maketank/Froxlor
2
0
Fork 0
Code Pull Requests Releases Activity

prepare ssl-per-domain (customer setable), no cronjob-functionality yet (intended), refs #365

Browse Source 
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
This commit is contained in:
Michael Kaufmann (d00p)
2013-05-14 17:26:30 +02:00
parent 14e9b81995
commit 42b201c54d
13 changed files with 315 additions and 4 deletions
Download Patch File Download Diff File Expand all files Collapse all files

14
lng/english.lng.php
View File

@@ -1942,3 +1942,17 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Allow admins to chan
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Allow customers to change the theme';
$lng['serversettings']['axfrservers']['title'] = 'AXFR servers';
$lng['serversettings']['axfrservers']['description'] = 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.';
$lng['panel']['ssleditor'] = 'SSL settings for this domain';
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete certificate content in the textbox';
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chainfile (optional)';
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
$lng['error']['sslcertificatewrongdomain'] = 'The given certificate does not belong to this domain';
$lng['error']['sslcertificateinvalidcert'] = 'The given certificate-content does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does not belong to the given certificate';
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?';