @@ $lng['dnseditor']['records'] = 'records';
|
|||||||
$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
|
$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
|
||||||
$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
|
$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
|
||||||
$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
|
$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
|
||||||
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are prefered, only missing entries will be automatically generated.';
|
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.';
|
||||||
$lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
|
$lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
|
||||||
$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
|
$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
|
||||||
|
|
||||||
@@ -1993,7 +1993,7 @@ $lng['serversettings']['leapiversion']['title'] = "Choose Let's Encrypt ACME imp
|
|||||||
$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
|
$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
|
||||||
$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
|
$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
|
||||||
$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
|
$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
|
||||||
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protcol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
|
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protocol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
|
||||||
$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
|
$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
|
||||||
$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
|
$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
|
||||||
$lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
|
$lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
|
||||||
|
|||||||
6
templates/Sparkle/assets/js/circular.js
vendored
6
templates/Sparkle/assets/js/circular.js
vendored
@@ -56,7 +56,7 @@ $(document).ready(function() {
|
|||||||
|
|
||||||
// Draw percentages
|
// Draw percentages
|
||||||
if (!isNaN(assigned) && available == "∞") {
|
if (!isNaN(assigned) && available == "∞") {
|
||||||
// Unlimited ressource and assigned
|
// Unlimited resource and assigned
|
||||||
if (assigned > used) {
|
if (assigned > used) {
|
||||||
// Draw assigned as full circle
|
// Draw assigned as full circle
|
||||||
circularCircle(canvas, 38, 0, 270, 4, assiColor);
|
circularCircle(canvas, 38, 0, 270, 4, assiColor);
|
||||||
@@ -77,7 +77,7 @@ $(document).ready(function() {
|
|||||||
}
|
}
|
||||||
circularText(canvas, 60, 42, 26, "∞");
|
circularText(canvas, 60, 42, 26, "∞");
|
||||||
} else if (!isNaN(assigned)) {
|
} else if (!isNaN(assigned)) {
|
||||||
// Limited ressources but assigned
|
// Limited resources but assigned
|
||||||
available = parseFloat(available);
|
available = parseFloat(available);
|
||||||
|
|
||||||
assignedP = Math.round(100 / available * assigned);
|
assignedP = Math.round(100 / available * assigned);
|
||||||
@@ -92,7 +92,7 @@ $(document).ready(function() {
|
|||||||
circularCircle(canvas, 40, 0, 270, 8, unliColor);
|
circularCircle(canvas, 40, 0, 270, 8, unliColor);
|
||||||
circularText(canvas, 60, 42, 26, "∞");
|
circularText(canvas, 60, 42, 26, "∞");
|
||||||
} else {
|
} else {
|
||||||
// Limited ressources
|
// Limited resources
|
||||||
available = parseFloat(available);
|
available = parseFloat(available);
|
||||||
usedP = 100 / available * used;
|
usedP = 100 / available * used;
|
||||||
if (usedP < 1 && usedP > 0) {
|
if (usedP < 1 && usedP > 0) {
|
||||||
|
|||||||
Reference in New Issue
Block a user