prepare ssl-per-domain (customer setable), no cronjob-functionality yet (intended), refs #365
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
This commit is contained in:
@@ -94,6 +94,15 @@ return array(
|
||||
'default' => '/var/customers/logs/',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'system_customersslpath' => array(
|
||||
'label' => $lng['serversettings']['customerssl_directory'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'customer_ssl_path',
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/etc/apache2/ssl/',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'system_phpappendopenbasedir' => array(
|
||||
'label' => $lng['serversettings']['phpappendopenbasedir'],
|
||||
'settinggroup' => 'system',
|
||||
|
||||
@@ -151,6 +151,15 @@ elseif($page == 'domains')
|
||||
$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
|
||||
}
|
||||
|
||||
// get ssl-ips if activated
|
||||
// FIXME for multi-ip later
|
||||
$show_ssledit = false;
|
||||
if ($settings['system']['use_ssl'] == '1'
|
||||
&& $row['ssl_ipandport'] != 0
|
||||
&& $row['caneditdomain'] == '1'
|
||||
) {
|
||||
$show_ssledit = true;
|
||||
}
|
||||
$row = htmlentities_array($row);
|
||||
eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
|
||||
}
|
||||
@@ -634,5 +643,124 @@ elseif($page == 'domains')
|
||||
}
|
||||
}
|
||||
}
|
||||
elseif ($page == 'domainssleditor') {
|
||||
|
||||
if ($action == ''
|
||||
|| $action == 'view'
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
|
||||
$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
|
||||
$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
|
||||
$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
|
||||
$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
|
||||
|
||||
if ($ssl_cert_file != '' && $ssl_key_file == '') {
|
||||
standard_error('sslcertificateismissingprivatekey');
|
||||
}
|
||||
|
||||
$do_verify = true;
|
||||
|
||||
// no cert-file given -> forget everything
|
||||
if ($ssl_cert_file == '') {
|
||||
$ssl_key_file = '';
|
||||
$ssl_ca_file = '';
|
||||
$ssl_cert_chainfile = '';
|
||||
$do_verify = false;
|
||||
}
|
||||
|
||||
// verify certificate content
|
||||
if ($do_verify) {
|
||||
// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
|
||||
// openssl_x509_parse() returns information about the supplied x509cert, including fields such as
|
||||
// subject name, issuer name, purposes, valid from and valid to dates etc.
|
||||
$cert_content = openssl_x509_parse($ssl_cert_file);
|
||||
|
||||
if (is_array($cert_content)
|
||||
&& isset($cert_content['subject'])
|
||||
&& isset($cert_content['subject']['CN'])
|
||||
) {
|
||||
// TODO self-signed certs might differ and don't need/want this
|
||||
/*
|
||||
$domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'");
|
||||
if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) {
|
||||
standard_error('sslcertificatewrongdomain');
|
||||
}
|
||||
*/
|
||||
|
||||
// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
|
||||
// Checks whether the given key is the private key that corresponds to cert.
|
||||
if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
|
||||
standard_error('sslcertificateinvalidcertkeypair');
|
||||
}
|
||||
|
||||
// check optional stuff
|
||||
if ($ssl_ca_file != '') {
|
||||
$ca_content = openssl_x509_parse($ssl_ca_file);
|
||||
if (!is_array($ca_content)) {
|
||||
// invalid
|
||||
standard_error('sslcertificateinvalidca');
|
||||
}
|
||||
}
|
||||
if ($ssl_cert_chainfile != '') {
|
||||
$chain_content = openssl_x509_parse($ssl_cert_chainfile);
|
||||
if (!is_array($chain_content)) {
|
||||
// invalid
|
||||
standard_error('sslcertificateinvalidchain');
|
||||
}
|
||||
}
|
||||
} else {
|
||||
standard_error('sslcertificateinvalidcert');
|
||||
}
|
||||
}
|
||||
|
||||
// Add/Update database entry
|
||||
$qrystart = "UPDATE ";
|
||||
$qrywhere = "WHERE ";
|
||||
if ($do_insert) {
|
||||
$qrystart = "INSERT INTO ";
|
||||
$qrywhere = ", ";
|
||||
}
|
||||
$db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
|
||||
`ssl_cert_file` = '".$db->escape($ssl_cert_file)."',
|
||||
`ssl_key_file` = '".$db->escape($ssl_key_file)."',
|
||||
`ssl_ca_file` = '".$db->escape($ssl_ca_file)."',
|
||||
`ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."'
|
||||
".$qrywhere." `domainid`='".(int)$id."';"
|
||||
);
|
||||
|
||||
// back to domain overview
|
||||
redirectTo($filename, array('page' => 'domains', 's' => $s));
|
||||
}
|
||||
|
||||
$result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
|
||||
WHERE `domainid`='".(int)$id."';"
|
||||
);
|
||||
|
||||
$do_insert = false;
|
||||
// if no entry can be found, behave like we have empty values
|
||||
if (!is_array($result) || !isset($result['ssl_cert_file'])) {
|
||||
$result = array(
|
||||
'ssl_cert_file' => '',
|
||||
'ssl_key_file' => '',
|
||||
'ssl_ca_file' => '',
|
||||
'ssl_cert_chainfile' => ''
|
||||
);
|
||||
$do_insert = true;
|
||||
}
|
||||
|
||||
$result = htmlentities_array($result);
|
||||
|
||||
$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
|
||||
$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
|
||||
|
||||
$title = $ssleditor_data['domain_ssleditor']['title'];
|
||||
$image = $ssleditor_data['domain_ssleditor']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
?>
|
||||
|
||||
@@ -512,6 +512,7 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('system', 'documentroot_use_default_value', '0'),
|
||||
('system', 'passwordcryptfunc', '1'),
|
||||
('system', 'axfrservers', ''),
|
||||
('system', 'customer_ssl_path', '/etc/apache2/ssl/'),
|
||||
('panel', 'decimal_places', '4'),
|
||||
('panel', 'adminmail', 'admin@SERVERNAME'),
|
||||
('panel', 'phpmyadmin_url', ''),
|
||||
@@ -539,7 +540,7 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('panel', 'phpconfigs_hidestdsubdomain', '0'),
|
||||
('panel', 'allow_theme_change_admin', '1'),
|
||||
('panel', 'allow_theme_change_customer', '1'),
|
||||
('panel', 'version', '0.9.29-dev3');
|
||||
('panel', 'version', '0.9.29-dev4');
|
||||
|
||||
|
||||
|
||||
@@ -917,3 +918,13 @@ CREATE TABLE IF NOT EXISTS `domain_docrootsettings` (
|
||||
PRIMARY KEY (`id`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
DROP TABLE IF EXISTS `domain_ssl_settings`;
|
||||
CREATE TABLE IF NOT EXISTS `domain_ssl_settings` (
|
||||
`id` int(5) NOT NULL auto_increment,
|
||||
`domainid` int(11) NOT NULL,
|
||||
`ssl_cert_file` text NOT NULL,
|
||||
`ssl_key_file` text NOT NULL,
|
||||
`ssl_ca_file` text NOT NULL,
|
||||
`ssl_cert_chainfile` text NOT NULL,
|
||||
PRIMARY KEY (`id`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
@@ -2109,3 +2109,24 @@ if (isFroxlorVersion('0.9.29-dev2')) {
|
||||
|
||||
updateToVersion('0.9.29-dev3');
|
||||
}
|
||||
|
||||
if (isFroxlorVersion('0.9.29-dev3')) {
|
||||
showUpdateStep("Updating from 0.9.29-dev3 to 0.9.29-dev4", true);
|
||||
lastStepStatus(0);
|
||||
|
||||
showUpdateStep("Adding new tables to database");
|
||||
$db->query("CREATE TABLE IF NOT EXISTS `domain_ssl_settings` (
|
||||
`id` int(5) NOT NULL auto_increment,
|
||||
`domainid` int(11) NOT NULL,
|
||||
`ssl_cert_file` text NOT NULL,
|
||||
`ssl_key_file` text NOT NULL,
|
||||
`ssl_ca_file` text NOT NULL,
|
||||
`ssl_cert_chainfile` text NOT NULL,
|
||||
PRIMARY KEY (`id`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;");
|
||||
lastStepStatus(0);
|
||||
|
||||
$system_customersslpath = isset($_POST['system_customersslpath']) ? makeCorrectDir($_POST['system_customersslpath']) : '/etc/apache2/ssl/';
|
||||
$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'customer_ssl_path', '".$db->escape($system_customersslpath)."');");
|
||||
updateToVersion('0.9.29-dev4');
|
||||
}
|
||||
|
||||
@@ -52,4 +52,3 @@ function versionInUpdate($current_version, $version_to_check)
|
||||
|
||||
return (version_compare2($current_version, $version_to_check) == -1 ? true : false);
|
||||
}
|
||||
|
||||
|
||||
@@ -533,4 +533,12 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
|
||||
$question.= '<input type="text" class="text" name="system_afxrservers" value="" />';
|
||||
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
|
||||
}
|
||||
|
||||
if (versionInUpdate($current_version, '0.9.29-dev4')) {
|
||||
$has_preconfig = true;
|
||||
$description = 'As customers can now specify ssl-certificate data for their domains, you need to specify where the generated files are stored<br />';
|
||||
$question = '<strong>Specify the directory for customer ssl-certificates:</strong> ';
|
||||
$question.= '<input type="text" class="text" name="system_customersslpath" value="/etc/apache2/ssl/" />';
|
||||
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
@@ -0,0 +1,67 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Formfields
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'domain_ssleditor' => array(
|
||||
'title' => $lng['panel']['ssleditor'],
|
||||
'image' => 'icons/ssl.png',
|
||||
'sections' => array(
|
||||
'section_a' => array(
|
||||
'title' => 'SSL certificates',
|
||||
'image' => 'icons/ssl.png',
|
||||
'fields' => array(
|
||||
'ssl_cert_file' => array(
|
||||
'style' => 'vertical-align:top;',
|
||||
'label' => $lng['admin']['ipsandports']['ssl_cert_file_content'],
|
||||
'desc' => $lng['admin']['ipsandports']['ssl_paste_description'],
|
||||
'type' => 'textarea',
|
||||
'cols' => 60,
|
||||
'rows' => 12,
|
||||
'value' => $result['ssl_cert_file']
|
||||
),
|
||||
'ssl_key_file' => array(
|
||||
'style' => 'vertical-align:top;',
|
||||
'label' => $lng['admin']['ipsandports']['ssl_key_file_content'],
|
||||
'desc' => $lng['admin']['ipsandports']['ssl_paste_description'],
|
||||
'type' => 'textarea',
|
||||
'cols' => 60,
|
||||
'rows' => 12,
|
||||
'value' => $result['ssl_key_file']
|
||||
),
|
||||
'ssl_ca_file' => array(
|
||||
'style' => 'vertical-align:top;',
|
||||
'label' => $lng['admin']['ipsandports']['ssl_ca_file_content'],
|
||||
'desc' => $lng['admin']['ipsandports']['ssl_paste_description'],
|
||||
'type' => 'textarea',
|
||||
'cols' => 60,
|
||||
'rows' => 12,
|
||||
'value' => $result['ssl_ca_file']
|
||||
),
|
||||
'ssl_cert_chainfile' => array(
|
||||
'style' => 'vertical-align:top;',
|
||||
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile_content'],
|
||||
'desc' => $lng['admin']['ipsandports']['ssl_paste_description'],
|
||||
'type' => 'textarea',
|
||||
'cols' => 60,
|
||||
'rows' => 12,
|
||||
'value' => $result['ssl_cert_chainfile']
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
@@ -54,6 +54,7 @@ define('TABLE_PANEL_REDIRECTCODES', 'redirect_codes');
|
||||
define('TABLE_PANEL_DOMAINREDIRECTS', 'domain_redirect_codes');
|
||||
define('TABLE_PANEL_IPDOCROOTSETTINGS', 'ipsandports_docrootsettings');
|
||||
define('TABLE_PANEL_DOMDOCROOTSETTINGS', 'domain_docrootsettings');
|
||||
define('TABLE_PANEL_DOMAIN_SSL_SETTINGS', 'domain_ssl_settings');
|
||||
|
||||
// APS constants
|
||||
|
||||
@@ -73,6 +74,6 @@ define('PACKAGE_ENABLED', 2);
|
||||
|
||||
// VERSION INFO
|
||||
|
||||
$version = '0.9.29-dev3';
|
||||
$version = '0.9.29-dev4';
|
||||
$dbversion = '2';
|
||||
$branding = '';
|
||||
|
||||
@@ -1942,3 +1942,17 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Allow admins to chan
|
||||
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Allow customers to change the theme';
|
||||
$lng['serversettings']['axfrservers']['title'] = 'AXFR servers';
|
||||
$lng['serversettings']['axfrservers']['description'] = 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.';
|
||||
$lng['panel']['ssleditor'] = 'SSL settings for this domain';
|
||||
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete certificate content in the textbox';
|
||||
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
|
||||
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
|
||||
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
|
||||
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chainfile (optional)';
|
||||
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
|
||||
$lng['error']['sslcertificatewrongdomain'] = 'The given certificate does not belong to this domain';
|
||||
$lng['error']['sslcertificateinvalidcert'] = 'The given certificate-content does not seem to be a valid certificate';
|
||||
$lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does not belong to the given certificate';
|
||||
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
|
||||
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
|
||||
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?';
|
||||
|
||||
@@ -1663,3 +1663,17 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Erlaube Admins das T
|
||||
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Erlaube Kunden das Theme zu wechseln';
|
||||
$lng['serversettings']['axfrservers']['title'] = 'AXFR Server';
|
||||
$lng['serversettings']['axfrservers']['description'] = 'Eine komma-getrennte Liste von IP Adressen, die DNS Zonen transferieren dürfen (AXFR).';
|
||||
$lng['panel']['ssleditor'] = 'SSL Einstellungen für diese Domain';
|
||||
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Bitte den Inhalt der Zertifikatsdatei in das Textfeld kopieren';
|
||||
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Inhalt des SSL Zertifikats';
|
||||
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Inhalt der Key-Datei (private key)';
|
||||
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Inhalt der SSL CA Datei (optional)';
|
||||
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Inhalt des Zertifikats-chainfile (optional)';
|
||||
$lng['error']['sslcertificateismissingprivatekey'] = 'Für das Zertifikat muss eine Key-Datei (private key) angegeben werden';
|
||||
$lng['error']['sslcertificatewrongdomain'] = 'Das angegebene Zertifikat gilt nicht für die gewählte Domain';
|
||||
$lng['error']['sslcertificateinvalidcert'] = 'Der angegebene Zertifikatsinhalt scheint kein gültiges Zertifikat zu sein';
|
||||
$lng['error']['sslcertificateinvalidcertkeypair'] = 'Der angegebene Key (private-key) gehört nicht zum angegebenen Zertifikat';
|
||||
$lng['error']['sslcertificateinvalidca'] = 'Die angegebenen CA Zertifikatsdaten scheinen kein gültiges Zertifikat zu sein';
|
||||
$lng['error']['sslcertificateinvalidchain'] = 'Die angegebenen Zertifikats-Chain-Daten scheinen kein gültiges Zertifikat zu sein';
|
||||
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver Kunden-SSL Zertifikats-Verzeichnis';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Wo sollen kundenspezifizierte SSL Zertifikate erstellt werden?';
|
||||
|
||||
BIN
templates/Froxlor/assets/img/icons/ssl.png
Normal file
BIN
templates/Froxlor/assets/img/icons/ssl.png
Normal file
Binary file not shown.
|
After Width: | Height: | Size: 521 B |
34
templates/Froxlor/customer/domains/domain_ssleditor.tpl
Normal file
34
templates/Froxlor/customer/domains/domain_ssleditor.tpl
Normal file
@@ -0,0 +1,34 @@
|
||||
$header
|
||||
<article>
|
||||
<header>
|
||||
<h2>
|
||||
<img src="templates/{$theme}/assets/img/{$image}" alt="{$title}" />
|
||||
{$title}
|
||||
</h2>
|
||||
</header>
|
||||
|
||||
<section class="fullform bradiusodd">
|
||||
|
||||
<form action="{$linker->getLink(array('section' => 'domains'))}" method="post" enctype="application/x-www-form-urlencoded">
|
||||
<fieldset>
|
||||
<legend>Froxlor - {$title}</legend>
|
||||
|
||||
<table class="formtable">
|
||||
{$ssleditor_form}
|
||||
</table>
|
||||
|
||||
<p style="display: none;">
|
||||
<if $do_insert == 1>
|
||||
<input type="hidden" name="do_insert" value="1" />
|
||||
</if>
|
||||
<input type="hidden" name="s" value="$s" />
|
||||
<input type="hidden" name="page" value="$page" />
|
||||
<input type="hidden" name="action" value="$action" />
|
||||
<input type="hidden" name="id" value="$id" />
|
||||
<input type="hidden" name="send" value="send" />
|
||||
</p>
|
||||
</fieldset>
|
||||
</form>
|
||||
</section>
|
||||
</article>
|
||||
$footer
|
||||
@@ -15,6 +15,11 @@
|
||||
<img src="templates/{$theme}/assets/img/icons/delete.png" alt="{$lng['panel']['delete']}" />
|
||||
</a>
|
||||
</if>
|
||||
<if $show_ssledit == 1>
|
||||
<a href="{$linker->getLink(array('section' => 'domains', 'page' => 'domainssleditor', 'action' => 'view', 'id' => $row['id']))}" style="text-decoration:none;">
|
||||
<img src="templates/{$theme}/assets/img/icons/ssl.png" alt="{$lng['panel']['ssleditor']}" />
|
||||
</a>
|
||||
</if>
|
||||
<if $row['parentdomainid'] == '0' && !(isset($row['domainaliasid']) && $row['domainaliasid'] != 0)>
|
||||
({$lng['domains']['isassigneddomain']})
|
||||
</if>
|
||||
|
||||
Reference in New Issue
Block a user