From 5d08d5235d97b72f00f9be79d3387c11adcd8d41 Mon Sep 17 00:00:00 2001 From: envoyr Date: Thu, 28 Apr 2022 16:49:11 +0200 Subject: [PATCH] major changes in language management and installer --- .github/LICENSE_HEADER | 22 + .gitignore | 1 + admin_apcuinfo.php | 118 +- admin_opcacheinfo.php | 29 +- install/{froxlor.sql => froxlor.sql.php} | 78 +- install/install.php | 47 +- install/lib/class.FroxlorInstall.php | 2 +- lib/Froxlor/FileDir.php | 143 +- lib/Froxlor/Install/Install.php | 109 + lib/Froxlor/Language.php | 117 + lib/formfields/install/formfield.install.php | 178 ++ lib/functions.php | 36 + lib/init.php | 105 +- lng/cz.lng.php | 873 +++++++ lng/czech.lng.php | 916 ------- lng/de.lng.php | 2096 +++++++++++++++ lng/dutch.lng.php | 1103 -------- lng/en.lng.php | 2451 ++++++++++++++++++ lng/english.lng.php | 2172 ---------------- lng/fr.lng.php | 778 ++++++ lng/french.lng.php | 763 ------ lng/german.lng.php | 1810 ------------- lng/it.lng.php | 1825 +++++++++++++ lng/italian.lng.php | 1665 ------------ lng/lng_references.php | 43 - lng/nl.lng.php | 1158 +++++++++ lng/portugues.lng.php | 745 ------ lng/pt.lng.php | 909 +++++++ lng/se.lng.php | 577 +++++ lng/swedish.lng.php | 572 ---- templates/Froxlor/form/formfields.html.twig | 7 + templates/Froxlor/install/index.html.twig | 105 +- templates/index.html | 0 33 files changed, 11444 insertions(+), 10109 deletions(-) create mode 100644 .github/LICENSE_HEADER rename install/{froxlor.sql => froxlor.sql.php} (97%) create mode 100644 lib/Froxlor/Install/Install.php create mode 100644 lib/Froxlor/Language.php create mode 100644 lib/formfields/install/formfield.install.php create mode 100644 lib/functions.php create mode 100644 lng/cz.lng.php delete mode 100644 lng/czech.lng.php create mode 100644 lng/de.lng.php delete mode 100644 lng/dutch.lng.php create mode 100644 lng/en.lng.php delete mode 100644 lng/english.lng.php create mode 100644 lng/fr.lng.php delete mode 100644 lng/french.lng.php delete mode 100644 lng/german.lng.php create mode 100644 lng/it.lng.php delete mode 100644 lng/italian.lng.php delete mode 100644 lng/lng_references.php create mode 100644 lng/nl.lng.php delete mode 100644 lng/portugues.lng.php create mode 100644 lng/pt.lng.php create mode 100644 lng/se.lng.php delete mode 100644 lng/swedish.lng.php create mode 100644 templates/index.html diff --git a/.github/LICENSE_HEADER b/.github/LICENSE_HEADER new file mode 100644 index 00000000..ea2ee538 --- /dev/null +++ b/.github/LICENSE_HEADER @@ -0,0 +1,22 @@ +/** + * This file is part of the Froxlor project. + * Copyright (c) 2010 the Froxlor Team (see authors). + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation; either version 2 + * of the License, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with this program; if not, you can also view it online at + * http://files.froxlor.org/misc/COPYING.txt + * + * @copyright the authors + * @author Froxlor team + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ diff --git a/.gitignore b/.gitignore index 02d868a6..b03345b3 100644 --- a/.gitignore +++ b/.gitignore @@ -16,6 +16,7 @@ vendor/ node_modules/ fonts/ templates/* +!templates/index.html !templates/Froxlor/ templates/Froxlor/assets/css/ templates/Froxlor/assets/js/ diff --git a/admin_apcuinfo.php b/admin_apcuinfo.php index 61f11bd1..c3a4e7cc 100644 --- a/admin_apcuinfo.php +++ b/admin_apcuinfo.php @@ -1,33 +1,38 @@ | - * | Rasmus Lerdorf | - * | Ilia Alshanetsky | - * +----------------------------------------------------------------------+ +/** + * This file is part of the Froxlor project. + * Copyright (c) 2010 the Froxlor Team (see authors). * - * All other licensing and usage conditions are those of the PHP Group. + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation; either version 2 + * of the License, or (at your option) any later version. * - * Based on https://github.com/krakjoe/apcu/blob/master/apc.php - * Implemented into Froxlor: Janos Muzsi + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. * + * You should have received a copy of the GNU General Public License + * along with this program; if not, you can also view it online at + * http://files.froxlor.org/misc/COPYING.txt + * + * @copyright the authors + * @author Froxlor team + * @author Janos Muzsi + * @author Ralf Becker + * @author Rasmus Lerdorf + * @author Ilia Alshanetsky + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + * + * Based on https://github.com/krakjoe/apcu/blob/master/apc.php, which is + * licensed under the PHP licence (version 3.01), which can be viewed + * online at https://www.php.net/license/3_01.txt */ +use Froxlor\UI\Panel\UI; + const AREA = 'admin'; require __DIR__ . '/lib/init.php'; @@ -37,9 +42,9 @@ if ($action == 'delete' && function_exists('apcu_clear_cache') && $userinfo['cha apcu_clear_cache(); $log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "cleared APCu cache"); header('Location: ' . $linker->getLink(array( - 'section' => 'apcuinfo', - 'page' => 'showinfo' - ))); + 'section' => 'apcuinfo', + 'page' => 'showinfo' + ))); exit(); } @@ -70,10 +75,14 @@ if ($page == 'showinfo') { 'num_hits' => $cache['num_hits'], 'num_misses' => $cache['num_misses'], 'num_inserts' => $cache['num_inserts'], - 'req_rate_user' => sprintf("%.2f", $cache['num_hits'] ? (($cache['num_hits'] + $cache['num_misses']) / ($time - $cache['start_time'])) : 0), - 'hit_rate_user' => sprintf("%.2f", $cache['num_hits'] ? (($cache['num_hits']) / ($time - $cache['start_time'])) : 0), - 'miss_rate_user' => sprintf("%.2f", $cache['num_misses'] ? (($cache['num_misses']) / ($time - $cache['start_time'])) : 0), - 'insert_rate_user' => sprintf("%.2f", $cache['num_inserts'] ? (($cache['num_inserts']) / ($time - $cache['start_time'])) : 0), + 'req_rate_user' => sprintf("%.2f", + $cache['num_hits'] ? (($cache['num_hits'] + $cache['num_misses']) / ($time - $cache['start_time'])) : 0), + 'hit_rate_user' => sprintf("%.2f", + $cache['num_hits'] ? (($cache['num_hits']) / ($time - $cache['start_time'])) : 0), + 'miss_rate_user' => sprintf("%.2f", + $cache['num_misses'] ? (($cache['num_misses']) / ($time - $cache['start_time'])) : 0), + 'insert_rate_user' => sprintf("%.2f", + $cache['num_inserts'] ? (($cache['num_inserts']) / ($time - $cache['start_time'])) : 0), 'apcversion' => phpversion('apcu'), 'phpversion' => phpversion(), 'number_vars' => $cache['num_entries'], @@ -96,8 +105,10 @@ if ($page == 'showinfo') { ]; $overview['mem_used_percentage'] = number_format(($overview['mem_used'] / $overview['mem_avail']) * 100, 1); - $overview['num_hits_percentage'] = number_format(($overview['num_hits'] / $overview['num_hits_and_misses']) * 100, 1); - $overview['num_misses_percentage'] = number_format(($overview['num_misses'] / $overview['num_hits_and_misses']) * 100, 1); + $overview['num_hits_percentage'] = number_format(($overview['num_hits'] / $overview['num_hits_and_misses']) * 100, + 1); + $overview['num_misses_percentage'] = number_format(($overview['num_misses'] / $overview['num_hits_and_misses']) * 100, + 1); $overview['readable'] = [ 'mem_size' => bsize($overview['mem_size']), 'mem_avail' => bsize($overview['mem_avail']), @@ -123,7 +134,9 @@ if ($page == 'showinfo') { } $ptr = $block['offset'] + $block['size']; /* Only consider blocks <5M for the fragmentation % */ - if ($block['size'] < (5 * 1024 * 1024)) $fragsize += $block['size']; + if ($block['size'] < (5 * 1024 * 1024)) { + $fragsize += $block['size']; + } $freetotal += $block['size']; } $freeseg += count($mem['block_lists'][$i]); @@ -175,15 +188,34 @@ function duration($ts) $hours = (int)(($rem) / 3600) - $days * 24 - $weeks * 7 * 24; $mins = (int)(($rem) / 60) - $hours * 60 - $days * 24 * 60 - $weeks * 7 * 24 * 60; $str = ''; - if ($years == 1) $str .= "$years year, "; - if ($years > 1) $str .= "$years years, "; - if ($weeks == 1) $str .= "$weeks week, "; - if ($weeks > 1) $str .= "$weeks weeks, "; - if ($days == 1) $str .= "$days day,"; - if ($days > 1) $str .= "$days days,"; - if ($hours == 1) $str .= " $hours hour and"; - if ($hours > 1) $str .= " $hours hours and"; - if ($mins == 1) $str .= " 1 minute"; - else $str .= " $mins minutes"; + if ($years == 1) { + $str .= "$years year, "; + } + if ($years > 1) { + $str .= "$years years, "; + } + if ($weeks == 1) { + $str .= "$weeks week, "; + } + if ($weeks > 1) { + $str .= "$weeks weeks, "; + } + if ($days == 1) { + $str .= "$days day,"; + } + if ($days > 1) { + $str .= "$days days,"; + } + if ($hours == 1) { + $str .= " $hours hour and"; + } + if ($hours > 1) { + $str .= " $hours hours and"; + } + if ($mins == 1) { + $str .= " 1 minute"; + } else { + $str .= " $mins minutes"; + } return $str; } diff --git a/admin_opcacheinfo.php b/admin_opcacheinfo.php index 1297fe35..20c9d0df 100644 --- a/admin_opcacheinfo.php +++ b/admin_opcacheinfo.php @@ -4,18 +4,29 @@ * This file is part of the Froxlor project. * Copyright (c) 2010 the Froxlor Team (see authors). * - * For the full copyright and license information, please view the COPYING - * file that was distributed with this source code. You can also view the - * COPYING file online at http://files.froxlor.org/misc/COPYING.txt + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation; either version 2 + * of the License, or (at your option) any later version. * - * @copyright (c) the authors - * @author Janos Muzsi (2016) - * @author Froxlor team (2010-) - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Panel + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. * - * Based on https://github.com/amnuts/opcache-gui + * You should have received a copy of the GNU General Public License + * along with this program; if not, you can also view it online at + * http://files.froxlor.org/misc/COPYING.txt * + * @copyright the authors + * @author Froxlor team + * @author Janos Muzsi + * @author Andrew Collington + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + * + * Based on https://github.com/amnuts/opcache-gui, which is + * licensed under the MIT licence, which can be viewed + * online at https://acollington.mit-license.org/ */ const AREA = 'admin'; diff --git a/install/froxlor.sql b/install/froxlor.sql.php similarity index 97% rename from install/froxlor.sql rename to install/froxlor.sql.php index b8dd9643..07dfbca1 100644 --- a/install/froxlor.sql +++ b/install/froxlor.sql.php @@ -1,3 +1,29 @@ + + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return << - * @author Froxlor team (2010-) - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Install + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. * + * You should have received a copy of the GNU General Public License + * along with this program; if not, you can also view it online at + * http://files.froxlor.org/misc/COPYING.txt + * + * @copyright the authors + * @author Froxlor team + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 */ + +use Froxlor\Install\Install; + // define default theme for configurehint, etc. $_deftheme = 'Froxlor'; -function view($template, $attributes) { - $view = file_get_contents(dirname(__DIR__) . '/templates/' . $template); - - return str_replace(array_keys($attributes), array_values($attributes), $view); -} - // validate correct php version if (version_compare("7.4.0", PHP_VERSION, ">=")) { die( @@ -48,15 +52,8 @@ if (!file_exists(dirname(__DIR__) . '/vendor/autoload.php')) { } require dirname(__DIR__) . '/vendor/autoload.php'; -require __DIR__ . '/lib/class.FroxlorInstall.php'; +require dirname(__DIR__) . '/lib/functions.php'; +require dirname(__DIR__) . '/lib/tables.inc.php'; -use Froxlor\UI\Panel\UI; - -UI::initTwig(true); -UI::twig()->addGlobal('install_mode', '1'); -UI::twig()->addGlobal('basehref', '../'); - -$frxinstall = new FroxlorInstall(); -$frxinstall->run(); - -UI::twigOutputBuffer(); +$installer = new Install(); +$installer->handle(); diff --git a/install/lib/class.FroxlorInstall.php b/install/lib/class.FroxlorInstall.php index 11d3e2a1..c5d71c8d 100644 --- a/install/lib/class.FroxlorInstall.php +++ b/install/lib/class.FroxlorInstall.php @@ -690,7 +690,7 @@ class FroxlorInstall 'title' => $this->_lng['install']['importing_data'], 'result' => 0 ]; - $db_schema = dirname(__FILE__, 2) . '/froxlor.sql'; + $db_schema = dirname(__FILE__, 2) . '/froxlor.sql.php'; $sql_query = @file_get_contents($db_schema); $sql_query = $this->_remove_remarks($sql_query); $sql_query = $this->_split_sql_file($sql_query, ';'); diff --git a/lib/Froxlor/FileDir.php b/lib/Froxlor/FileDir.php index 18c97980..02bfb981 100644 --- a/lib/Froxlor/FileDir.php +++ b/lib/Froxlor/FileDir.php @@ -1,4 +1,5 @@ 0) { - $template = $result_stmt->fetch(\PDO::FETCH_ASSOC); $replace_arr = array( @@ -224,12 +230,14 @@ class FileDir fwrite($index_html_handler, $htmlcontent); fclose($index_html_handler); if ($logger !== null) { - $logger->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, 'Creating \'index.' . Settings::Get('system.index_file_extension') . '\' for Customer \'' . $template['customer_login'] . '\' based on template in directory ' . escapeshellarg($indexhtmlpath)); + $logger->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, + 'Creating \'index.' . Settings::Get('system.index_file_extension') . '\' for Customer \'' . $template['customer_login'] . '\' based on template in directory ' . escapeshellarg($indexhtmlpath)); } } else { $destination = self::makeCorrectDir($destination); if ($logger !== null) { - $logger->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, 'Running: cp -a ' . \Froxlor\Froxlor::getInstallDir() . '/templates/misc/standardcustomer/* ' . escapeshellarg($destination)); + $logger->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, + 'Running: cp -a ' . \Froxlor\Froxlor::getInstallDir() . '/templates/misc/standardcustomer/* ' . escapeshellarg($destination)); } self::safe_exec('cp -a ' . \Froxlor\Froxlor::getInstallDir() . '/templates/misc/standardcustomer/* ' . escapeshellarg($destination)); } @@ -241,13 +249,13 @@ class FileDir * Function which returns a correct filename, means to add a slash at the beginning if there wasn't one * * @param string $filename - * the filename - * + * the filename + * * @return string the corrected filename */ public static function makeCorrectFile($filename) { - if (! isset($filename) || trim($filename) == '') { + if (!isset($filename) || trim($filename) == '') { $error = 'Given filename for function ' . __FUNCTION__ . ' is empty.' . "\n"; $error .= 'This is very dangerous and should not happen.' . "\n"; $error .= 'Please inform the Froxlor team about this issue so they can fix it.'; @@ -266,19 +274,20 @@ class FileDir } /** - * Function which returns a correct dirname, means to add slashes at the beginning and at the end if there weren't some + * Function which returns a correct dirname, means to add slashes at the beginning and at the end if there weren't + * some * * @param string $path - * the path to correct - * - * @throws \Exception + * the path to correct + * * @return string the corrected path + * @throws \Exception */ public static function makeCorrectDir($dir) { if (is_string($dir) && strlen($dir) > 0) { $dir = trim($dir); - if (substr($dir, - 1, 1) != '/') { + if (substr($dir, -1, 1) != '/') { $dir .= '/'; } if (substr($dir, 0, 1) != '/') { @@ -293,13 +302,12 @@ class FileDir * Function which returns a secure path, means to remove all multiple dots and slashes * * @param string $path - * the path to secure - * + * the path to secure + * * @return string the corrected path */ public static function makeSecurePath($path) { - // check for bad characters, some are allowed with escaping // but we generally don't want them in our directory-names, // thx to aaronmueller for this snipped @@ -341,7 +349,7 @@ class FileDir * Function which returns a correct destination for Postfix Virtual Table * * @param - * string The destinations + * string The destinations * @return string the corrected destinations * @author Florian Lippert */ @@ -355,7 +363,7 @@ class FileDir $destination = substr($destination, 1); } - if (substr($destination, - 1, 1) == ' ') { + if (substr($destination, -1, 1) == ' ') { $destination = substr($destination, 0, strlen($destination) - 1); } @@ -366,16 +374,16 @@ class FileDir * Returns a valid html tag for the chosen $fieldType for paths * * @param - * string path The path to start searching in + * string path The path to start searching in * @param - * integer uid The uid which must match the found directories + * integer uid The uid which must match the found directories * @param - * integer gid The gid which must match the found directories + * integer gid The gid which must match the found directories * @param - * string value the value for the input-field - * + * string value the value for the input-field + * * @return string The html tag for the chosen $fieldType - * + * * @author Martin Burchert * @author Manuel Bernhardt */ @@ -390,21 +398,18 @@ class FileDir // but dirList holds the paths with starting slash // so we just add one here to get the correct // default path selected, #225 - if (substr($value, 0, 1) != '/' && ! $dom) { + if (substr($value, 0, 1) != '/' && !$dom) { $value = '/' . $value; } $fieldType = strtolower(\Froxlor\Settings::Get('panel.pathedit')); if ($fieldType == 'manual') { - $field = array( 'type' => 'text', 'value' => htmlspecialchars($value) ); - } elseif ($fieldType == 'dropdown') { - $dirList = self::findDirs($path, $uid, $gid); natcasesort($dirList); @@ -459,12 +464,12 @@ class FileDir * the found directory is valid. It uses recursive-iterators to find subdirectories. * * @param string $path - * the path to start searching in + * the path to start searching in * @param int $uid - * the uid which must match the found directories + * the uid which must match the found directories * @param int $gid - * the gid which must match the found directories - * + * the gid which must match the found directories + * * @return array Array of found valid paths */ private static function findDirs($path, $uid, $gid) @@ -474,7 +479,6 @@ class FileDir // valid directory? if (is_dir($path)) { - // Will exclude everything under these directories $exclude = array( 'awstats', @@ -496,7 +500,8 @@ class FileDir }; // create RecursiveIteratorIterator - $its = new \RecursiveIteratorIterator(new \RecursiveCallbackFilterIterator(new \RecursiveDirectoryIterator($path, \RecursiveDirectoryIterator::SKIP_DOTS), $filter)); + $its = new \RecursiveIteratorIterator(new \RecursiveCallbackFilterIterator(new \RecursiveDirectoryIterator($path, + \RecursiveDirectoryIterator::SKIP_DOTS), $filter)); // we can limit the recursion-depth, but will it be helpful or // will people start asking "why do I only see 2 subdirectories, i want to use /a/b/c" // let's keep this in mind and see whether it will be useful @@ -521,13 +526,13 @@ class FileDir * if exact = false [default]) * * @param boolean $exact - * whether to check explicitly for FreeBSD or *BSD - * + * whether to check explicitly for FreeBSD or *BSD + * * @return boolean */ public static function isFreeBSD($exact = false) { - if (($exact && PHP_OS == 'FreeBSD') || (! $exact && stristr(PHP_OS, 'BSD'))) { + if (($exact && PHP_OS == 'FreeBSD') || (!$exact && stristr(PHP_OS, 'BSD'))) { return true; } return false; @@ -537,8 +542,8 @@ class FileDir * set the immutable flag for a file * * @param string $filename - * the file to set the flag for - * + * the file to set the flag for + * * @return boolean */ public static function setImmutable($filename = null) @@ -550,8 +555,8 @@ class FileDir * removes the immutable flag for a file * * @param string $filename - * the file to set the flag for - * + * the file to set the flag for + * * @return boolean */ public static function removeImmutable($filename = null) @@ -564,8 +569,8 @@ class FileDir * to use chattr (Linux) or chflags (FreeBSD) * * @param boolean $remove - * whether to use +i|schg (false) or -i|noschg (true) - * + * whether to use +i|schg (false) or -i|noschg (true) + * * @return string functionname + parameter (not the file) */ private static function getImmutableFunction($remove = false) @@ -581,10 +586,8 @@ class FileDir public static function getFilesystemQuota() { - // enabled at all? if (Settings::Get('system.diskquota_enabled')) { - // set linux defaults $repquota_params = "-np"; // $quota_line_regex = "/^#([0-9]+)\s*[+-]{2}\s*(\d+)\s*(\d+)\s*(\d+)\s*(\d+)\s*(\d+)\s*(\d+)\s*(\d+)\s*(\d+)/i"; @@ -598,14 +601,14 @@ class FileDir // Fetch all quota in the desired partition $repquota = array(); - exec(Settings::Get('system.diskquota_repquota_path') . " " . $repquota_params . " " . escapeshellarg(Settings::Get('system.diskquota_customer_partition')), $repquota); + exec(Settings::Get('system.diskquota_repquota_path') . " " . $repquota_params . " " . escapeshellarg(Settings::Get('system.diskquota_customer_partition')), + $repquota); $usedquota = array(); foreach ($repquota as $tmpquota) { $matches = null; // Let's see if the line matches a quota - line if (preg_match($quota_line_regex, $tmpquota, $matches)) { - // It matches - put it into an array with userid as key (for easy lookup later) $usedquota[$matches[1]] = array( 'block' => array( diff --git a/lib/Froxlor/Install/Install.php b/lib/Froxlor/Install/Install.php new file mode 100644 index 00000000..2f59f1a0 --- /dev/null +++ b/lib/Froxlor/Install/Install.php @@ -0,0 +1,109 @@ + + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +namespace Froxlor\Install; + +use Froxlor\UI\Panel\UI; + +class Install +{ + public $step = 0; + public $phpVersion; + public string $requiredVersion = '7.4.0'; + public array $requiredExtensions = ['libxml', 'zip']; + public array $suggestedExtensions = ['curl']; + public array $suggestions; + public array $criticals; + + public function __construct() + { + $this->step = \Froxlor\UI\Request::get('step'); + + $this->phpVersion = phpversion(); + $this->loadedExtensions = get_loaded_extensions(); + + $this->checkExtensions(); + } + + public function checkExtensions() + { + // check for required extensions + foreach ($this->requiredExtensions as $requiredExtension) { + if (in_array($requiredExtension, $this->loadedExtensions)) continue; + $this->criticals['missing_extensions'][] = $requiredExtension; + } + + // check for suggested extensions + foreach ($this->suggestedExtensions as $suggestedExtension) { + if (in_array($suggestedExtension, $this->loadedExtensions)) continue; + $this->suggestions['missing_extensions'][] = $suggestedExtension; + } + } + + public function getPreflightText(): string + { + if (version_compare($this->requiredVersion, PHP_VERSION, "<")) { + $text = 'Your system is running with PHP ' . $this->phpVersion; + } else { + $text = 'Your system is running a lower version than PHP ' . $this->requiredVersion; + $this->criticals[] = 'Update your current PHP Version from ' . $this->phpVersion . ' to ' . $this->requiredVersion . ' or higher'; + } + + return $text; + } + + public function handle() + { + $formfield = require dirname(__DIR__) . '/lib/formfields/install/formfield.install.php'; + + // init twig + UI::initTwig(true); + UI::sendHeaders(); + + // set global variables + UI::twig()->addGlobal('install_mode', true); + UI::twig()->addGlobal('basehref', '../'); + + // load template + UI::twigBuffer('/install/index.html.twig', [ + 'setup' => [ + 'step' => $this->step, + ], + 'preflight' => [ + 'text' => $this->getPreflightText(), + 'suggestions' => $this->suggestions, + 'criticals' => $this->criticals, + ], + 'page' => [ + 'title' => 'Database', + 'description' => 'Test', + ], + 'section' => $formfield['install']['sections'][sprintf('step%s', $this->step)] ?? [], + ]); + + // output view + UI::twigOutputBuffer(); + } +} diff --git a/lib/Froxlor/Language.php b/lib/Froxlor/Language.php new file mode 100644 index 00000000..62b0c8f7 --- /dev/null +++ b/lib/Froxlor/Language.php @@ -0,0 +1,117 @@ + + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +namespace Froxlor; + +use RecursiveArrayIterator; +use RecursiveIteratorIterator; + +class Language +{ + protected static ?array $lng = null; + protected static string $defaultLanguage = 'en'; + protected static ?string $requestedLanguage = null; + + /** + * @TODO: Possible iso: de, de-DE, de-AT (fallback to de) + * + * @param $iso + * @return array + */ + private static function loadLanguage($iso): array + { + $languageFile = dirname(__DIR__, 2) . sprintf('/lng/%s.lng.php', $iso); + + if (!file_exists($languageFile)) { + return []; + } + + // load default language + $lng = require $languageFile; + + // multidimensional array to dot notation keys + $reItIt = new RecursiveIteratorIterator(new RecursiveArrayIterator($lng)); + $result = []; + foreach ($reItIt as $leafValue) { + $keys = []; + foreach (range(0, $reItIt->getDepth()) as $depth) { + $keys[] = $reItIt->getSubIterator($depth)->key(); + } + $result[join('.', $keys)] = $leafValue; + } + + return $result; + } + + /** + * @return array + * @fixme iso seems to be not used in froxlor? + */ + public static function getLanguages(): array + { + $languages = []; + $directory = dirname(__DIR__, 2) . '/lng'; + + foreach (array_diff(scandir($directory), array('..', '.', 'index.html')) as $language) { + $iso = explode('.', $language)[0]; + $languages[$iso] = self::getTranslation('languages.' . $iso); + } + + return $languages; + } + + public static function getTranslation(string $identifier, array $arguments = []) + { + // initialize + if (is_null(self::$lng)) { + // load fallback language + self::$lng = self::loadLanguage(self::$defaultLanguage); + + // load user requested language + if (self::$requestedLanguage) { + self::$lng = array_merge(self::$lng, self::loadLanguage(self::$requestedLanguage)); + } + + // load fallback from browser if nothing requested + $iso = trim(substr(strtok(strtok($_SERVER['HTTP_ACCEPT_LANGUAGE'], ','), ';'), 0, 5)); + if (!self::$requestedLanguage && strlen($iso) == 2 && $iso !== self::$defaultLanguage) { + self::$lng = array_merge(self::$lng, self::loadLanguage($iso)); + } + } + + // search by identifier + return vsprintf(self::$lng[$identifier] ?? $identifier, $arguments); + } + + public static function setDefaultLanguage(string $string) + { + self::$defaultLanguage = $string; + } + + public static function setLanguage(string $string) + { + self::$requestedLanguage = $string; + } +} diff --git a/lib/formfields/install/formfield.install.php b/lib/formfields/install/formfield.install.php new file mode 100644 index 00000000..9a91209c --- /dev/null +++ b/lib/formfields/install/formfield.install.php @@ -0,0 +1,178 @@ + (2010-) + * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt + * @package Formfields + * + */ + +use Froxlor\Settings; + +return array( + 'install' => [ + 'title' => lng('admin.admin_add'), + 'image' => 'fa-solid fa-user-plus', + 'self_overview' => ['section' => 'admins', 'page' => 'admins'], + 'sections' => [ + 'step1' => [ + 'title' => lng('install.dabatase'), + 'fields' => [ + 'sql_hostname' => [ + 'label' => lng('sql_hostname'), + 'type' => 'text', + 'mandatory' => true, + 'value' => 'localhost' + ], + 'sql_root_username' => [ + 'label' => lng('sql_root_username'), + 'type' => 'password', + 'mandatory' => true, + 'next_to' => [ + 'sql_root_password' => [ + 'label' => lng('sql_root_password'), + 'type' => 'password', + 'mandatory' => true + ], + ] + ], + 'sql_username' => [ + 'label' => lng('sql_username'), + 'type' => 'password', + 'mandatory' => true, + 'next_to' => [ + 'sql_password' => [ + 'label' => lng('sql_password'), + 'type' => 'password', + 'mandatory' => true + ], + ] + ], + ] + ], + 'step2' => [ + 'title' => lng('admin.contactdata'), + 'image' => 'icons/user_add.png', + 'fields' => [ + 'name' => [ + 'label' => lng('name'), + 'type' => 'text', + 'mandatory' => true + ], + 'username' => [ + 'label' => lng('username'), + 'type' => 'text', + 'mandatory' => true + ], + 'password' => [ + 'label' => lng('password'), + 'type' => 'password', + 'mandatory' => true + ], + 'email' => [ + 'label' => lng('email'), + 'type' => 'text', + 'mandatory' => true + ], + ] + ], + 'step3' => [ + 'title' => lng('admin.servicedata'), + 'image' => 'icons/user_add.png', + 'fields' => [ + 'ipaddress' => [ + 'label' => lng('serversettings.ipaddress.title'), + 'type' => 'select' + ], + 'change_serversettings' => [ + 'label' => lng('admin.change_serversettings'), + 'type' => 'checkbox', + 'value' => '1', + 'checked' => false + ], + 'customers' => [ + 'label' => lng('admin.customers'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9, + 'mandatory' => true + ], + 'customers_see_all' => [ + 'label' => lng('admin.customers_see_all'), + 'type' => 'checkbox', + 'value' => '1', + 'checked' => false + ], + 'domains' => [ + 'label' => lng('admin.domains'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9, + 'mandatory' => true + ], + 'domains_see_all' => [ + 'label' => lng('admin.domains_see_all'), + 'type' => 'checkbox', + 'value' => '1', + 'checked' => false + ], + 'caneditphpsettings' => [ + 'label' => lng('admin.caneditphpsettings'), + 'type' => 'checkbox', + 'value' => '1', + 'checked' => false + ], + 'subdomains' => [ + 'label' => lng('customer.subdomains'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9, + 'mandatory' => true + ], + 'emails' => [ + 'label' => lng('customer.emails'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9, + 'mandatory' => true + ], + 'email_accounts' => [ + 'label' => lng('customer.accounts'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9, + 'mandatory' => true + ], + 'email_forwarders' => [ + 'label' => lng('customer.forwarders'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9, + 'mandatory' => true + ], + 'ftps' => [ + 'label' => lng('customer.ftps'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9 + ], + 'mysqls' => [ + 'label' => lng('customer.mysqls'), + 'type' => 'textul', + 'value' => 0, + 'maxlength' => 9, + 'mandatory' => true + ] + ] + ] + ] + ] +); diff --git a/lib/functions.php b/lib/functions.php new file mode 100644 index 00000000..21086c8c --- /dev/null +++ b/lib/functions.php @@ -0,0 +1,36 @@ + + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +function view($template, $attributes) +{ + $view = file_get_contents(dirname(__DIR__) . '/templates/' . $template); + + return str_replace(array_keys($attributes), array_values($attributes), $view); +} + +function lng(string $identifier, array $arguments = []) +{ + return \Froxlor\Language::getTranslation($identifier, $arguments); +} diff --git a/lib/init.php b/lib/init.php index 1f43d854..4a218aea 100644 --- a/lib/init.php +++ b/lib/init.php @@ -2,19 +2,25 @@ /** * This file is part of the Froxlor project. - * Copyright (c) 2003-2009 the SysCP Team (see authors). * Copyright (c) 2010 the Froxlor Team (see authors). * - * For the full copyright and license information, please view the COPYING - * file that was distributed with this source code. You can also view the - * COPYING file online at http://files.froxlor.org/misc/COPYING.txt + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation; either version 2 + * of the License, or (at your option) any later version. * - * @copyright (c) the authors - * @author Florian Lippert (2003-2009) - * @author Froxlor team (2010-) - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package System + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. * + * You should have received a copy of the GNU General Public License + * along with this program; if not, you can also view it online at + * http://files.froxlor.org/misc/COPYING.txt + * + * @copyright the authors + * @author Froxlor team + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 */ // define default theme for configurehint, etc. @@ -47,8 +53,10 @@ if (!file_exists(dirname(__DIR__) . '/vendor/autoload.php')) { } require dirname(__DIR__) . '/vendor/autoload.php'; +require dirname(__DIR__) . '/lib/functions.php'; use Froxlor\Database\Database; +use Froxlor\Language; use Froxlor\Settings; use Froxlor\UI\Panel\UI; use Froxlor\UI\Request; @@ -120,91 +128,34 @@ if (CurrentUser::hasSession()) { CurrentUser::reReadUserData(); } -// Language Management -$langs = array(); -$languages = array(); -$iso = array(); - -// query the whole table -$result_stmt = Database::query("SELECT * FROM `" . TABLE_PANEL_LANGUAGE . "`"); - -// presort languages -while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) { - $langs[$row['language']][] = $row; - // check for row[iso] cause older froxlor - // versions didn't have that and it will - // lead to a lot of undefined variables - // before the admin can even update - if (isset($row['iso'])) { - $iso[$row['iso']] = $row['language']; - } -} - -// buildup $languages for the login screen -foreach ($langs as $key => $value) { - $languages[$key] = $key; -} +/** + * Language management + */ // set default language before anything else to // ensure that we can display messages -$language = Settings::Get('panel.standardlanguage'); +Language::setLanguage(Settings::Get('panel.standardlanguage')); -if (CurrentUser::hasSession() && !empty(CurrentUser::getField('language')) && isset($languages[CurrentUser::getField('language')])) { - // default: use language from session, #277 - $language = CurrentUser::getField('language'); -} else { - if (!CurrentUser::hasSession()) { - if (isset($_SERVER['HTTP_ACCEPT_LANGUAGE'])) { - $accept_langs = explode(',', $_SERVER['HTTP_ACCEPT_LANGUAGE']); - for ($i = 0; $i < count($accept_langs); $i++) { - // this only works for most common languages. some (uncommon) languages have a 3 letter iso-code. - // to be able to use these also, we would have to depend on the intl extension for php (using Locale::lookup or similar) - // as long as froxlor does not support any of these languages, we can leave it like that. - if (isset($iso[substr($accept_langs[$i], 0, 2)])) { - $language = $iso[substr($accept_langs[$i], 0, 2)]; - break; - } - } - unset($iso); - - // if HTTP_ACCEPT_LANGUAGES has no valid langs, use default (very unlikely) - if (!strlen($language) > 0) { - $language = Settings::Get('panel.standardlanguage'); - } - } +// set language by given user +if (CurrentUser::hasSession()) { + if (!empty(CurrentUser::getField('language')) && isset(Language::getLanguages()[CurrentUser::getField('language')])) { + Language::setLanguage(CurrentUser::getField('language')); } else { - $language = CurrentUser::getField('def_language'); + Language::setLanguage(CurrentUser::getField('def_language')); } } -// include every english language file we can get -foreach ($langs['English'] as $key => $value) { - include_once \Froxlor\FileDir::makeSecurePath($value['file']); -} - -// now include the selected language if its not english -if ($language != 'English') { - foreach ($langs[$language] as $key => $value) { - include_once \Froxlor\FileDir::makeSecurePath($value['file']); - } -} - -// last but not least include language references file -include_once \Froxlor\FileDir::makeSecurePath('lng/lng_references.php'); - -UI::setLng($lng); - // Initialize our link - class $linker = new \Froxlor\UI\Linker('index.php'); UI::setLinker($linker); /** - * global Theme-variable + * Global Theme-variable */ $theme = (Settings::Get('panel.default_theme') !== null) ? Settings::Get('panel.default_theme') : $_deftheme; /** - * overwrite with customer/admin theme if defined + * Overwrite with customer/admin theme if defined */ if (CurrentUser::hasSession() && CurrentUser::getField('theme') != $theme) { $theme = CurrentUser::getField('theme'); diff --git a/lng/cz.lng.php b/lng/cz.lng.php new file mode 100644 index 00000000..c454fe41 --- /dev/null +++ b/lng/cz.lng.php @@ -0,0 +1,873 @@ + + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + '2fa' => [ + '2fa' => '2FA možnosti', + '2fa_enabled' => 'Aktivovat dvoufázové ověření (2FA)', + '2fa_removed' => '2FA úspěšně odstraněno', + '2fa_add' => 'Aktivovat 2FA', + '2fa_delete' => 'Deaktivovat 2FA', + '2fa_verify' => 'Ověřit kód', + ], + 'admin' => [ + 'overview' => 'Přehled', + 'ressourcedetails' => 'Využité zdroje', + 'systemdetails' => 'Detaily systému', + 'froxlordetails' => 'Froxlor detaily', + 'installedversion' => 'Nainstalovaná verze', + 'latestversion' => 'Poslední verze', + 'lookfornewversion' => [ + 'clickhere' => 'Hledat pomocí webové služby', + 'error' => 'Chyba při čtení', + ], + 'resources' => 'Zdroje', + 'customer' => 'Zákazník', + 'customers' => 'Zákazníci', + 'customer_add' => 'Vytvořit zákazníka', + 'customer_edit' => 'Upravit zákazníka', + 'domains' => 'Domény', + 'domain_add' => 'Vytvořit doménu', + 'domain_edit' => 'Upravit doménu', + 'subdomainforemail' => 'Subdomény jako emailové domény', + 'admin' => 'Admin', + 'admins' => 'Admini', + 'admin_add' => 'Vytvořit admina', + 'admin_edit' => 'Upravit admina', + 'customers_see_all' => 'Může vidět všechny zákazníky?', + 'domains_see_all' => 'Může vidět všechny domény?', + 'change_serversettings' => 'Může vidět nastavení serveru?', + 'server' => 'Systém', + 'serversettings' => 'Nastavení', + 'rebuildconf' => 'Znovu setstavit konfigurační soubory', + 'stdsubdomain' => 'Standartní subdoména', + 'stdsubdomain_add' => 'Vytvořit standartní subdoménu', + 'phpenabled' => 'PHP povoleno', + 'deactivated' => 'Deaktivováno', + 'deactivated_user' => 'Deaktivovat uživatele', + 'sendpassword' => 'Odeslat heslo', + 'ownvhostsettings' => 'Vlastní vHost-nastavení', + 'configfiles' => [ + 'serverconfiguration' => 'Konfigurace', + 'overview' => 'Přehled', + 'wizard' => 'Průvodce', + 'distribution' => 'Distribuce', + 'service' => 'Služba', + 'etc' => 'Ostatní (System)', + 'choosedistribution' => '-- Vyber distribuci --', + 'chooseservice' => '-- Vyber službu --', + 'statistics' => 'Statistics', + ], + 'templates' => [ + 'templates' => 'Email-šablony', + 'template_add' => 'Přidat šablonu', + 'template_edit' => 'Upravit šablonu', + 'action' => 'Akce', + 'email' => 'Email & šablony souborů', + 'subject' => 'Předmět', + 'mailbody' => 'Tělo emailu', + 'createcustomer' => 'Uvítací email pro nové zákazníky', + 'pop_success' => 'Uvítací email pro nově založene emaily', + 'template_replace_vars' => 'Variables to be replaced in the template:', + 'SALUTATION' => 'Replaced with a correct salutation (name or company)', + 'FIRSTNAME' => 'Replaced with the customer\'s first name.', + 'NAME' => 'Nahrazeno jménem zákazníka.', + 'COMPANY' => 'Replaces with the customer\'s company name', + 'USERNAME' => 'Replaced with the customer\'s account username.', + 'PASSWORD' => 'Replaced with the customer\'s account password.', + 'EMAIL' => 'Replaced with the address of the POP3/IMAP account.', + 'CUSTOMER_NO' => 'Replaces with the customer number', + 'EMAIL_PASSWORD' => 'Nahrazeno POP3/IMAP heslem účtu.', + 'filecontent' => 'Öbsah souboru', + 'newdatabase' => 'Emailové notifikace o nových databázích', + 'newftpuser' => 'Emailové notifikace o nových ftp uživatelů', + 'CUST_NAME' => 'Jméno zákazníka', + 'DB_NAME' => 'Název databáze', + 'DB_PASS' => 'Heslo databáze', + 'DB_DESC' => 'Popis databáze', + 'DB_SRV' => 'Databázový server', + 'PMA_URI' => 'Odkaz k phpMyAdmin (pokud je postytnut)', + 'USR_NAME' => 'FTP uživatelské jméno', + 'USR_PASS' => 'FTP heslo', + ], + 'webserver' => 'Webový server', + 'ipsandports' => [ + 'add' => 'Přidat IP/Port', + 'edit' => 'Upravit IP/Port', + 'enable_ssl' => 'Je tohle SSL port?', + 'ssl_cert_file' => 'Cesta k SSL certifikátu', + 'webserverdefaultconfig' => 'Výchozí konfigurace Webserveru', + ], + 'memorylimitdisabled' => 'Vypnuto', + 'valuemandatory' => 'Tato hodnota je důležitá', + 'serversoftware' => 'Serversoftware', + 'phpversion' => 'PHP-Verze', + 'mysqlserverversion' => 'MySQL verze serveru', + 'webserverinterface' => 'Rozhraní webového serveru', + 'accountsettings' => 'Nastavení účtu', + 'panelsettings' => 'Nastavení panelu', + 'systemsettings' => 'Nastavení systému', + 'webserversettings' => 'Nastavení webového serveru', + 'mailserversettings' => 'Nastavení mailového serveru', + 'nameserversettings' => 'Nameserver settings', + 'updatecounters' => 'Přepočítat využití zdrojů', + 'subcanemaildomain' => [ + 'never' => 'Nikdy', + 'choosableno' => 'Volitelné, výchozí ne', + 'choosableyes' => 'Volitelné, výchozí ano', + 'always' => 'Vždy', + ], + 'webalizersettings' => 'Webalizer nastavení', + 'webalizer' => [ + 'normal' => 'Normální', + 'quiet' => 'Tiché', + 'veryquiet' => 'Bez výstupu', + ], + 'domain_nocustomeraddingavailable' => 'Momentálně není možné přidat doménu. Nejdříve musíš přidat alespoň jednoho zákazníka.', + 'loggersettings' => 'Log nastavení', + 'logger' => [ + 'normal' => 'normální', + 'paranoid' => 'paranoidní', + ], + 'loggersystem' => 'Systémový log', + 'emaildomain' => 'Emailová doména', + 'email_only' => 'Jen email?', + 'wwwserveralias' => 'Přidat "www." ServerAlias', + 'subject' => 'Předmět', + 'recipient' => 'Příjemce', + 'message' => 'Napsat zprávu', + 'text' => 'Zpráva', + 'sslsettings' => 'SSL nastavení', + 'dkimsettings' => 'DomainKey nastavení', + 'caneditphpsettings' => 'Může změnit doménové nastavení spojené s php?', + 'allips' => 'Všechny IP', + 'awstatssettings' => 'AWstats nastavení', + 'domain_dns_settings' => 'DNS nastavení domény', + 'activated' => 'Aktivováno', + 'statisticsettings' => 'Nastavení statistik', + 'sysload' => 'Systémové zatížení', + 'noloadavailable' => 'nedostupné', + 'nouptimeavailable' => 'nedostupné', + 'nosubject' => '(Bez předmětu)', + 'phpsettings' => [ + 'title' => 'PHP konfigurace', + 'description' => 'Krátký popis', + 'actions' => 'Akce', + 'editsettings' => 'Změnit PHP nastavení', + 'addsettings' => 'Vytvořit nové PHP nastavení', + 'viewsettings' => 'Zobrazit PHP nastavení', + 'phpinisettings' => 'php.ini nastavení', + 'addnew' => 'Vytvořit novou PHP konfiguraci', + 'fpmdesc' => 'PHP-FPM konfigurace', + 'file_extensions' => 'Přípony souborů', + 'file_extensions_note' => '(bez tečky, oddělené mezerou)', + ], + 'fpmsettings' => [ + 'addnew' => 'Vytvořit novou PHP verzi', + ], + 'expert_settings' => 'Expertní nastavení!', + 'phpserversettings' => 'PHP nastavení', + 'mod_fcgid_maxrequests' => [ + 'title' => 'Maximum php žádostí pro tuto doménu (ponechte prázdné pro výchozí hodnotu)', + ], + 'contactdata' => 'Kontaktní data', + 'newerversionavailable' => 'Nová verze Froxloru je dostupná', + 'lastlogin_succ' => 'Posledníí přihlášení', + 'ftpserversettings' => 'Nastavení FTP serveru', + 'perlenabled' => 'Perl povolen', + 'traffic' => 'Provoz', + 'domaintraffic' => 'Domény', + 'customertraffic' => 'Zákazníci', + 'assignedmax' => 'Přiřazeno / Max', + 'usedmax' => 'Použito / Max', + 'used' => 'Použito', + 'delete_statistics' => 'Promazat statistiky', + 'speciallogfile' => [ + 'title' => 'Oddělit log soubor', + ], + 'domain_editable' => [ + 'title' => 'Povolit upravování domény', + ], + 'integritycheck' => 'Ověření databáze', + 'integrityid' => '#', + 'integrityname' => 'Název', + 'integrityresult' => 'Výsledek', + 'integrityfix' => 'Opravit problémy automaticky', + 'movetoadmin' => 'Přesunout zákazníka', + 'note' => 'Poznámka', + 'letsencrypt' => [ + 'title' => 'Používat Let\'s Encrypt', + ], + 'autoupdate' => 'Auto-Aktualizace', + 'dnsenabled' => 'Povolit DNS editor', + 'plans' => [ + 'description' => 'Popis', + 'last_update' => 'Naposledy aktualizováno', + ], + 'domain_sslenabled' => 'Povolit použití SSL', + ], + 'apcuinfo' => [ + 'clearcache' => 'Vyčistit APCu cache', + 'version' => 'APCu verze', + 'phpversion' => 'PHP verze', + 'sharedmem' => 'Sdílená pamět', + 'sharedmemval' => '%d Segment(s) with %s (%s memory)', + 'start' => 'Čas zapnutí', + 'uptime' => 'Uptime', + 'upload' => 'Podpora nahrávání souborů', + 'cachetitle' => 'Cache Information', + 'memnote' => 'Využití paměti (několik krajíců indikuje fragmenty)', + 'free' => 'Volné', + 'used' => 'Využité', + 'detailmem' => 'Detailní využití paměti a fragmentace', + 'fragment' => 'Fragmentace', + ], + 'apikeys' => [ + 'no_api_keys' => 'Žádné API klíče nalezeny', + 'key_add' => 'přidat nový klíč', + 'clicktoview' => 'Klikni pro zobrazení', + 'allowed_from' => 'Povoleno od', + 'valid_until' => 'Platné do', + ], + 'changepassword' => [ + 'old_password' => 'Staré heslo', + 'new_password' => 'Nové heslo', + 'new_password_confirm' => 'Potvrdit heslo', + 'new_password_ifnotempty' => 'Nové heslo (prázdné = beze změny)', + 'also_change_ftp' => ' také změní heslo hlavního FTP účtu', + 'also_change_stats' => ' také změní heslo na stránku k statistikám', + ], + 'cron' => [ + 'lastrun' => 'naposledy spušteno', + 'isactive' => 'povoleno', + 'description' => 'popis', + ], + 'crondesc' => [ + 'cron_letsencrypt' => 'aktualizuji Let\'s Encrypt certifikáty', + ], + 'cronjobs' => [ + 'notyetrun' => 'Ještě nespuštěno', + ], + 'customer' => [ + 'documentroot' => 'Domovský adresář', + 'name' => 'Název', + 'firstname' => 'Křestní jméno', + 'company' => 'Společnost', + 'street' => 'Ulice', + 'zipcode' => 'PSČ', + 'city' => 'Město', + 'phone' => 'Telefon', + 'fax' => 'Fax', + 'email' => 'Email', + 'customernumber' => 'ID Zákazníka', + 'diskspace' => 'Webový prostor (MiB)', + 'traffic' => 'Provoz (GiB)', + 'mysqls' => 'MySQL-databáze', + 'emails' => 'Email-adresy', + 'accounts' => 'Email-účty', + 'forwarders' => 'Email-forwarders', + 'ftps' => 'FTP-účty', + 'subdomains' => 'Subdomény', + 'domains' => 'Domény', + 'title' => 'Oslovení', + 'country' => 'Země', + 'generated_pwd' => 'Navrhnutí hesla', + 'usedmax' => 'Použito / Max', + 'services' => 'Služby', + ], + 'diskquota' => 'Quota', + 'dkim' => [ + 'use_dkim' => [ + 'title' => 'Aktivovat DKIM podporu?', + ], + ], + 'dns' => [ + 'a_record' => 'A-Záznam (IPv6 volitelný)', + 'cname_record' => 'CNAME-Záznam', + 'mxrecords' => 'Definovat MX záznamy', + 'standardmx' => 'Server standard MX record', + 'mxconfig' => 'Vlastní MX záznamy', + 'priority10' => 'Priorita 10', + 'priority20' => 'Priorita 20', + 'txtrecords' => 'Definovat TXT záznamy', + ], + 'dnseditor' => [ + 'edit' => 'upravit DNS', + 'records' => 'záznamy', + ], + 'domain' => [ + 'openbasedirpath' => 'OpenBasedir-cesta', + 'docroot' => 'Path from field above', + 'homedir' => 'Domovský adresář', + ], + 'domains' => [ + 'description' => 'Zde můžeš vytvořit a upravit (sub-)domémny a změnit jejich cesty.
Systém bude chtít nějaký čas pro aplikování nového nastavení po každé změně.', + 'domainsettings' => 'Nastavení domény', + 'domainname' => 'Název domény', + 'subdomain_add' => 'Vytvořit subdoménu', + 'subdomain_edit' => 'Upravit (sub)doménu', + 'wildcarddomain' => 'Vytvořit jako wildcarddoménu?', + 'aliasdomain' => 'Alias pro doménu', + 'noaliasdomain' => 'Doména bez aliasu', + 'statstics' => 'Statistiky využití', + 'isassigneddomain' => 'Je přiřazenou doménou', + 'registration_date' => 'Přidáno do registru', + 'aliasdomains' => 'Alias domén', + 'nosubtomaindomain' => 'Žádná subdoména celé domény', + 'ipandport_ssl_multi' => [ + 'title' => 'SSL IP adresa(y)', + ], + 'ssl_redirect' => [ + 'title' => 'SSL přesměrování', + ], + 'serveraliasoption_none' => 'Bez aliasu', + 'domain_import' => 'Importovat domény', + 'import_separator' => 'Oddělovač', + 'import_file' => 'CSV-Soubor', + 'termination_date' => 'Datum zrušení', + 'termination_date_overview' => 'zrušeno datem ', + ], + 'emails' => [ + 'description' => 'Zde můžeš vytvořit a upravit tvé emailové adresy.
Účet je jako poštovní schránka před tvým domem. Pokud ti někdo odešle email, přijde ti do tvého účtu.

Pro stažení tvých emailů použij následující nastavení v tvém emailovém klientovi: (Data v italském fontu na ekvivalenty, které jsi vepsal/a!)
Název hostitele: názevdomény
Uživatel: název účtu / emailová addresa
heslo: heslo, které jsi si zvolil/a', + 'emailaddress' => 'Emailová adresa', + 'emails_add' => 'Vytvořit emailové adresy', + 'emails_edit' => 'Upravit emailovou adresu', + 'catchall' => 'Catchall', + 'iscatchall' => 'Definovat jako catchall-adresu?', + 'account' => 'Účet', + 'account_add' => 'Vytvořit účet', + 'account_delete' => 'Smazat účet', + 'from' => 'Zdroj', + 'to' => 'Cíl', + 'forwarders' => 'Forwarders', + 'forwarder_add' => 'Vytvořit forwarder', + 'alternative_emailaddress' => 'Alternativní emailová adresa', + 'quota' => 'Kvóta', + 'noquota' => 'Bez kvóty', + 'updatequota' => 'Aktualizovat kvótu', + 'back_to_overview' => 'Zpět na přehled', + ], + 'error' => [ + 'error' => 'Chyba', + 'directorymustexist' => 'Adresář %s musí existovat. Vytvoř jej prosím v FTP klientovi.', + 'filemustexist' => 'Soubor %s musí existovat.', + 'allresourcesused' => 'Již jsi využil všechny svoje zdroje.', + 'domains_cantdeletemaindomain' => 'Nemůžeš smazat doménu, která je využívána pro emailovou doménu.', + 'domains_canteditdomain' => 'Tuto doménu nemůžeš měnit. Administrátor tuto možnost vypnul.', + 'domains_cantdeletedomainwithemail' => 'Nemůžeš smazat doménu, která je využívána pro emailovou doménu. Nejříve smaž všechny emailové adresy.', + 'firstdeleteallsubdomains' => 'Nejdříve musíš smazat všechny subdomény, než vytvoříš wildcard doménu.', + 'youhavealreadyacatchallforthisdomain' => 'Již jsi definoval catchall pro tuto doménu.', + 'ftp_cantdeletemainaccount' => 'Nemůžeš smazat svůj hlavní FTP účet', + 'login' => 'Zadané uživatelské jméno nebo heslo je špatné. Zkus to prosím za chvíli!', + 'login_blocked' => 'Tento účet byl zablokován po příliš mnoho selhaných pokusech o přihlášení.
Zkus to znovu za %s sekund.', + 'notallreqfieldsorerrors' => 'Nic jsi nevyplnil nebo jsi vyplnil některé kolonky špatně.', + 'oldpasswordnotcorrect' => 'Staré heslo není správné.', + 'youcantallocatemorethanyouhave' => 'Nemůžeš přiřadit více prostředků, než vlastníš.', + 'mustbeurl' => 'Nenapsal jsi správnou nebo kompletí odkaz (např. http://somedomain.com/error404.htm)', + 'invalidpath' => 'Nevybral jsi správný odkaz (možná se jedná o problém s dirlisting?)', + 'stringisempty' => 'Chybějící vstup v poli', + 'stringiswrong' => 'Špatný vstup v poli', + 'newpasswordconfirmerror' => 'Nové heslo a jeho potvrzení neodpovídá', + 'mydomain' => '\'Doména\'', + 'mydocumentroot' => '\'Documentroot\'', + 'loginnameexists' => 'Přihlašovací jméno %s již existuje', + 'emailiswrong' => 'Email. adresa %s neplatné znaky nebo není kompletní', + 'alternativeemailiswrong' => 'Zadaná alternativní email. adresa %s k odeslání údajů se zdá být neplatná', + 'loginnameiswrong' => 'Přihlašovací jméno "%s" obsahuje nepovolené znaky.', + 'loginnameiswrong2' => 'Přihlašovací jméno obsahuje příliš mnoho znaků. Jen %s znaky jsou povoleny.', + 'userpathcombinationdupe' => 'Kombinace přihlašovacího jména a cesty již existuje', + 'patherror' => 'Obecná chyba! Cesta nesmí být prázdná', + 'errordocpathdupe' => 'Možnost u cesty %s již existuje', + 'adduserfirst' => 'Nejdřív vytvoř zákazníka, prosím', + 'domainalreadyexists' => 'Doména %s je již přiřazena k zákazníkovi', + 'nolanguageselect' => 'Není vybrán žádný jazyk.', + 'nosubjectcreate' => 'Musíš definovat téma k této emailové šabloně.', + 'nomailbodycreate' => 'Musíš definovat text emailu pro tuto emailovou šablonu.', + 'templatenotfound' => 'Šablona nebyla nalezena.', + 'alltemplatesdefined' => 'Nemůžeš nadefinovat více šablon, všechny jazyky jsou již podporovány.', + 'wwwnotallowed' => 'www není povolena pro subdomény.', + 'subdomainiswrong' => 'Subdoména %s nemůže obsahovat neplatné znaky.', + 'domaincantbeempty' => 'Název domény nemůže být prázdná.', + 'domainexistalready' => 'Doména %s již existuje.', + 'emailexistalready' => 'Emailová adresa %s již existuje.', + 'maindomainnonexist' => 'Hlavní doména %s neexistuje.', + 'myipnotdouble' => 'Tato IP/Port kombinace již existuje.', + 'stringformaterror' => 'Hodnota pro pole "%s" není v očekávaném formátu.', + 'youcantdeleteyourself' => 'Z bezpečnostních důvodů nemůžeš smazat sám sebe.', + 'youcanteditallfieldsofyourself' => 'POZNÁMKA: Nemůžeš upravit všechna pole tvého vlastního účtu kvůli bezpečnosti.', + 'documentrootexists' => 'Adresář "%s" pro tohoto zázaníka již existuje. Odeber to před znovu přidáním tohoto zákazníka.', + 'logerror' => 'Log-Chyba: %s', + 'nomessagetosend' => 'Nezadal/a jsi zprávu.', + 'norecipientsgiven' => 'Nespecifikoval/a jsi žádného příjemce', + 'errorsendingmail' => 'Zpráva uživateli "%s" selhala', + 'cannotreaddir' => 'Nelze přečíst adresář "%s"', + 'invalidip' => 'Neplatná IP adresa: %s', + 'cannotwritetologfile' => 'Nelze otevřít log soubor %s pro zápis', + 'phpsettingidwrong' => 'Konfigurace s tímto ID neexistuje', + 'descriptioninvalid' => 'Popis je moc krátký, dlouhý nebo obsahuje nepovolené znaky.', + 'filecontentnotset' => 'Soubor nemůže být prázdný!', + 'customerdoesntexist' => 'Zvolený zákazník neexistuje.', + 'admindoesntexist' => 'Zvolený administrátor neexistuje.', + 'intvaluetoolow' => 'Zadané číslo je přiliš malé (pole %s)', + 'intvaluetoohigh' => 'Zadané číslo je příliš vysoké (pole %s)', + 'session_timeout' => 'Moc nízká hodnota', + 'operationnotpermitted' => 'Operace nepovolena!', + 'featureisdisabled' => 'Funkce %s je vypnuta. Kontaktuj prosím providera.', + 'usercurrentlydeactivated' => 'Uživatel %s je momentálně deaktivován', + 'no_phpinfo' => 'Omlouváme se, ale phpinfo() nelze načíst', + 'customized_version' => 'Vypadá to, že tvá instalace Froxloru byla upravována, podpora byla zrušena, promiň.', + 'autoupdate_0' => 'Neznámá chyba', + 'autoupdate_1' => 'PHP nastavení allow_url_fopen je vypnuté. Automatická aktualizace toto nastavení potřebuje v php.ini', + 'autoupdate_2' => 'PHP zip rozšíření nebylo nalezeno, ujisti se, že je nainstalované a aktivované', + 'autoupdate_4' => 'Froxlor archiv nemohl být uložen na disku :(', + 'autoupdate_5' => 'version.froxlor.org vrátila nepřijatelné hodnoty :(', + 'autoupdate_6' => 'Uf, nebyla nalezena (platná) verze ke stažení :(', + 'autoupdate_7' => 'Stažený archiv nebyl nalezen :(', + 'autoupdate_8' => 'Archiv nemohl být extrahován :(', + 'autoupdate_9' => 'Stažený soubor neprošel testem integrity. Zkus aktualizaci znovu.', + 'autoupdate_10' => 'Minimální podporovaná verze PHP je 7.4.0', + 'dns_domain_nodns' => 'DNS pro tuto doménu je vypnuto', + ], + 'extras' => [ + 'description' => 'Zde můžeš přidat dodatečné věci, např. ochranu odresáře.
Systém bude potřebovat nějaký čas pro aplikování změn.', + 'directoryprotection_add' => 'Přidat ocrhanu adresáře', + 'view_directory' => 'Zobrazit obsah adresáře', + 'pathoptions_add' => 'Přidat možnosti cesty', + 'directory_browsing' => 'Procházení obsahu adresáře', + 'pathoptions_edit' => 'Upravit možnosti cesty', + 'execute_perl' => 'Spustit perl/CGI', + 'backup' => 'Vytvořit zálohu', + 'backup_web' => 'Zálohovat web-data', + 'backup_mail' => 'Zálohovat mail-data', + 'backup_dbs' => 'Zálohovat databáze', + ], + 'ftp' => [ + 'description' => 'Zde můžeš tvořit a upravovat tvé FTP-účty.
Změny jsou uskutečněny okamžitě a účty mohou být použity ihned.', + 'account_add' => 'Vytvořit účet', + 'account_edit' => 'Upravit ftp účet', + ], + 'gender' => [ + 'title' => 'Titul', + 'male' => 'Pan.', + 'female' => 'Paní.', + 'undef' => '', + ], + 'index' => [ + 'customerdetails' => 'Detaily zákazníka', + 'accountdetails' => 'Detaily účtu', + ], + 'logger' => [ + 'date' => 'Datum', + 'type' => 'Typ', + 'action' => 'Akce', + 'user' => 'Uživatel', + 'truncate' => 'Prázdný log', + 'admin' => 'Administrátor', + 'login' => 'Přihlášení', + 'intern' => 'Interní', + 'unknown' => 'Neznámý', + ], + 'login' => [ + 'username' => 'Uživatelské jméno', + 'password' => 'Heslo', + 'language' => 'Jazyk', + 'login' => 'Přihlásit se', + 'logout' => 'Odhlásit se', + 'profile_lng' => 'Jazyk profilu', + 'forgotpwd' => 'Zapomněl jsi heslo?', + 'presend' => 'Resetovat heslo', + 'email' => 'Emailová addresa', + 'remind' => 'Resetovat mé heslo', + 'usernotfound' => 'Uživatel nenalezen!', + '2fa' => 'Dvoufázové ověření (2FA)', + '2facode' => 'Prosím zadej 2FA kód', + ], + 'mails' => [ + 'pop_success' => [ + 'subject' => 'Emailový účet nastaven úspěšně', + ], + 'createcustomer' => [ + 'subject' => 'Informace o účtu', + ], + 'password_reset' => [ + 'subject' => 'Resetovat heslo', + ], + ], + 'menu' => [ + 'message' => 'Zprávy', + ], + 'menue' => [ + 'main' => [ + 'main' => 'Hlavní', + 'changepassword' => 'Změnit heslo', + 'changelanguage' => 'Změnit jazyk', + 'username' => 'Přihlášen/a jako: ', + 'changetheme' => 'Změnit téma', + 'apihelp' => 'API pomoc', + 'apikeys' => 'API klíče', + ], + 'email' => [ + 'email' => 'Email', + 'emails' => 'Adresy', + 'webmail' => 'Webmail', + ], + 'mysql' => [ + 'mysql' => 'MySQL', + 'databases' => 'Databáze', + 'phpmyadmin' => 'phpMyAdmin', + ], + 'domains' => [ + 'domains' => 'Domény', + 'settings' => 'Nastavení', + ], + 'ftp' => [ + 'ftp' => 'FTP', + 'accounts' => 'Účty', + 'webftp' => 'WebFTP', + ], + 'extras' => [ + 'extras' => 'Extra', + 'directoryprotection' => 'Ochrana adresáře', + 'pathoptions' => 'Možnosti cesty', + 'backup' => 'Záloha', + ], + 'traffic' => [ + 'traffic' => 'Provoz', + 'current' => 'Momentální měsíc', + 'table' => 'Provoz', + ], + 'phpsettings' => [ + 'maintitle' => 'PHP konfigurace', + ], + ], + 'message' => [ + 'norecipients' => 'Email nebyl odeslán, protože databáze neobsahuje žádné příjemce', + ], + 'mysql' => [ + 'databasename' => 'Název uživetele/databáze', + 'databasedescription' => 'Popis databáze', + 'database_create' => 'Vytvořit databázi', + 'size' => 'Velikost', + ], + 'opcacheinfo' => [ + 'resetcache' => 'Resetovat OPcache', + 'version' => 'OPCache verze', + 'phpversion' => 'PHP verze', + 'start' => 'Čas zapnutí', + 'lastreset' => 'Poslední restart', + 'oomrestarts' => 'OOM restart count', + 'hashrestarts' => 'Hash restart count', + 'manualrestarts' => 'Manual restart count', + 'status' => 'Stav', + 'cachefull' => 'Cache je plný', + 'restartinprogress' => 'Restart právě probíhá', + 'memusage' => 'Využití paměti', + 'totalmem' => 'Celková pamět', + 'usedmem' => 'Využitá paměť', + 'freemem' => 'Volná pamět', + 'used' => 'Využité', + 'free' => 'Volné', + 'blacklist' => 'Černá listina', + 'novalue' => 'bez hodnoty', + ], + 'panel' => [ + 'edit' => 'Upravit', + 'delete' => 'Smazat', + 'create' => 'Vytvořit', + 'save' => 'Uložit', + 'yes' => 'Ano', + 'no' => 'Ne', + 'path' => 'Cesta', + 'toggle' => 'Toggle', + 'next' => 'Další', + 'dirsmissing' => 'Nemůžu najít nebo přečíst adresář!', + 'pathorurl' => 'Cesta nebo URL', + 'ascending' => 'vzestupně', + 'descending' => 'sestupně', + 'search' => 'Hledat', + 'used' => 'použito', + 'translator' => 'Překladač', + 'reset' => 'Zahodit změny', + 'pathDescription' => 'Pokud adresář neexistuje, bude automaticky vytvořen.', + 'back' => 'Zpět', + 'reseller' => 'prodejce', + 'admin' => 'admin', + 'customer' => 'zákazník/ci', + 'send' => 'odeslat', + 'nosslipsavailable' => 'Momentálně zde nejsou žádné ssl ip/port kombinace pro tento server', + 'backtooverview' => 'Zpět na přehled', + 'dateformat' => 'RRRR-MM-DD', + 'dateformat_function' => 'R-m-d', + 'timeformat_function' => 'H:i:s', + 'default' => 'Výchozí', + 'never' => 'Nikdy', + 'active' => 'Aktivní', + 'please_choose' => 'Zvol prosím', + 'allow_modifications' => 'Povolit modifikace', + 'not_supported' => 'Nepodporováno v: ', + 'neverloggedin' => 'Zatím bez přihlášení', + 'theme' => 'Téma', + 'variable' => 'Variable', + 'description' => 'Popis', + 'cancel' => 'Zrušit', + 'ssleditor' => 'SSL nastavené pro tuto doménu', + 'dashboard' => 'Nástěnka', + 'assigned' => 'Přiřazen', + 'available' => 'Dostupný', + 'letsencrypt' => 'Používá Let\'s encrypt', + 'set' => 'Použít', + 'none_value' => 'Nic', + ], + 'pwdreminder' => [ + 'success' => 'Žádost o reset hesla úspěšně odeslána. Následuj prosím instrukce v emailu, který jsi obdržel/a.', + 'notallowed' => 'Resetování hesla je vypnuto', + ], + 'question' => [ + 'question' => 'Bezpečnostní otázka', + 'admin_customer_reallydelete' => 'Opravdu chceš smazat zákazníka %s? Tuto akci nelze vrátit zpět!', + 'admin_domain_reallydelete' => 'Opravdu chceš smazat doménu %s?', + 'mysql_reallydelete' => 'Opravdu chceš smazat databázi %s? Tento krok je nevratný!', + 'admin_customer_alsoremovefiles' => 'Smazat i soubory uživatelů?', + 'admin_ip_reallydelete' => 'Opravdu chceš odebrat IP adresu %s?', + 'admin_counters_reallyupdate' => 'Opravdu chceš přepočítat využití zdrojů?', + ], + 'redirect_desc' => [ + 'rc_movedperm' => 'permanentně přesunuto', + ], + 'serversettings' => [ + 'documentroot_prefix' => [ + 'title' => 'Domovský adresář', + ], + 'bindreload_command' => [ + 'title' => 'Příkaz pro znovu načtení DNS serveru', + 'description' => 'Jaký je příkaz pro znovu načtení dns serveru?', + ], + 'vmail_uid' => [ + 'description' => 'Jaké uživatelsk=e ID by měly emaily mít?', + ], + 'vmail_gid' => [ + 'description' => 'Jaké skupinové ID by měly emaily mít?', + ], + 'vmail_homedir' => [ + 'title' => 'Domovská složka pro emaily', + 'description' => 'Kde by všechny emaily měly být uloženy?', + ], + 'adminmail' => [ + 'title' => 'Odesílatel', + 'description' => 'Jaká je adresa odesílatele na emaily odeslané z panelu?', + ], + 'phpmyadmin_url' => [ + 'description' => 'Jaké je URL do phpMyAdmin? (musí začínat with http(s)://)', + ], + 'webmail_url' => [ + 'title' => 'Webový mail URL', + 'description' => 'Jaké je URL do webového mailu? (musí začínath http(s)://)', + ], + 'webftp_url' => [ + 'description' => 'Jaké je URL do WebFTP? (musí začínat http(s)://)', + ], + 'language' => [ + 'description' => 'Jaký je tvůj standartní jazyk serveru?', + ], + 'maxloginattempts' => [ + 'title' => 'Max. pokusů o přihlášení', + 'description' => 'Maximum pokusů o přihlášení do deaktivace účtu.', + ], + 'deactivatetime' => [ + 'title' => 'Čas deaktivace', + 'description' => 'Čas (v sek.) po kterých se účet deaktivuje po několika neúspěšných pokusech o přihlášení.', + ], + 'pathedit' => [ + 'title' => 'Typ obsahu cesty', + 'description' => 'Měla by cesta být na výběr z rozbalovací nabídky nebo jen zadána do textového pole?', + ], + 'nameservers' => [ + 'title' => 'Názvy serverů', + 'description' => 'Seznam oddělený čárkami obsahující názvy hostitelů všech jmenných serverů. První bude primární.', + ], + 'mxservers' => [ + 'title' => 'MX servery', + 'description' => 'Seznam oddělený čárkami obsahující dvojici čísla a jméno hostitele oddělené mezerou (např. \'10 mx.example.com\') obsahující servery mx.', + ], + 'defaultip' => [ + 'title' => 'Výchozí IP/Port', + ], + 'defaultsslip' => [ + 'title' => 'Výchozí SSL IP/Port', + ], + 'deactivateddocroot' => [ + 'title' => 'Docroot pro deaktivované uživatele', + ], + 'mailpwcleartext' => [ + 'title' => 'Také ukládat hesla emailů nezašifrované v databázi', + ], + 'ftpdomain' => [ + 'title' => 'FTP účty @domain', + 'description' => 'Zákazníci mohou vytvářet FTP účty user@customerdomain?', + ], + 'mod_fcgid' => [ + 'title' => 'Povolit FCGID', + 'configdir' => [ + 'title' => 'Konfigurace adresářů', + 'description' => 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/

POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.
', + ], + 'tmpdir' => [ + 'title' => 'Dočasný adresář', + ], + 'maxrequests' => [ + 'title' => 'Maximum požadavků na doménu', + 'description' => 'Kolik požadavků na doménu by mělo být povoleno?', + ], + ], + 'webalizer_quiet' => [ + 'title' => 'Webalizer výstup', + 'description' => 'Verbosity of the webalizer-program', + ], + 'logger' => [ + 'enable' => 'Logging zapnuto/vypnuto', + 'severity' => 'Logging úroveň', + 'logcronoption' => [ + 'never' => 'Nikdy', + 'once' => 'Jednou', + 'always' => 'Vždy', + ], + ], + 'ssl' => [ + 'use_ssl' => [ + 'title' => 'Povolit SSL využití', + 'description' => 'Tohle zaškrtni, pokud chceš používat SSL pro tvůj webový server', + ], + 'ssl_cert_file' => [ + 'title' => 'Cesta k SSL certifikátu', + 'description' => 'Specifikujte cestu k souboru obsahující v názvu .crt nebo .pem koncovku (hlavní certifikát)', + ], + 'openssl_cnf' => 'Výchozí nastavení pro tvorbu Cert souboru', + ], + 'default_vhostconf' => [ + 'title' => 'Výchozí vHost-nastavení', + ], + 'webalizer_enabled' => 'Povolit webalizer statistiky', + 'awstats_enabled' => 'Povolit AWstats statistiky', + 'selfdnscustomer' => [ + 'title' => 'Povolit zákazníkům upravovat dns nastavení domén', + ], + 'unix_names' => [ + 'title' => 'Použít kompatibilní přezdívky s UNIX ', + ], + 'allow_password_reset' => [ + 'title' => 'Povolit resetování hesla pro zákazníky', + ], + 'allow_password_reset_admin' => [ + 'title' => 'Povolit reset hesla pro adminy', + ], + 'panel_password_min_length' => [ + 'title' => 'Minimální délka hesla', + ], + 'perl_path' => [ + 'title' => 'Cesta k perl', + 'description' => 'Výchozí je /usr/bin/perl', + ], + 'perl_server' => [ + 'title' => 'Perl umístění na serveru', + ], + 'phpfpm' => [ + 'title' => 'Zapnout php-fpm', + ], + 'default_theme' => 'Výchozí téma', + 'diskquota_enabled' => 'Kvóta aktivována?', + 'apache_24' => [ + 'title' => 'Použít modifikace pro Apache 2.4', + ], + 'systemdefault' => 'Základní systém. nastavení', + 'panel_allow_theme_change_admin' => 'Povolit amdinům změnit téma', + 'mailtraffic_enabled' => [ + 'title' => 'Analyzovat mailový provoz', + ], + 'letsencryptstate' => [ + 'description' => 'State used to generate Let\'s Encrypt certificates.', + ], + 'leenabled' => [ + 'title' => 'Zapnout Let\'s Encrypt', + ], + 'caa_entry' => [ + 'title' => 'Generovat CAA DNS záznamy', + ], + 'backupenabled' => [ + 'title' => 'Povolit zálohy pro zákazníky', + ], + 'mail_smtp_passwd' => 'SMTP heslo', + ], + 'success' => [ + 'messages_success' => 'Zpráva úspěšně odeslána %s příjemcům,', + 'success' => 'Informace', + 'clickheretocontinue' => 'Klikni zde pro pokračování', + 'settingssaved' => 'Nastavení bylo úspěšně uloženo.', + 'domain_import_successfully' => 'Úspěšně importováno %s domén.', + 'testmailsent' => 'Testovací email byl odeslán úspěšně', + ], + 'tasks' => [ + 'CREATE_QUOTA' => 'Set quota on filesystem', + ], + 'traffic' => [ + 'month' => 'Měsíc', + 'day' => 'Den', + 'months' => [ + 1 => 'Leden', + 2 => 'Únor', + 3 => 'Březen', + 4 => 'Duben', + 5 => 'Květen', + 6 => 'Červen', + 7 => 'Červenec', + 8 => 'Srpen', + 9 => 'Září', + 10 => 'Říjen', + 11 => 'Listopad', + 12 => 'Prosinec', + 'jan' => 'Led', + 'feb' => 'Úno', + 'mar' => 'Bře', + 'apr' => 'Dub', + 'may' => 'Kvě', + 'jun' => 'Čer', + 'jul' => 'Čer', + 'aug' => 'Srp', + 'sep' => 'Zář', + 'oct' => 'Říj', + 'nov' => 'Lis', + 'dec' => 'Pro', + 'total' => 'Celkem', + ], + 'mb' => 'Provoz (MiB)', + 'sumhttp' => 'Celkový HTTP-Provoz', + 'sumftp' => 'Celkový FTP-Provoz', + 'summail' => 'Celkový Mail-Provoz', + 'customer' => 'Zákazník', + 'domain' => 'Doména', + 'trafficoverview' => 'Shrnutí provozu podle', + 'details' => 'Detaily', + ], + 'translator' => '', +]; diff --git a/lng/czech.lng.php b/lng/czech.lng.php deleted file mode 100644 index de0383bc..00000000 --- a/lng/czech.lng.php +++ /dev/null @@ -1,916 +0,0 @@ - - * @author Froxlor Team - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Global - */ -$lng['translator'] = ''; -$lng['panel']['edit'] = 'Upravit'; -$lng['panel']['delete'] = 'Smazat'; -$lng['panel']['create'] = 'Vytvořit'; -$lng['panel']['save'] = 'Uložit'; -$lng['panel']['yes'] = 'Ano'; -$lng['panel']['no'] = 'Ne'; -$lng['panel']['path'] = 'Cesta'; -$lng['panel']['toggle'] = 'Toggle'; -$lng['panel']['next'] = 'Další'; -$lng['panel']['dirsmissing'] = 'Nemůžu najít nebo přečíst adresář!'; - -/** - * Login - */ - -$lng['login']['username'] = 'Uživatelské jméno'; -$lng['login']['password'] = 'Heslo'; -$lng['login']['language'] = 'Jazyk'; -$lng['login']['login'] = 'Přihlásit se'; -$lng['login']['logout'] = 'Odhlásit se'; -$lng['login']['profile_lng'] = 'Jazyk profilu'; - -/** - * Customer - */ - -$lng['customer']['documentroot'] = 'Domovský adresář'; -$lng['customer']['name'] = 'Název'; -$lng['customer']['firstname'] = 'Křestní jméno'; -$lng['customer']['company'] = 'Společnost'; -$lng['customer']['street'] = 'Ulice'; -$lng['customer']['zipcode'] = 'PSČ'; -$lng['customer']['city'] = 'Město'; -$lng['customer']['phone'] = 'Telefon'; -$lng['customer']['fax'] = 'Fax'; -$lng['customer']['email'] = 'Email'; -$lng['customer']['customernumber'] = 'ID Zákazníka'; -$lng['customer']['diskspace'] = 'Webový prostor (MiB)'; -$lng['customer']['traffic'] = 'Provoz (GiB)'; -$lng['customer']['mysqls'] = 'MySQL-databáze'; -$lng['customer']['emails'] = 'Email-adresy'; -$lng['customer']['accounts'] = 'Email-účty'; -$lng['customer']['forwarders'] = 'Email-forwarders'; -$lng['customer']['ftps'] = 'FTP-účty'; -$lng['customer']['subdomains'] = 'Subdomény'; -$lng['customer']['domains'] = 'Domény'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Hlavní'; -$lng['menue']['main']['changepassword'] = 'Změnit heslo'; -$lng['menue']['main']['changelanguage'] = 'Změnit jazyk'; -$lng['menue']['email']['email'] = 'Email'; -$lng['menue']['email']['emails'] = 'Adresy'; -$lng['menue']['email']['webmail'] = 'Webmail'; -$lng['menue']['mysql']['mysql'] = 'MySQL'; -$lng['menue']['mysql']['databases'] = 'Databáze'; -$lng['menue']['mysql']['phpmyadmin'] = 'phpMyAdmin'; -$lng['menue']['domains']['domains'] = 'Domény'; -$lng['menue']['domains']['settings'] = 'Nastavení'; -$lng['menue']['ftp']['ftp'] = 'FTP'; -$lng['menue']['ftp']['accounts'] = 'Účty'; -$lng['menue']['ftp']['webftp'] = 'WebFTP'; -$lng['menue']['extras']['extras'] = 'Extra'; -$lng['menue']['extras']['directoryprotection'] = 'Ochrana adresáře'; -$lng['menue']['extras']['pathoptions'] = 'Možnosti cesty'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Detaily zákazníka'; -$lng['index']['accountdetails'] = 'Detaily účtu'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Staré heslo'; -$lng['changepassword']['new_password'] = 'Nové heslo'; -$lng['changepassword']['new_password_confirm'] = 'Potvrdit heslo'; -$lng['changepassword']['new_password_ifnotempty'] = 'Nové heslo (prázdné = beze změny)'; -$lng['changepassword']['also_change_ftp'] = ' také změní heslo hlavního FTP účtu'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Zde můžeš vytvořit a upravit (sub-)domémny a změnit jejich cesty.
Systém bude chtít nějaký čas pro aplikování nového nastavení po každé změně.'; -$lng['domains']['domainsettings'] = 'Nastavení domény'; -$lng['domains']['domainname'] = 'Název domény'; -$lng['domains']['subdomain_add'] = 'Vytvořit subdoménu'; -$lng['domains']['subdomain_edit'] = 'Upravit (sub)doménu'; -$lng['domains']['wildcarddomain'] = 'Vytvořit jako wildcarddoménu?'; -$lng['domains']['aliasdomain'] = 'Alias pro doménu'; -$lng['domains']['noaliasdomain'] = 'Doména bez aliasu'; - -/** - * E-mails - */ - -$lng['emails']['description'] = 'Zde můžeš vytvořit a upravit tvé emailové adresy.
Účet je jako poštovní schránka před tvým domem. Pokud ti někdo odešle email, přijde ti do tvého účtu.

Pro stažení tvých emailů použij následující nastavení v tvém emailovém klientovi: (Data v italském fontu na ekvivalenty, které jsi vepsal/a!)
Název hostitele: názevdomény
Uživatel: název účtu / emailová addresa
heslo: heslo, které jsi si zvolil/a'; -$lng['emails']['emailaddress'] = 'Emailová adresa'; -$lng['emails']['emails_add'] = 'Vytvořit emailové adresy'; -$lng['emails']['emails_edit'] = 'Upravit emailovou adresu'; -$lng['emails']['catchall'] = 'Catchall'; -$lng['emails']['iscatchall'] = 'Definovat jako catchall-adresu?'; -$lng['emails']['account'] = 'Účet'; -$lng['emails']['account_add'] = 'Vytvořit účet'; -$lng['emails']['account_delete'] = 'Smazat účet'; -$lng['emails']['from'] = 'Zdroj'; -$lng['emails']['to'] = 'Cíl'; -$lng['emails']['forwarders'] = 'Forwarders'; -$lng['emails']['forwarder_add'] = 'Vytvořit forwarder'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Zde můžeš tvořit a upravovat tvé FTP-účty.
Změny jsou uskutečněny okamžitě a účty mohou být použity ihned.'; -$lng['ftp']['account_add'] = 'Vytvořit účet'; - -/** - * MySQL - */ - -$lng['mysql']['databasename'] = 'Název uživetele/databáze'; -$lng['mysql']['databasedescription'] = 'Popis databáze'; -$lng['mysql']['database_create'] = 'Vytvořit databázi'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Zde můžeš přidat dodatečné věci, např. ochranu odresáře.
Systém bude potřebovat nějaký čas pro aplikování změn.'; -$lng['extras']['directoryprotection_add'] = 'Přidat ocrhanu adresáře'; -$lng['extras']['view_directory'] = 'Zobrazit obsah adresáře'; -$lng['extras']['pathoptions_add'] = 'Přidat možnosti cesty'; -$lng['extras']['directory_browsing'] = 'Procházení obsahu adresáře'; -$lng['extras']['pathoptions_edit'] = 'Upravit možnosti cesty'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Chyba'; -$lng['error']['directorymustexist'] = 'Adresář %s musí existovat. Vytvoř jej prosím v FTP klientovi.'; -$lng['error']['filemustexist'] = 'Soubor %s musí existovat.'; -$lng['error']['allresourcesused'] = 'Již jsi využil všechny svoje zdroje.'; -$lng['error']['domains_cantdeletemaindomain'] = 'Nemůžeš smazat doménu, která je využívána pro emailovou doménu.'; -$lng['error']['domains_canteditdomain'] = 'Tuto doménu nemůžeš měnit. Administrátor tuto možnost vypnul.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'Nemůžeš smazat doménu, která je využívána pro emailovou doménu. Nejříve smaž všechny emailové adresy.'; -$lng['error']['firstdeleteallsubdomains'] = 'Nejdříve musíš smazat všechny subdomény, než vytvoříš wildcard doménu.'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'Již jsi definoval catchall pro tuto doménu.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'Nemůžeš smazat svůj hlavní FTP účet'; -$lng['error']['login'] = 'Zadané uživatelské jméno nebo heslo je špatné. Zkus to prosím za chvíli!'; -$lng['error']['login_blocked'] = 'Tento účet byl zablokován po příliš mnoho selhaných pokusech o přihlášení.
Zkus to znovu za %s sekund.'; -$lng['error']['notallreqfieldsorerrors'] = 'Nic jsi nevyplnil nebo jsi vyplnil některé kolonky špatně.'; -$lng['error']['oldpasswordnotcorrect'] = 'Staré heslo není správné.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'Nemůžeš přiřadit více prostředků, než vlastníš.'; -$lng['error']['mustbeurl'] = 'Nenapsal jsi správnou nebo kompletí odkaz (např. http://somedomain.com/error404.htm)'; -$lng['error']['invalidpath'] = 'Nevybral jsi správný odkaz (možná se jedná o problém s dirlisting?)'; -$lng['error']['stringisempty'] = 'Chybějící vstup v poli'; -$lng['error']['stringiswrong'] = 'Špatný vstup v poli'; -$lng['error']['newpasswordconfirmerror'] = 'Nové heslo a jeho potvrzení neodpovídá'; -$lng['error']['mydomain'] = '\'Doména\''; -$lng['error']['mydocumentroot'] = '\'Documentroot\''; -$lng['error']['loginnameexists'] = 'Přihlašovací jméno %s již existuje'; -$lng['error']['emailiswrong'] = 'Email. adresa %s neplatné znaky nebo není kompletní'; -$lng['error']['alternativeemailiswrong'] = 'Zadaná alternativní email. adresa %s k odeslání údajů se zdá být neplatná'; -$lng['error']['loginnameiswrong'] = 'Přihlašovací jméno "%s" obsahuje nepovolené znaky.'; -$lng['error']['loginnameiswrong2'] = 'Přihlašovací jméno obsahuje příliš mnoho znaků. Jen %s znaky jsou povoleny.'; -$lng['error']['userpathcombinationdupe'] = 'Kombinace přihlašovacího jména a cesty již existuje'; -$lng['error']['patherror'] = 'Obecná chyba! Cesta nesmí být prázdná'; -$lng['error']['errordocpathdupe'] = 'Možnost u cesty %s již existuje'; -$lng['error']['adduserfirst'] = 'Nejdřív vytvoř zákazníka, prosím'; -$lng['error']['domainalreadyexists'] = 'Doména %s je již přiřazena k zákazníkovi'; -$lng['error']['nolanguageselect'] = 'Není vybrán žádný jazyk.'; -$lng['error']['nosubjectcreate'] = 'Musíš definovat téma k této emailové šabloně.'; -$lng['error']['nomailbodycreate'] = 'Musíš definovat text emailu pro tuto emailovou šablonu.'; -$lng['error']['templatenotfound'] = 'Šablona nebyla nalezena.'; -$lng['error']['alltemplatesdefined'] = 'Nemůžeš nadefinovat více šablon, všechny jazyky jsou již podporovány.'; -$lng['error']['wwwnotallowed'] = 'www není povolena pro subdomény.'; -$lng['error']['subdomainiswrong'] = 'Subdoména %s nemůže obsahovat neplatné znaky.'; -$lng['error']['domaincantbeempty'] = 'Název domény nemůže být prázdná.'; -$lng['error']['domainexistalready'] = 'Doména %s již existuje.'; -$lng['error']['emailexistalready'] = 'Emailová adresa %s již existuje.'; -$lng['error']['maindomainnonexist'] = 'Hlavní doména %s neexistuje.'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Bezpečnostní otázka'; -$lng['question']['admin_customer_reallydelete'] = 'Opravdu chceš smazat zákazníka %s? Tuto akci nelze vrátit zpět!'; -$lng['question']['admin_domain_reallydelete'] = 'Opravdu chceš smazat doménu %s?'; -$lng['question']['mysql_reallydelete'] = 'Opravdu chceš smazat databázi %s? Tento krok je nevratný!'; -$lng['question']['admin_customer_alsoremovefiles'] = 'Smazat i soubory uživatelů?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['subject'] = 'Emailový účet nastaven úspěšně'; -$lng['mails']['createcustomer']['subject'] = 'Informace o účtu'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Přehled'; -$lng['admin']['ressourcedetails'] = 'Využité zdroje'; -$lng['admin']['systemdetails'] = 'Detaily systému'; -$lng['admin']['froxlordetails'] = 'Froxlor detaily'; -$lng['admin']['installedversion'] = 'Nainstalovaná verze'; -$lng['admin']['latestversion'] = 'Poslední verze'; -$lng['admin']['lookfornewversion']['clickhere'] = 'Hledat pomocí webové služby'; -$lng['admin']['lookfornewversion']['error'] = 'Chyba při čtení'; -$lng['admin']['resources'] = 'Zdroje'; -$lng['admin']['customer'] = 'Zákazník'; -$lng['admin']['customers'] = 'Zákazníci'; -$lng['admin']['customer_add'] = 'Vytvořit zákazníka'; -$lng['admin']['customer_edit'] = 'Upravit zákazníka'; -$lng['admin']['domains'] = 'Domény'; -$lng['admin']['domain_add'] = 'Vytvořit doménu'; -$lng['admin']['domain_edit'] = 'Upravit doménu'; -$lng['admin']['subdomainforemail'] = 'Subdomény jako emailové domény'; -$lng['admin']['admin'] = 'Admin'; -$lng['admin']['admins'] = 'Admini'; -$lng['admin']['admin_add'] = 'Vytvořit admina'; -$lng['admin']['admin_edit'] = 'Upravit admina'; -$lng['admin']['customers_see_all'] = 'Může vidět všechny zákazníky?'; -$lng['admin']['domains_see_all'] = 'Může vidět všechny domény?'; -$lng['admin']['change_serversettings'] = 'Může vidět nastavení serveru?'; -$lng['admin']['server'] = 'Systém'; -$lng['admin']['serversettings'] = 'Nastavení'; -$lng['admin']['rebuildconf'] = 'Znovu setstavit konfigurační soubory'; -$lng['admin']['stdsubdomain'] = 'Standartní subdoména'; -$lng['admin']['stdsubdomain_add'] = 'Vytvořit standartní subdoménu'; -$lng['admin']['phpenabled'] = 'PHP povoleno'; -$lng['admin']['deactivated'] = 'Deaktivováno'; -$lng['admin']['deactivated_user'] = 'Deaktivovat uživatele'; -$lng['admin']['sendpassword'] = 'Odeslat heslo'; -$lng['admin']['ownvhostsettings'] = 'Vlastní vHost-nastavení'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Konfigurace'; -$lng['admin']['templates']['templates'] = 'Email-šablony'; -$lng['admin']['templates']['template_add'] = 'Přidat šablonu'; -$lng['admin']['templates']['template_edit'] = 'Upravit šablonu'; -$lng['admin']['templates']['action'] = 'Akce'; -$lng['admin']['templates']['email'] = 'Email & šablony souborů'; -$lng['admin']['templates']['subject'] = 'Předmět'; -$lng['admin']['templates']['mailbody'] = 'Tělo emailu'; -$lng['admin']['templates']['createcustomer'] = 'Uvítací email pro nové zákazníky'; -$lng['admin']['templates']['pop_success'] = 'Uvítací email pro nově založene emaily'; -$lng['admin']['templates']['template_replace_vars'] = 'Variables to be replaced in the template:'; -$lng['admin']['templates']['SALUTATION'] = 'Replaced with a correct salutation (name or company)'; -$lng['admin']['templates']['FIRSTNAME'] = 'Replaced with the customer\'s first name.'; -$lng['admin']['templates']['NAME'] = 'Nahrazeno jménem zákazníka.'; -$lng['admin']['templates']['COMPANY'] = 'Replaces with the customer\'s company name'; -$lng['admin']['templates']['USERNAME'] = 'Replaced with the customer\'s account username.'; -$lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account password.'; -$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.'; -$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number'; -$lng['admin']['webserver'] = 'Webový server'; - -/** - * Serversettings - */ - -$lng['serversettings']['documentroot_prefix']['title'] = 'Domovský adresář'; -$lng['serversettings']['bindreload_command']['title'] = 'Příkaz pro znovu načtení DNS serveru'; -$lng['serversettings']['bindreload_command']['description'] = 'Jaký je příkaz pro znovu načtení dns serveru?'; -$lng['serversettings']['vmail_uid']['description'] = 'Jaké uživatelsk=e ID by měly emaily mít?'; -$lng['serversettings']['vmail_gid']['description'] = 'Jaké skupinové ID by měly emaily mít?'; -$lng['serversettings']['vmail_homedir']['title'] = 'Domovská složka pro emaily'; -$lng['serversettings']['vmail_homedir']['description'] = 'Kde by všechny emaily měly být uloženy?'; -$lng['serversettings']['adminmail']['title'] = 'Odesílatel'; -$lng['serversettings']['adminmail']['description'] = 'Jaká je adresa odesílatele na emaily odeslané z panelu?'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'Jaké je URL do phpMyAdmin? (musí začínat with http(s)://)'; -$lng['serversettings']['webmail_url']['title'] = 'Webový mail URL'; -$lng['serversettings']['webmail_url']['description'] = 'Jaké je URL do webového mailu? (musí začínath http(s)://)'; -$lng['serversettings']['webftp_url']['description'] = 'Jaké je URL do WebFTP? (musí začínat http(s)://)'; -$lng['serversettings']['language']['description'] = 'Jaký je tvůj standartní jazyk serveru?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Max. pokusů o přihlášení'; -$lng['serversettings']['maxloginattempts']['description'] = 'Maximum pokusů o přihlášení do deaktivace účtu.'; -$lng['serversettings']['deactivatetime']['title'] = 'Čas deaktivace'; -$lng['serversettings']['deactivatetime']['description'] = 'Čas (v sek.) po kterých se účet deaktivuje po několika neúspěšných pokusech o přihlášení.'; -$lng['serversettings']['pathedit']['title'] = 'Typ obsahu cesty'; -$lng['serversettings']['pathedit']['description'] = 'Měla by cesta být na výběr z rozbalovací nabídky nebo jen zadána do textového pole?'; -$lng['serversettings']['nameservers']['title'] = 'Názvy serverů'; -$lng['serversettings']['nameservers']['description'] = 'Seznam oddělený čárkami obsahující názvy hostitelů všech jmenných serverů. První bude primární.'; -$lng['serversettings']['mxservers']['title'] = 'MX servery'; -$lng['serversettings']['mxservers']['description'] = 'Seznam oddělený čárkami obsahující dvojici čísla a jméno hostitele oddělené mezerou (např. \'10 mx.example.com\') obsahující servery mx.'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['error']['myipnotdouble'] = 'Tato IP/Port kombinace již existuje.'; -$lng['question']['admin_ip_reallydelete'] = 'Opravdu chceš odebrat IP adresu %s?'; -$lng['admin']['ipsandports']['add'] = 'Přidat IP/Port'; -$lng['admin']['ipsandports']['edit'] = 'Upravit IP/Port'; - -// ADDED IN 1.2.14-rc1 - -$lng['admin']['memorylimitdisabled'] = 'Vypnuto'; -$lng['domain']['openbasedirpath'] = 'OpenBasedir-cesta'; -$lng['domain']['docroot'] = 'Path from field above'; -$lng['domain']['homedir'] = 'Domovský adresář'; -$lng['admin']['valuemandatory'] = 'Tato hodnota je důležitá'; -$lng['menue']['main']['username'] = 'Přihlášen/a jako: '; -$lng['panel']['pathorurl'] = 'Cesta nebo URL'; -$lng['serversettings']['defaultip']['title'] = 'Výchozí IP/Port'; -$lng['serversettings']['defaultsslip']['title'] = 'Výchozí SSL IP/Port'; -$lng['domains']['statstics'] = 'Statistiky využití'; -$lng['panel']['ascending'] = 'vzestupně'; -$lng['panel']['descending'] = 'sestupně'; -$lng['panel']['search'] = 'Hledat'; -$lng['panel']['used'] = 'použito'; - -// ADDED IN 1.2.14-rc3 - -$lng['panel']['translator'] = 'Překladač'; - -// ADDED IN 1.2.14-rc4 - -$lng['error']['stringformaterror'] = 'Hodnota pro pole "%s" není v očekávaném formátu.'; - -// ADDED IN 1.2.15-rc1 - -$lng['admin']['serversoftware'] = 'Serversoftware'; -$lng['admin']['phpversion'] = 'PHP-Verze'; -$lng['admin']['mysqlserverversion'] = 'MySQL verze serveru'; -$lng['admin']['webserverinterface'] = 'Rozhraní webového serveru'; -$lng['domains']['isassigneddomain'] = 'Je přiřazenou doménou'; - -// CHANGED IN 1.2.15-rc1 - -$lng['error']['youcantdeleteyourself'] = 'Z bezpečnostních důvodů nemůžeš smazat sám sebe.'; -$lng['error']['youcanteditallfieldsofyourself'] = 'POZNÁMKA: Nemůžeš upravit všechna pole tvého vlastního účtu kvůli bezpečnosti.'; - - -// ADDED IN 1.2.16-svn2 - -$lng['serversettings']['deactivateddocroot']['title'] = 'Docroot pro deaktivované uživatele'; - -// ADDED IN 1.2.16-svn4 - -$lng['panel']['reset'] = 'Zahodit změny'; -$lng['admin']['accountsettings'] = 'Nastavení účtu'; -$lng['admin']['panelsettings'] = 'Nastavení panelu'; -$lng['admin']['systemsettings'] = 'Nastavení systému'; -$lng['admin']['webserversettings'] = 'Nastavení webového serveru'; -$lng['admin']['mailserversettings'] = 'Nastavení mailového serveru'; -$lng['admin']['nameserversettings'] = 'Nameserver settings'; -$lng['admin']['updatecounters'] = 'Přepočítat využití zdrojů'; -$lng['question']['admin_counters_reallyupdate'] = 'Opravdu chceš přepočítat využití zdrojů?'; -$lng['panel']['pathDescription'] = 'Pokud adresář neexistuje, bude automaticky vytvořen.'; - -// ADDED IN 1.2.16-svn7 - -$lng['admin']['subcanemaildomain']['never'] = 'Nikdy'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'Volitelné, výchozí ne'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'Volitelné, výchozí ano'; -$lng['admin']['subcanemaildomain']['always'] = 'Vždy'; -$lng['changepassword']['also_change_stats'] = ' také změní heslo na stránku k statistikám'; - -// ADDED IN 1.2.16-svn8 - -$lng['serversettings']['mailpwcleartext']['title'] = 'Také ukládat hesla emailů nezašifrované v databázi'; -$lng['admin']['configfiles']['overview'] = 'Přehled'; -$lng['admin']['configfiles']['wizard'] = 'Průvodce'; -$lng['admin']['configfiles']['distribution'] = 'Distribuce'; -$lng['admin']['configfiles']['service'] = 'Služba'; -$lng['admin']['configfiles']['etc'] = 'Ostatní (System)'; -$lng['admin']['configfiles']['choosedistribution'] = '-- Vyber distribuci --'; -$lng['admin']['configfiles']['chooseservice'] = '-- Vyber službu --'; - -// ADDED IN 1.2.16-svn10 - -$lng['serversettings']['ftpdomain']['title'] = 'FTP účty @domain'; -$lng['serversettings']['ftpdomain']['description'] = 'Zákazníci mohou vytvářet FTP účty user@customerdomain?'; -$lng['panel']['back'] = 'Zpět'; - -// ADDED IN 1.2.16-svn12 - -$lng['serversettings']['mod_fcgid']['title'] = 'Povolit FCGID'; -$lng['emails']['alternative_emailaddress'] = 'Alternativní emailová adresa'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Nahrazeno POP3/IMAP heslem účtu.'; - -// ADDED IN 1.2.16-svn13 - -$lng['error']['documentrootexists'] = 'Adresář "%s" pro tohoto zázaníka již existuje. Odeber to před znovu přidáním tohoto zákazníka.'; - -// ADDED IN 1.2.18-svn2 - -$lng['admin']['webalizersettings'] = 'Webalizer nastavení'; -$lng['admin']['webalizer']['normal'] = 'Normální'; -$lng['admin']['webalizer']['quiet'] = 'Tiché'; -$lng['admin']['webalizer']['veryquiet'] = 'Bez výstupu'; -$lng['serversettings']['webalizer_quiet']['title'] = 'Webalizer výstup'; -$lng['serversettings']['webalizer_quiet']['description'] = 'Verbosity of the webalizer-program'; - -// ADDED IN 1.2.18-svn4 - -$lng['admin']['domain_nocustomeraddingavailable'] = 'Momentálně není možné přidat doménu. Nejdříve musíš přidat alespoň jednoho zákazníka.'; - -// ADDED IN 1.2.19-svn1 - -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Konfigurace adresářů'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/

POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.
'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Dočasný adresář'; - -// ADDED IN 1.2.19-svn4 - -$lng['menue']['traffic']['traffic'] = 'Provoz'; -$lng['menue']['traffic']['current'] = 'Momentální měsíc'; -$lng['traffic']['month'] = "Měsíc"; -$lng['traffic']['day'] = "Den"; -$lng['traffic']['months'][1] = "Leden"; -$lng['traffic']['months'][2] = "Únor"; -$lng['traffic']['months'][3] = "Březen"; -$lng['traffic']['months'][4] = "Duben"; -$lng['traffic']['months'][5] = "Květen"; -$lng['traffic']['months'][6] = "Červen"; -$lng['traffic']['months'][7] = "Červenec"; -$lng['traffic']['months'][8] = "Srpen"; -$lng['traffic']['months'][9] = "Září"; -$lng['traffic']['months'][10] = "Říjen"; -$lng['traffic']['months'][11] = "Listopad"; -$lng['traffic']['months'][12] = "Prosinec"; -$lng['traffic']['mb'] = "Provoz (MiB)"; -$lng['traffic']['sumhttp'] = 'Celkový HTTP-Provoz'; -$lng['traffic']['sumftp'] = 'Celkový FTP-Provoz'; -$lng['traffic']['summail'] = 'Celkový Mail-Provoz'; - -// ADDED IN 1.2.19-svn6 - -$lng['admin']['loggersettings'] = 'Log nastavení'; -$lng['serversettings']['logger']['enable'] = 'Logging zapnuto/vypnuto'; -$lng['serversettings']['logger']['severity'] = 'Logging úroveň'; -$lng['admin']['logger']['normal'] = 'normální'; -$lng['admin']['logger']['paranoid'] = 'paranoidní'; -$lng['error']['logerror'] = 'Log-Chyba: %s'; -$lng['serversettings']['logger']['logcronoption']['never'] = 'Nikdy'; -$lng['serversettings']['logger']['logcronoption']['once'] = 'Jednou'; -$lng['serversettings']['logger']['logcronoption']['always'] = 'Vždy'; -$lng['admin']['loggersystem'] = 'Systémový log'; -$lng['logger']['date'] = 'Datum'; -$lng['logger']['type'] = 'Typ'; -$lng['logger']['action'] = 'Akce'; -$lng['logger']['user'] = 'Uživatel'; -$lng['logger']['truncate'] = 'Prázdný log'; - -// ADDED IN 1.2.19-svn7 - -$lng['serversettings']['ssl']['use_ssl']['title'] = 'Povolit SSL využití'; -$lng['serversettings']['ssl']['use_ssl']['description'] = 'Tohle zaškrtni, pokud chceš používat SSL pro tvůj webový server'; -$lng['serversettings']['ssl']['ssl_cert_file']['title'] = 'Cesta k SSL certifikátu'; -$lng['serversettings']['ssl']['ssl_cert_file']['description'] = 'Specifikujte cestu k souboru obsahující v názvu .crt nebo .pem koncovku (hlavní certifikát)'; -$lng['serversettings']['ssl']['openssl_cnf'] = 'Výchozí nastavení pro tvorbu Cert souboru'; -$lng['panel']['reseller'] = 'prodejce'; -$lng['panel']['admin'] = 'admin'; -$lng['panel']['customer'] = 'zákazník/ci'; -$lng['error']['nomessagetosend'] = 'Nezadal/a jsi zprávu.'; -$lng['error']['norecipientsgiven'] = 'Nespecifikoval/a jsi žádného příjemce'; -$lng['admin']['emaildomain'] = 'Emailová doména'; -$lng['admin']['email_only'] = 'Jen email?'; -$lng['admin']['wwwserveralias'] = 'Přidat "www." ServerAlias'; -$lng['admin']['ipsandports']['enable_ssl'] = 'Je tohle SSL port?'; -$lng['admin']['ipsandports']['ssl_cert_file'] = 'Cesta k SSL certifikátu'; -$lng['panel']['send'] = 'odeslat'; -$lng['admin']['subject'] = 'Předmět'; -$lng['admin']['recipient'] = 'Příjemce'; -$lng['admin']['message'] = 'Napsat zprávu'; -$lng['admin']['text'] = 'Zpráva'; -$lng['menu']['message'] = 'Zprávy'; -$lng['error']['errorsendingmail'] = 'Zpráva uživateli "%s" selhala'; -$lng['error']['cannotreaddir'] = 'Nelze přečíst adresář "%s"'; -$lng['success']['messages_success'] = 'Zpráva úspěšně odeslána %s příjemcům,'; -$lng['message']['norecipients'] = 'Email nebyl odeslán, protože databáze neobsahuje žádné příjemce'; -$lng['admin']['sslsettings'] = 'SSL nastavení'; -$lng['cronjobs']['notyetrun'] = 'Ještě nespuštěno'; -$lng['serversettings']['default_vhostconf']['title'] = 'Výchozí vHost-nastavení'; -$lng['error']['invalidip'] = 'Neplatná IP adresa: %s'; - -// ADDED IN 1.2.19-svn8 - -$lng['admin']['dkimsettings'] = 'DomainKey nastavení'; - -// ADDED IN 1.2.19-svn9 - -$lng['admin']['caneditphpsettings'] = 'Může změnit doménové nastavení spojené s php?'; - -// ADDED IN 1.2.19-svn12 - -$lng['admin']['allips'] = 'Všechny IP'; -$lng['panel']['nosslipsavailable'] = 'Momentálně zde nejsou žádné ssl ip/port kombinace pro tento server'; -$lng['dkim']['use_dkim']['title'] = 'Aktivovat DKIM podporu?'; -$lng['serversettings']['webalizer_enabled'] = 'Povolit webalizer statistiky'; -$lng['serversettings']['awstats_enabled'] = 'Povolit AWstats statistiky'; -$lng['admin']['awstatssettings'] = 'AWstats nastavení'; - -// ADDED IN 1.2.19-svn16 - -$lng['admin']['domain_dns_settings'] = 'DNS nastavení domény'; -$lng['dns']['a_record'] = 'A-Záznam (IPv6 volitelný)'; -$lng['dns']['cname_record'] = 'CNAME-Záznam'; -$lng['dns']['mxrecords'] = 'Definovat MX záznamy'; -$lng['dns']['standardmx'] = 'Server standard MX record'; -$lng['dns']['mxconfig'] = 'Vlastní MX záznamy'; -$lng['dns']['priority10'] = 'Priorita 10'; -$lng['dns']['priority20'] = 'Priorita 20'; -$lng['dns']['txtrecords'] = 'Definovat TXT záznamy'; -$lng['serversettings']['selfdnscustomer']['title'] = 'Povolit zákazníkům upravovat dns nastavení domén'; -$lng['admin']['activated'] = 'Aktivováno'; -$lng['admin']['statisticsettings'] = 'Nastavení statistik'; - -// ADDED IN 1.2.19-svn17 - -$lng['serversettings']['unix_names']['title'] = 'Použít kompatibilní přezdívky s UNIX '; -$lng['error']['cannotwritetologfile'] = 'Nelze otevřít log soubor %s pro zápis'; -$lng['admin']['sysload'] = 'Systémové zatížení'; -$lng['admin']['noloadavailable'] = 'nedostupné'; -$lng['admin']['nouptimeavailable'] = 'nedostupné'; -$lng['panel']['backtooverview'] = 'Zpět na přehled'; -$lng['admin']['nosubject'] = '(Bez předmětu)'; -$lng['admin']['configfiles']['statistics'] = 'Statistics'; -$lng['login']['forgotpwd'] = 'Zapomněl jsi heslo?'; -$lng['login']['presend'] = 'Resetovat heslo'; -$lng['login']['email'] = 'Emailová addresa'; -$lng['login']['remind'] = 'Resetovat mé heslo'; -$lng['login']['usernotfound'] = 'Uživatel nenalezen!'; -$lng['mails']['password_reset']['subject'] = 'Resetovat heslo'; -$lng['pwdreminder']['success'] = 'Žádost o reset hesla úspěšně odeslána. Následuj prosím instrukce v emailu, který jsi obdržel/a.'; - -// ADDED IN 1.2.19-svn18 - -$lng['serversettings']['allow_password_reset']['title'] = 'Povolit resetování hesla pro zákazníky'; -$lng['pwdreminder']['notallowed'] = 'Resetování hesla je vypnuto'; - -// ADDED IN 1.2.19-svn21 - -$lng['customer']['title'] = 'Oslovení'; -$lng['customer']['country'] = 'Země'; -$lng['panel']['dateformat'] = 'RRRR-MM-DD'; -$lng['panel']['dateformat_function'] = 'R-m-d'; - -// Y = Year, m = Month, d = Day - -$lng['panel']['timeformat_function'] = 'H:i:s'; - -// H = Hour, i = Minute, s = Second - -$lng['panel']['default'] = 'Výchozí'; -$lng['panel']['never'] = 'Nikdy'; -$lng['panel']['active'] = 'Aktivní'; -$lng['panel']['please_choose'] = 'Zvol prosím'; -$lng['panel']['allow_modifications'] = 'Povolit modifikace'; -$lng['domains']['registration_date'] = 'Přidáno do registru'; - -// ADDED IN 1.2.19-svn22 - -$lng['serversettings']['allow_password_reset_admin']['title'] = 'Povolit reset hesla pro adminy'; - -// ADDED IN 1.2.19-svn25 - -$lng['emails']['quota'] = 'Kvóta'; -$lng['emails']['noquota'] = 'Bez kvóty'; -$lng['emails']['updatequota'] = 'Aktualizovat kvótu'; -$lng['panel']['not_supported'] = 'Nepodporováno v: '; - -// improved froxlor - -$lng['menue']['phpsettings']['maintitle'] = 'PHP konfigurace'; -$lng['admin']['phpsettings']['title'] = 'PHP konfigurace'; -$lng['admin']['phpsettings']['description'] = 'Krátký popis'; -$lng['admin']['phpsettings']['actions'] = 'Akce'; -$lng['admin']['phpsettings']['editsettings'] = 'Změnit PHP nastavení'; -$lng['admin']['phpsettings']['addsettings'] = 'Vytvořit nové PHP nastavení'; -$lng['admin']['phpsettings']['viewsettings'] = 'Zobrazit PHP nastavení'; -$lng['admin']['phpsettings']['phpinisettings'] = 'php.ini nastavení'; -$lng['admin']['phpsettings']['addnew'] = 'Vytvořit novou PHP konfiguraci'; -$lng['admin']['fpmsettings']['addnew'] = 'Vytvořit novou PHP verzi'; -$lng['error']['phpsettingidwrong'] = 'Konfigurace s tímto ID neexistuje'; -$lng['error']['descriptioninvalid'] = 'Popis je moc krátký, dlouhý nebo obsahuje nepovolené znaky.'; - -// improved Froxlor 2 - -$lng['admin']['templates']['filecontent'] = 'Öbsah souboru'; -$lng['error']['filecontentnotset'] = 'Soubor nemůže být prázdný!'; -$lng['admin']['expert_settings'] = 'Expertní nastavení!'; - -$lng['error']['customerdoesntexist'] = 'Zvolený zákazník neexistuje.'; -$lng['error']['admindoesntexist'] = 'Zvolený administrátor neexistuje.'; - -// ADDED IN 1.2.19-svn37 - -$lng['domains']['aliasdomains'] = 'Alias domén'; - -// ADDED IN 1.2.19-svn38 - -$lng['admin']['phpserversettings'] = 'PHP nastavení'; -$lng['admin']['phpsettings']['fpmdesc'] = 'PHP-FPM konfigurace'; -$lng['admin']['phpsettings']['file_extensions'] = 'Přípony souborů'; -$lng['admin']['phpsettings']['file_extensions_note'] = '(bez tečky, oddělené mezerou)'; -$lng['admin']['mod_fcgid_maxrequests']['title'] = 'Maximum php žádostí pro tuto doménu (ponechte prázdné pro výchozí hodnotu)'; -$lng['serversettings']['mod_fcgid']['maxrequests']['title'] = 'Maximum požadavků na doménu'; -$lng['serversettings']['mod_fcgid']['maxrequests']['description'] = 'Kolik požadavků na doménu by mělo být povoleno?'; - -// ADDED IN 1.4.2.1-2 - -$lng['admin']['ipsandports']['webserverdefaultconfig'] = 'Výchozí konfigurace Webserveru'; - -$lng['success']['success'] = 'Informace'; -$lng['success']['clickheretocontinue'] = 'Klikni zde pro pokračování'; -$lng['success']['settingssaved'] = 'Nastavení bylo úspěšně uloženo.'; - -// ADDED IN FROXLOR 0.9.1 - -$lng['admin']['contactdata'] = 'Kontaktní data'; - -// ADDED IN FROXLOR 0.9.2 - -$lng['admin']['newerversionavailable'] = 'Nová verze Froxloru je dostupná'; - -// ADDED IN FROXLOR 0.9.3-svn1 - -$lng['serversettings']['panel_password_min_length']['title'] = 'Minimální délka hesla'; - -// ADDED IN FROXLOR 0.9.3-svn3 -$lng['cron']['lastrun'] = 'naposledy spušteno'; -$lng['cron']['isactive'] = 'povoleno'; -$lng['cron']['description'] = 'popis'; - -// ADDED IN FROXLOR 0.9.4-svn1 -$lng['ftp']['account_edit'] = 'Upravit ftp účet'; -$lng['admin']['lastlogin_succ'] = 'Posledníí přihlášení'; -$lng['panel']['neverloggedin'] = 'Zatím bez přihlášení'; - -// ADDED IN FROXLOR 0.9.6-svn6 -$lng['admin']['ftpserversettings'] = 'Nastavení FTP serveru'; - -// ADDED IN FROXLOR 0.9.7-svn3 - -// these stay only in english.lng.php - they are the same -// for all other languages and are used if not found there -$lng['redirect_desc']['rc_movedperm'] = 'permanentně přesunuto'; - -// ADDED IN FROXLOR 0.9.11-svn2 -$lng['extras']['execute_perl'] = 'Spustit perl/CGI'; -$lng['admin']['perlenabled'] = 'Perl povolen'; - -// ADDED IN FROXLOR 0.9.11-svn3 -$lng['serversettings']['perl_path']['title'] = 'Cesta k perl'; -$lng['serversettings']['perl_path']['description'] = 'Výchozí je /usr/bin/perl'; - -// ADDED IN FROXLOR 0.9.12-svn3 -$lng['domains']['nosubtomaindomain'] = 'Žádná subdoména celé domény'; -$lng['admin']['templates']['newdatabase'] = 'Emailové notifikace o nových databázích'; -$lng['admin']['templates']['newftpuser'] = 'Emailové notifikace o nových ftp uživatelů'; -$lng['admin']['templates']['CUST_NAME'] = 'Jméno zákazníka'; -$lng['admin']['templates']['DB_NAME'] = 'Název databáze'; -$lng['admin']['templates']['DB_PASS'] = 'Heslo databáze'; -$lng['admin']['templates']['DB_DESC'] = 'Popis databáze'; -$lng['admin']['templates']['DB_SRV'] = 'Databázový server'; -$lng['admin']['templates']['PMA_URI'] = 'Odkaz k phpMyAdmin (pokud je postytnut)'; -$lng['admin']['templates']['USR_NAME'] = 'FTP uživatelské jméno'; -$lng['admin']['templates']['USR_PASS'] = 'FTP heslo'; - -// ADDED IN FROXLOR 0.9.15 -$lng['serversettings']['perl_server']['title'] = 'Perl umístění na serveru'; - -// ADDED IN FROXLOR 0.9.16 -$lng['error']['intvaluetoolow'] = 'Zadané číslo je přiliš malé (pole %s)'; -$lng['error']['intvaluetoohigh'] = 'Zadané číslo je příliš vysoké (pole %s)'; -$lng['serversettings']['phpfpm']['title'] = 'Zapnout php-fpm'; - -// ADDED IN FROXLOR 0.9.18 -$lng['serversettings']['default_theme'] = 'Výchozí téma'; -$lng['menue']['main']['changetheme'] = 'Změnit téma'; -$lng['panel']['theme'] = 'Téma'; -$lng['panel']['variable'] = 'Variable'; -$lng['panel']['description'] = 'Popis'; -$lng['emails']['back_to_overview'] = 'Zpět na přehled'; - -// ADDED IN FROXLOR 0.9.20 -$lng['customer']['generated_pwd'] = 'Navrhnutí hesla'; -$lng['customer']['usedmax'] = 'Použito / Max'; -$lng['admin']['traffic'] = 'Provoz'; -$lng['admin']['domaintraffic'] = 'Domény'; -$lng['admin']['customertraffic'] = 'Zákazníci'; -$lng['traffic']['customer'] = 'Zákazník'; -$lng['traffic']['domain'] = 'Doména'; -$lng['traffic']['trafficoverview'] = 'Shrnutí provozu podle'; -$lng['traffic']['months']['jan'] = 'Led'; -$lng['traffic']['months']['feb'] = 'Úno'; -$lng['traffic']['months']['mar'] = 'Bře'; -$lng['traffic']['months']['apr'] = 'Dub'; -$lng['traffic']['months']['may'] = 'Kvě'; -$lng['traffic']['months']['jun'] = 'Čer'; -$lng['traffic']['months']['jul'] = 'Čer'; -$lng['traffic']['months']['aug'] = 'Srp'; -$lng['traffic']['months']['sep'] = 'Zář'; -$lng['traffic']['months']['oct'] = 'Říj'; -$lng['traffic']['months']['nov'] = 'Lis'; -$lng['traffic']['months']['dec'] = 'Pro'; -$lng['traffic']['months']['total'] = 'Celkem'; -$lng['traffic']['details'] = 'Detaily'; -$lng['menue']['traffic']['table'] = 'Provoz'; - -// ADDED IN FROXLOR 0.9.21 -$lng['gender']['title'] = 'Titul'; -$lng['gender']['male'] = 'Pan.'; -$lng['gender']['female'] = 'Paní.'; -$lng['gender']['undef'] = ''; - -// ADDED IN FROXLOR 0.9.22-svn1 -$lng['diskquota'] = 'Quota'; -$lng['serversettings']['diskquota_enabled'] = 'Kvóta aktivována?'; -$lng['tasks']['CREATE_QUOTA'] = 'Set quota on filesystem'; -$lng['error']['session_timeout'] = 'Moc nízká hodnota'; - -// ADDED IN FROXLOR 0.9.24-svn1 -$lng['admin']['assignedmax'] = 'Přiřazeno / Max'; -$lng['admin']['usedmax'] = 'Použito / Max'; -$lng['admin']['used'] = 'Použito'; -$lng['mysql']['size'] = 'Velikost'; - -// ADDED IN 0.9.27-svn2 -$lng['panel']['cancel'] = 'Zrušit'; -$lng['admin']['delete_statistics'] = 'Promazat statistiky'; - -// ADDED IN 0.9.28-svn5 -$lng['error']['operationnotpermitted'] = 'Operace nepovolena!'; -$lng['error']['featureisdisabled'] = 'Funkce %s je vypnuta. Kontaktuj prosím providera.'; - -// ADDED IN 0.9.28.svn6 -$lng['serversettings']['apache_24']['title'] = 'Použít modifikace pro Apache 2.4'; - -// Added in Froxlor 0.9.28-rc2 - -$lng['error']['usercurrentlydeactivated'] = 'Uživatel %s je momentálně deaktivován'; -$lng['admin']['speciallogfile']['title'] = 'Oddělit log soubor'; -$lng['admin']['domain_editable']['title'] = 'Povolit upravování domény'; - -// Added in Froxlor 0.9.29-dev -$lng['serversettings']['systemdefault'] = 'Základní systém. nastavení'; -$lng['serversettings']['panel_allow_theme_change_admin'] = 'Povolit amdinům změnit téma'; -$lng['panel']['ssleditor'] = 'SSL nastavené pro tuto doménu'; - -// Added in Froxlor 0.9.30 -$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL IP adresa(y)'; -$lng['domains']['ssl_redirect']['title'] = 'SSL přesměrování'; -$lng['domains']['serveraliasoption_none'] = 'Bez aliasu'; - -// Added in Froxlor 0.9.31 -$lng['panel']['dashboard'] = 'Nástěnka'; -$lng['panel']['assigned'] = 'Přiřazen'; -$lng['panel']['available'] = 'Dostupný'; -$lng['customer']['services'] = 'Služby'; - -// Added in Froxlor 0.9.32 -$lng['logger']['admin'] = "Administrátor"; -$lng['logger']['login'] = "Přihlášení"; -$lng['logger']['intern'] = "Interní"; -$lng['logger']['unknown'] = "Neznámý"; -$lng['serversettings']['mailtraffic_enabled']['title'] = "Analyzovat mailový provoz"; -$lng['admin']['integritycheck'] = 'Ověření databáze'; -$lng['admin']['integrityid'] = '#'; -$lng['admin']['integrityname'] = 'Název'; -$lng['admin']['integrityresult'] = 'Výsledek'; -$lng['admin']['integrityfix'] = 'Opravit problémy automaticky'; - -// Added in Froxlor 0.9.33 -$lng['error']['no_phpinfo'] = 'Omlouváme se, ale phpinfo() nelze načíst'; - -$lng['admin']['movetoadmin'] = 'Přesunout zákazníka'; - -$lng['domains']['domain_import'] = 'Importovat domény'; -$lng['domains']['import_separator'] = 'Oddělovač'; -$lng['domains']['import_file'] = 'CSV-Soubor'; -$lng['success']['domain_import_successfully'] = 'Úspěšně importováno %s domén.'; -$lng['admin']['note'] = 'Poznámka'; - -// Added for apcuinfo -$lng['apcuinfo']['clearcache'] = 'Vyčistit APCu cache'; -$lng['apcuinfo']['version'] = 'APCu verze'; -$lng['apcuinfo']['phpversion'] = 'PHP verze'; -$lng['apcuinfo']['sharedmem'] = 'Sdílená pamět'; -$lng['apcuinfo']['sharedmemval'] = '%d Segment(s) with %s (%s memory)'; -$lng['apcuinfo']['start'] = 'Čas zapnutí'; -$lng['apcuinfo']['uptime'] = 'Uptime'; -$lng['apcuinfo']['upload'] = 'Podpora nahrávání souborů'; -$lng['apcuinfo']['cachetitle'] = 'Cache Information'; -$lng['apcuinfo']['memnote'] = 'Využití paměti (několik krajíců indikuje fragmenty)'; -$lng['apcuinfo']['free'] = 'Volné'; -$lng['apcuinfo']['used'] = 'Využité'; -$lng['apcuinfo']['detailmem'] = 'Detailní využití paměti a fragmentace'; -$lng['apcuinfo']['fragment'] = 'Fragmentace'; - -// Added for opcache info -$lng['opcacheinfo']['resetcache'] = 'Resetovat OPcache'; -$lng['opcacheinfo']['version'] = 'OPCache verze'; -$lng['opcacheinfo']['phpversion'] = 'PHP verze'; -$lng['opcacheinfo']['start'] = 'Čas zapnutí'; -$lng['opcacheinfo']['lastreset'] = 'Poslední restart'; -$lng['opcacheinfo']['oomrestarts'] = 'OOM restart count'; -$lng['opcacheinfo']['hashrestarts'] = 'Hash restart count'; -$lng['opcacheinfo']['manualrestarts'] = 'Manual restart count'; -$lng['opcacheinfo']['status'] = 'Stav'; -$lng['opcacheinfo']['cachefull'] = 'Cache je plný'; -$lng['opcacheinfo']['restartinprogress'] = 'Restart právě probíhá'; -$lng['opcacheinfo']['memusage'] = 'Využití paměti'; -$lng['opcacheinfo']['totalmem'] = 'Celková pamět'; -$lng['opcacheinfo']['usedmem'] = 'Využitá paměť'; -$lng['opcacheinfo']['freemem'] = 'Volná pamět'; -$lng['opcacheinfo']['used'] = 'Využité'; -$lng['opcacheinfo']['free'] = 'Volné'; -$lng['opcacheinfo']['blacklist'] = 'Černá listina'; -$lng['opcacheinfo']['novalue'] = 'bez hodnoty'; - -// Added for let's encrypt -$lng['admin']['letsencrypt']['title'] = 'Používat Let\'s Encrypt'; -$lng['panel']['letsencrypt'] = 'Používá Let\'s encrypt'; -$lng['crondesc']['cron_letsencrypt'] = 'aktualizuji Let\'s Encrypt certifikáty'; -$lng['serversettings']['letsencryptstate']['description'] = "State used to generate Let's Encrypt certificates."; -$lng['serversettings']['leenabled']['title'] = "Zapnout Let's Encrypt"; - -// Added for CAA record support -$lng['serversettings']['caa_entry']['title'] = 'Generovat CAA DNS záznamy'; - -// Autoupdate -$lng['admin']['autoupdate'] = 'Auto-Aktualizace'; -$lng['error']['customized_version'] = 'Vypadá to, že tvá instalace Froxloru byla upravována, podpora byla zrušena, promiň.'; -$lng['error']['autoupdate_0'] = 'Neznámá chyba'; -$lng['error']['autoupdate_1'] = 'PHP nastavení allow_url_fopen je vypnuté. Automatická aktualizace toto nastavení potřebuje v php.ini'; -$lng['error']['autoupdate_2'] = 'PHP zip rozšíření nebylo nalezeno, ujisti se, že je nainstalované a aktivované'; -$lng['error']['autoupdate_4'] = 'Froxlor archiv nemohl být uložen na disku :('; -$lng['error']['autoupdate_5'] = 'version.froxlor.org vrátila nepřijatelné hodnoty :('; -$lng['error']['autoupdate_6'] = 'Uf, nebyla nalezena (platná) verze ke stažení :('; -$lng['error']['autoupdate_7'] = 'Stažený archiv nebyl nalezen :('; -$lng['error']['autoupdate_8'] = 'Archiv nemohl být extrahován :('; -$lng['error']['autoupdate_9'] = 'Stažený soubor neprošel testem integrity. Zkus aktualizaci znovu.'; -$lng['error']['autoupdate_10'] = 'Minimální podporovaná verze PHP je 7.4.0'; - -$lng['domains']['termination_date'] = 'Datum zrušení'; -$lng['domains']['termination_date_overview'] = 'zrušeno datem '; -$lng['panel']['set'] = 'Použít'; - -$lng['menue']['extras']['backup'] = 'Záloha'; -$lng['extras']['backup'] = 'Vytvořit zálohu'; -$lng['extras']['backup_web'] = 'Zálohovat web-data'; -$lng['extras']['backup_mail'] = 'Zálohovat mail-data'; -$lng['extras']['backup_dbs'] = 'Zálohovat databáze'; -$lng['serversettings']['backupenabled']['title'] = "Povolit zálohy pro zákazníky"; - -$lng['error']['dns_domain_nodns'] = 'DNS pro tuto doménu je vypnuto'; -$lng['dnseditor']['edit'] = 'upravit DNS'; -$lng['dnseditor']['records'] = 'záznamy'; - -$lng['admin']['dnsenabled'] = 'Povolit DNS editor'; - -// Added in froxlor 0.9.38-rc1 -$lng['serversettings']['mail_smtp_passwd'] = 'SMTP heslo'; - -// Added in froxlor 0.9.38.8 -$lng['success']['testmailsent'] = 'Testovací email byl odeslán úspěšně'; - -// added in froxlor 0.9.39 -$lng['admin']['plans']['description'] = 'Popis'; -$lng['admin']['plans']['last_update'] = 'Naposledy aktualizováno'; - -// added in froxlor 0.10.0 -$lng['panel']['none_value'] = 'Nic'; -$lng['menue']['main']['apihelp'] = 'API pomoc'; -$lng['menue']['main']['apikeys'] = 'API klíče'; -$lng['apikeys']['no_api_keys'] = 'Žádné API klíče nalezeny'; -$lng['apikeys']['key_add'] = 'přidat nový klíč'; -$lng['apikeys']['clicktoview'] = 'Klikni pro zobrazení'; -$lng['apikeys']['allowed_from'] = 'Povoleno od'; -$lng['apikeys']['valid_until'] = 'Platné do'; -$lng['2fa']['2fa'] = '2FA možnosti'; -$lng['2fa']['2fa_enabled'] = 'Aktivovat dvoufázové ověření (2FA)'; -$lng['login']['2fa'] = 'Dvoufázové ověření (2FA)'; -$lng['login']['2facode'] = 'Prosím zadej 2FA kód'; -$lng['2fa']['2fa_removed'] = '2FA úspěšně odstraněno'; -$lng['2fa']['2fa_add'] = 'Aktivovat 2FA'; -$lng['2fa']['2fa_delete'] = 'Deaktivovat 2FA'; -$lng['2fa']['2fa_verify'] = 'Ověřit kód'; -$lng['admin']['domain_sslenabled'] = 'Povolit použití SSL'; diff --git a/lng/de.lng.php b/lng/de.lng.php new file mode 100644 index 00000000..66a69f7c --- /dev/null +++ b/lng/de.lng.php @@ -0,0 +1,2096 @@ + + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + 'languages' => [ + 'cz' => 'Tschechisch', + 'de' => 'Deutsch', + 'en' => 'Englisch', + 'fr' => 'Französisch', + 'it' => 'Italienisch', + 'nl' => 'Niederländisch', + 'pt' => 'Portugiesisch', + 'se' => 'Schwedisch', + ], + '2fa' => [ + '2fa' => '2FA Optionen', + '2fa_enabled' => 'Aktiviere Zwei-Faktor Authentifizierung (2FA)', + '2fa_removed' => '2FA erfolgreich gelöscht', + '2fa_added' => '2FA erfolgreich aktiviert
2FA Details öffnen', + '2fa_add' => '2FA aktivieren', + '2fa_delete' => '2FA deaktivieren', + '2fa_verify' => 'Code verifizieren', + '2fa_overview_desc' => 'Hier kann für das Konto eine Zwei-Faktor-Authentisierung aktiviert werden.

Es kann entweder eine Authenticator-App (time-based one-time password / TOTP) genutzt werden oder ein Einmalpasswort, welches nach erfolgreichem Login an die hinterlegte E-Mail Adresse gesendet wird.', + '2fa_email_desc' => 'Das Konto ist eingerichtet, um Einmalpasswörter per E-Mail zu erhalten. Zum Deaktivieren, klicke auf "2FA deaktivieren"', + '2fa_ga_desc' => 'Das Konto ist eingerichtet, um zeitbasierte Einmalpasswörter via Authenticator-App zu erhalten. Um die gewünschte Authenticator-App einzurichten, scanne bitte den untenstehenden QR-Code. Zum Deaktivieren, klicke auf "2FA deaktivieren"', + ], + 'admin' => [ + 'overview' => 'Übersicht', + 'ressourcedetails' => 'Verbrauchte Ressourcen', + 'systemdetails' => 'Systemdetails', + 'froxlordetails' => 'Froxlor-Details', + 'installedversion' => 'Installierte Version', + 'latestversion' => 'Neueste Version', + 'lookfornewversion' => [ + 'clickhere' => 'per Webservice abfragen - Hier klicken', + 'error' => 'Fehler bei Abfrage', + ], + 'resources' => 'Ressourcen', + 'customer' => 'Kunde', + 'customers' => 'Kunden', + 'customer_add' => 'Kunden anlegen', + 'customer_edit' => 'Kunden bearbeiten', + 'domains' => 'Domains', + 'domain_add' => 'Domain anlegen', + 'domain_edit' => 'Domain bearbeiten', + 'subdomainforemail' => 'Subdomains als E-Mail-Domains erlauben', + 'admin' => 'Admin', + 'admins' => 'Admins', + 'admin_add' => 'Admin anlegen', + 'admin_edit' => 'Admin bearbeiten', + 'customers_see_all' => 'Kann alle Kunden sehen?', + 'domains_see_all' => 'Kann alle Domains sehen?', + 'change_serversettings' => 'Kann Servereinstellungen bearbeiten?', + 'serversettings' => 'Einstellungen', + 'rebuildconf' => 'Configs neu schreiben', + 'stdsubdomain' => 'Standardsubdomain', + 'stdsubdomain_add' => 'Standardsubdomain anlegen', + 'phpenabled' => 'PHP verfügbar', + 'deactivated' => 'Gesperrt', + 'deactivated_user' => 'Benutzer sperren', + 'sendpassword' => 'Passwort zusenden', + 'ownvhostsettings' => 'Eigene vHost-Einstellungen', + 'configfiles' => [ + 'serverconfiguration' => 'Konfiguration', + 'overview' => 'Übersicht', + 'wizard' => 'Assistent', + 'distribution' => 'Distribution', + 'service' => 'Service', + 'daemon' => 'Daemon', + 'http' => 'Webserver (HTTP)', + 'dns' => 'Nameserver (DNS)', + 'mail' => 'Mailserver (IMAP/POP3)', + 'smtp' => 'Mailserver (SMTP)', + 'ftp' => 'FTP-Server', + 'etc' => 'Sonstige (System)', + 'choosedistribution' => '-- Distribution wählen --', + 'chooseservice' => '-- Service wählen --', + 'choosedaemon' => '-- Daemon wählen --', + 'statistics' => 'Statistik', + 'compactoverview' => 'Kompakt-Übersicht', + 'legend' => '

Sie konfigurieren nun einen Service/Daemon.

', + 'commands' => 'Kommandos: Die angezeigten Befehle müssen als Benutzer root in einer Shell ausgeführt werden. Es kann auch problemlos der ganze Block kopiert und in die Shell eingefügt werden.', + 'files' => 'Konfigurationsdateien: Der Befehl direkt vor dem Textfeld sollte einen Editor mit der Zieldatei öffnen. Der Inhalt kann nun einfach kopiert und in den Editor eingefügt und die Datei gespeichert werden.
Bitte beachten: Das MySQL-Passwort wurde aus Sicherheitsgründen nicht ersetzt. Bitte ersetzen Sie "FROXLOR_MYSQL_PASSWORD" manuell oder nutzen Sie das folgende Formular, um es temporär auf dieser Seite zu setzen. Falls das Passwort vergessen wurde, findet es sich in der Datei "lib/userdata.inc.php".', + 'finishnote' => 'Parameter Datei erfolgreich erstellt. Folgende Befehle müssen als root ausgeführt werden:', + 'description' => 'System-Dienste konfigurieren', + 'skipconfig' => 'Nicht (erneut) konfigurieren', + 'recommendednote' => 'Empfohlene/benötigte Dienste anhand der aktuellen Systemeinstellungen', + 'selectrecommended' => 'Empfohlene wählen', + ], + 'templates' => [ + 'templates' => 'E-Mail-Vorlagen', + 'template_add' => 'Vorlage hinzufügen', + 'template_fileadd' => 'Dateivorlage hinzufügen', + 'template_edit' => 'Vorlage bearbeiten', + 'action' => 'Aktion', + 'email' => 'E-Mail- & Dateivorlagen', + 'subject' => 'Betreff', + 'mailbody' => 'Mailtext', + 'createcustomer' => 'Willkommensmail für neue Kunden', + 'pop_success' => 'Willkommensmail für neue E-Mail-Konten', + 'template_replace_vars' => 'Variablen, die in den Vorlagen ersetzt werden:', + 'SALUTATION' => 'Wird mit einer korrekten Anrede des Kunden ersetzt.', + 'FIRSTNAME' => 'Wird mit dem Vornamen des Kunden ersetzt.', + 'NAME' => 'Wird mit dem Namen des Kunden ersetzt.', + 'COMPANY' => 'Wird mit dem Firmennamen des Kunden ersetzt.', + 'USERNAME' => 'Wird mit dem Benutzernamen des neuen Kundenkontos ersetzt.', + 'PASSWORD' => 'Wird mit dem Passwort des neuen Kundenkontos ersetzt.', + 'EMAIL' => 'Wird mit der Adresse des neuen E-Mail-Kontos ersetzt.', + 'CUSTOMER_NO' => 'Wir mit der Kunden-Nummer ersetzt', + 'TRAFFIC' => 'Wird mit Traffic, der dem Kunden zugewiesen wurde, ersetzt (in MB).', + 'TRAFFICUSED' => 'Wird mit Traffic, der vom Kunden bereits verbraucht wurde, ersetzt (in MB).', + 'pop_success_alternative' => 'Willkommensmail für neue E-Mail-Konten für die alternative E-Mail-Adresse', + 'EMAIL_PASSWORD' => 'Wird mit dem Passwort des neuen POP3/IMAP Kontos ersetzt.', + 'index_html' => 'index.html Datei für neu erzeugte Kundenverzeichnisse', + 'SERVERNAME' => 'Wird mit dem Servernamen ersetzt.', + 'CUSTOMER' => 'Wird mit dem Loginnamen des Kunden ersetzt.', + 'ADMIN' => 'Wird mit dem Loginnamen des Admins ersetzt.', + 'CUSTOMER_EMAIL' => 'Wird mit der E-Mail-Adresse des Kunden ersetzt.', + 'ADMIN_EMAIL' => 'Wird mit der E-Mail-Adresse des Admin ersetzt.', + 'filetemplates' => 'Dateivorlagen', + 'filecontent' => 'Dateiinhalt', + 'new_database_by_customer' => 'Kunden-Benachrichtigungs nach Erstellung einer neuen Datenbank', + 'new_ftpaccount_by_customer' => 'Kunden-Benachrichtigung nach Erstellung eines neuen FTP-Benutzers', + 'newdatabase' => 'Benachrichtigungs-Mails für neue Datenbank', + 'newftpuser' => 'Benachrichtigungs-Mails für neuen FTP-Benutzer', + 'CUST_NAME' => 'Kundenname', + 'DB_NAME' => 'Datenbankname', + 'DB_PASS' => 'Datenbankpasswort', + 'DB_DESC' => 'Datenbankbeschreibung', + 'DB_SRV' => 'Datenbankserver', + 'PMA_URI' => 'URL zu phpMyAdmin (wenn angegeben)', + 'USR_NAME' => 'FTP-Benutzername', + 'USR_PASS' => 'FTP-Passwort', + 'USR_PATH' => 'FTP-Heimatverzeichnis (relativ zum Kunden-Heimatverzeichnis)', + 'forgotpwd' => 'Benachrichtigungs-Mails bei Zurücksetzen des Passworts', + 'password_reset' => 'Kunden-Benachrichtigung nach Zurücksetzen des Passworts', + 'trafficmaxpercent' => 'Hinweismail für Kunden, wenn sie die angegebenen Prozent des Traffics verbraucht haben', + 'MAX_PERCENT' => 'Wird mit dem Webspace/Traffic-Limit, welches dem Kunden zugewiesen wurde, ersetzt.', + 'USAGE_PERCENT' => 'Wird mit dem Webspace/Traffic, welcher vom Kunden bereits verbraucht wurde, ersetzt.', + 'diskmaxpercent' => 'Hinweismail für Kunden, wenn sie die angegebenen Prozent des Webspaces verbraucht haben', + 'DISKAVAILABLE' => 'Wird mit dem Webspace, der dem Kunden zugewiesen wurde, ersetzt (in MB).', + 'DISKUSED' => 'Wird mit dem Webspace, welcher vom Kunden bereits verbraucht wurde, ersetzt (in MB).', + 'LINK' => 'Wird mit dem Link zum Zurücksetzen des Passworts ersetzt.', + 'SERVER_HOSTNAME' => 'Wird mit dem System-Hostname (URL zu froxlor) ersetzt', + 'SERVER_IP' => 'Wird mit der Standard-System-IP-Adresse ersetzt', + 'SERVER_PORT' => 'Wird mit dem Standard-Port ersetzt', + 'DOMAINNAME' => 'Wird mit der Standardsubdomain des Kunden ersetzt (kann leer sein, wenn keine erstellt werden soll)', + ], + 'bindzonewarning' => 'Leer für Standardeinstellung.
WARNUNG: Bei der Verwendung einer Zonendatei müssen alle benötigten Records aller Subdomains ebenfalls manuell verwaltet werden.', + 'ipsandports' => [ + 'ipsandports' => 'IPs und Ports', + 'add' => 'IP-Adresse/Port hinzufügen', + 'edit' => 'IP-Adresse/Port bearbeiten', + 'ipandport' => 'IP-Adresse/Port', + 'ip' => 'IP-Adresse', + 'ipnote' => '
Hinweis: Obwohl private IP Adressen erlaubt sind, kann es bei manchen Features wie DNS zu ungewolltem Verhalten kommen.
Verwende private Adressen nur wenn du sicher bist.
', + 'port' => 'Port', + 'create_listen_statement' => 'Erstelle Listen-Eintrag', + 'create_namevirtualhost_statement' => 'Erstelle NameVirtualHost-Eintrag', + 'create_vhostcontainer' => 'Erstelle vHost-Container', + 'create_vhostcontainer_servername_statement' => 'Erstelle ServerName-Eintrag im vHost-Container', + 'enable_ssl' => 'Ist dies ein SSL-Port?', + 'ssl_cert_file' => 'Pfad zum Zertifikat', + 'webserverdefaultconfig' => 'Webserver-Standard-Konfiguration', + 'webserverdomainconfig' => 'Webserver-Domain-Konfiguration', + 'webserverssldomainconfig' => 'Webserver-SSL-Konfiguration', + 'ssl_key_file' => 'Pfad zum SSL-Private-Key', + 'ssl_ca_file' => 'Pfad zum SSL-CA-Zertifikat (optional)', + 'default_vhostconf_domain' => 'Standard vHost-Einstellungen für jeden Domain-Container', + 'ssl_cert_chainfile' => [ + 'title' => 'Pfad zu dem SSL-CertificateChainFile (optional)', + 'description' => 'Meist CA_Bundle, o. Ä. Dies ist das Feld, das gesetzt werden sollte, wenn ein gekauftes SSL-Zertifikat vorliegt.', + ], + 'docroot' => [ + 'title' => 'Benutzerdefinierter Docroot (wenn leer, zeige auf Froxlor)', + 'description' => 'Hier kann ein benutzerdefinierter Document-Root (der Zielordner für einen Zugriff) für diese IP/Port Kombination gesetzt werden.
ACHTUNG: Bitte überlege vorher, welchen Pfad du hier angibst!', + ], + 'ssl_paste_description' => 'Bitte den Inhalt der Zertifikatsdatei in das Textfeld kopieren.', + 'ssl_cert_file_content' => 'Inhalt des SSL-Zertifikats (Certificate)', + 'ssl_key_file_content' => 'Inhalt der Key-Datei (Private-Key)', + 'ssl_ca_file_content' => 'Inhalt der SSL-CA-Datei (optional)', + 'ssl_ca_file_content_desc' => '

Client Authentifizierung, dieses Feld sollte nur gesetzt werden, wenn es wirklich gebraucht wird.', + 'ssl_cert_chainfile_content' => 'Inhalt des SSL-CertificateChainFile (optional)', + 'ssl_cert_chainfile_content_desc' => '

Meist CA_Bundle, o. Ä. Dies ist das Feld, das gesetzt werden sollte, wenn ein gekauftes SSL-Zertifikat vorliegt.', + 'ssl_default_vhostconf_domain' => 'Standard SSL vHost-Einstellungen für jeden Domain-Container', + ], + 'memorylimitdisabled' => 'Deaktiviert', + 'valuemandatory' => 'Dieses Feld muss ausgefüllt werden.', + 'valuemandatorycompany' => 'Entweder "Name" und "Vorname" oder "Firma" muss ausgefüllt werden.', + 'serversoftware' => 'Webserver', + 'phpversion' => 'PHP-Version', + 'mysqlserverversion' => 'MySQL-Server-Version', + 'webserverinterface' => 'Webserver-Interface', + 'accountsettings' => 'Konteneinstellungen', + 'panelsettings' => 'Panel-Einstellungen', + 'systemsettings' => 'Systemeinstellungen', + 'webserversettings' => 'Webserver-Einstellungen', + 'mailserversettings' => 'Mailserver-Einstellungen', + 'nameserversettings' => 'Nameserver-Einstellungen', + 'updatecounters' => 'Ressourcenverbrauch', + 'subcanemaildomain' => [ + 'never' => 'Nie', + 'choosableno' => 'Wählbar, Standardwert: Nein', + 'choosableyes' => 'Wählbar, Standardwert: Ja', + 'always' => 'Immer', + ], + 'wipecleartextmailpwd' => 'Klartext-Passwörter leeren', + 'webalizersettings' => 'Webalizereinstellungen', + 'webalizer' => [ + 'normal' => 'Normal', + 'quiet' => 'Leise', + 'veryquiet' => 'Keine Ausgaben', + ], + 'domain_nocustomeraddingavailable' => 'Es können derzeit keine Domains angelegt werden. Sie müssen zuerst einen Kunden anlegen', + 'loggersettings' => 'Log-Einstellungen', + 'logger' => [ + 'normal' => 'Normal', + 'paranoid' => 'Paranoid', + ], + 'loggersystem' => 'System-Log', + 'emaildomain' => 'E-Mail-Domain', + 'email_only' => 'Nur als E-Mail-Domain verwenden?', + 'wwwserveralias' => 'Einen "www." ServerAlias hinzufügen', + 'subject' => 'Betreff', + 'recipient' => 'Empfänger', + 'message' => 'Rundmail senden', + 'text' => 'Nachricht', + 'sslsettings' => 'SSL-Einstellungen', + 'specialsettings_replacements' => 'Die folgenden Variablen können verwendet werden:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (wenn zutreffend)
', + 'dkimsettings' => 'DomainKey-Einstellungen', + 'caneditphpsettings' => 'Kann PHP-bezogene Domaineinstellungen vornehmen?', + 'allips' => 'Alle IP-Adressen', + 'awstatssettings' => 'AWstats-Einstellungen', + 'domain_dns_settings' => 'Domain-DNS-Einstellungen', + 'activated' => 'Aktiviert', + 'statisticsettings' => 'Statistik-Einstellungen', + 'or' => 'oder', + 'sysload' => 'System-Auslastung', + 'noloadavailable' => 'nicht verfügbar', + 'nouptimeavailable' => 'nicht verfügbar', + 'nosubject' => '(Kein Betreff)', + 'show_version_login' => [ + 'title' => 'Zeige Froxlor Version beim Login', + 'description' => 'Zeige Froxlor Version in der Fußzeile der Loginseite', + ], + 'show_version_footer' => [ + 'title' => 'Zeige Froxlor Version in Fußzeile', + 'description' => 'Zeige Froxlor Version in der Fußzeile aller anderen Seiten', + ], + 'froxlor_graphic' => [ + 'title' => 'Grafik im Kopfbereich des Panels', + 'description' => 'Welche Grafik soll im Kopfbereich des Panels anstatt des Froxlor Logos angezeigt werden?', + ], + 'phpsettings' => [ + 'title' => 'PHP-Konfiguration', + 'description' => 'Kurzbeschreibung', + 'actions' => 'Aktionen', + 'activedomains' => 'In Verwendung für Domain(s)', + 'notused' => 'Konfiguration wird nicht verwendet', + 'editsettings' => 'PHP-Konfiguration bearbeiten', + 'addsettings' => 'PHP-Konfiguration erstellen', + 'viewsettings' => 'PHP-Konfiguration ansehen', + 'phpinisettings' => 'php.ini-Einstellungen', + 'addnew' => 'Neue PHP Konfiguration erstellen', + 'binary' => 'PHP-Binary', + 'fpmdesc' => 'PHP-FPM Config', + 'file_extensions' => 'Dateiendungen', + 'file_extensions_note' => '(ohne Punkt, durch Leerzeichen getrennt)', + 'enable_slowlog' => 'FPM-slowlog pro Domain aktivieren', + 'request_terminate_timeout' => 'request_terminate_timeout', + 'request_slowlog_timeout' => 'request_slowlog_timeout', + 'activephpconfigs' => 'In Verwendung für PHP-Konfiguration(en)', + 'pass_authorizationheader' => 'Füge "-pass-header Authorization" / "CGIPassAuth On" in Vhosts ein', + ], + 'misc' => 'Sonstiges', + 'fpmsettings' => [ + 'addnew' => 'Neue PHP Version erstellen', + ], + 'phpconfig' => [ + 'template_replace_vars' => 'Variablen, die in den Konfigurationen ersetzt werden', + 'pear_dir' => 'Wird mit dem globalen Wert für das Include Verzeichnis ersetzt.', + 'open_basedir_c' => 'Wird mit einem ; (Semikolon) ersetzt, um open_basedir auszukommentieren/deaktivieren, wenn eingestellt.', + 'open_basedir' => 'Wird mit der open_basedir-Einstellung der Domain ersetzt.', + 'tmp_dir' => 'Wird mit der Einstellung für das temporäre Verzeichnis der Domain ersetzt.', + 'open_basedir_global' => 'Wird mit der globalen Einstellung des Pfades ersetzt, der dem open_basedir hinzugefügt wird (siehe Webserver Einstellungen).', + 'customer_email' => 'Wird mit der E-Mail-Adresse des Kunden ersetzt, dem die Domain gehört.', + 'admin_email' => 'Wird mit der E-Mail-Adresse des Admins ersetzt, dem die Domain gehört.', + 'domain' => 'Wird mit der Domain ersetzt.', + 'customer' => 'Wird mit dem Loginnamen des Kunden ersetzt, dem die Domain gehört.', + 'admin' => 'Wird mit dem Loginnamen des Admins ersetzt, dem die Domain gehört.', + 'docroot' => 'Wird mit dem Heimatverzeichnis der Domain ersetzt.', + 'homedir' => 'Wird mit dem Heimatverzeichnis des Kunden ersetzt.', + ], + 'know_what_youre_doing' => 'Ändern Sie diese Einstellungen nur, wenn Sie wissen was Sie tun!', + 'security_settings' => 'Sicherheitseinstellungen', + 'expert_settings' => 'Experteneinstellungen!', + 'mod_fcgid_starter' => [ + 'title' => 'PHP-Prozesse für diese Domain (leer für Standardwert)', + ], + 'phpserversettings' => 'PHP-Einstellungen', + 'mod_fcgid_maxrequests' => [ + 'title' => 'Maximale PHP-Requests für diese Domain (leer für Standardwert)', + ], + 'webserver' => 'Webserver', + 'spfsettings' => 'Domain-SPF-Einstellungen', + 'specialsettingsforsubdomains' => 'Übernehme Einstellungen für alle Subdomains (*.beispiel.de)', + 'accountdata' => 'Benutzerdaten', + 'contactdata' => 'Kontaktdaten', + 'servicedata' => 'Dienstleistungsdaten', + 'newerversionavailable' => 'Eine neuere Version von Froxlor wurde veröffentlicht', + 'cron' => [ + 'cronsettings' => 'Cronjob-Einstellungen', + 'add' => 'Cronjob hinzufügen', + ], + 'cronjob_edit' => 'Cronjob bearbeiten', + 'warning' => 'ACHTUNG - Wichtiger Hinweis!', + 'lastlogin_succ' => 'Letzte Anmeldung', + 'ftpserver' => 'FTP-Server', + 'ftpserversettings' => 'FTP-Server-Einstellungen', + 'webserver_user' => 'Benutzername Webserver', + 'webserver_group' => 'Gruppenname Webserver', + 'perlenabled' => 'Perl verfügbar', + 'fcgid_settings' => 'FCGID', + 'mod_fcgid_user' => 'Lokaler Benutzer für FCGID (Froxlor Vhost)', + 'mod_fcgid_group' => 'Lokale Gruppe für FCGID (Froxlor Vhost)', + 'perl_settings' => 'Perl/CGI', + 'notgiven' => '[nicht angegeben]', + 'store_defaultindex' => 'Standard-Index-Datei im Kundenordner erstellen', + 'phpfpm_settings' => 'PHP-FPM', + 'traffic' => 'Traffic', + 'customertraffic' => 'Kunden', + 'assignedmax' => 'Zugewiesen / Max.', + 'usedmax' => 'Benutzt / Max.', + 'used' => 'Benutzt', + 'speciallogwarning' => '
ACHTUNG: Durch diese Einstellungen werden Sie alle bisherige Statistiken dieser Domain verlieren.
', + 'speciallogfile' => [ + 'title' => 'Eigene Log-Datei', + 'description' => 'Aktivieren Sie diese Option, um für diese Domain eine eigene Access-Log Datei zu erhalten', + ], + 'domain_editable' => [ + 'title' => 'Erlaube Bearbeiten der Domain', + 'desc' => 'Wenn ja, darf der Kunde verschiedene Einstellungen anpassen.
Wenn nein, darf nichts durch den Kunden geändert werden.', + ], + 'writeaccesslog' => [ + 'title' => 'Zugriffslog schreiben', + 'description' => 'Aktiviere diese Option, um für diese Domain eine Access-Log Datei zu erhalten', + ], + 'writeerrorlog' => [ + 'title' => 'Fehlerlog schreiben', + 'description' => 'Aktiviere diese Option, um für diese Domain eine Error-Log Datei zu erhalten', + ], + 'phpfpm.ininote' => 'Nicht alle gewünschten Werte können in der php-fpm-pool-Konfiguration verwendet werden.', + 'selectserveralias' => 'ServerAlias-Angabe für Domain', + 'selectserveralias_desc' => 'Wählen Sie hier, ob für diese Domain ein Wildcard-Eintrag (*.domain.tld), ein www-Alias (www.domain.tld) oder gar kein Alias angelegt werden soll.', + 'show_news_feed' => [ + 'title' => 'Zeige Newsfeed im Admin-Dashboard', + 'description' => 'Aktivieren Sie diese Option, um das offizielle Froxlor newsfeed (https://inside.froxlor.org/news/) auf deinem Dashboard anzuzeigen und verpasse keine wichtigen Informationen oder Release-Announcements.', + ], + 'cronsettings' => 'Cronjob-Einstellungen', + 'integritycheck' => 'Datenbankprüfung', + 'integrityid' => '#', + 'integrityname' => 'Name', + 'integrityresult' => 'Ergebnis', + 'integrityfix' => 'Probleme automatisch beheben', + 'customer_show_news_feed' => 'Zeige Newsfeed im Kunden-Dashboard', + 'customer_news_feed_url' => [ + 'title' => 'Benutzerdefiniertes RSS-Feed', + 'description' => 'Hier kann ein eigenes RSS-Feed angegeben werden, welches den Kunden auf dem Dashboard angezeigt wird.
Leerlassen um das offizielle Froxlor Newsfeed (https://inside.froxlor.org/news/) zu verwenden.', + ], + 'movetoadmin' => 'Kunde verschieben', + 'movecustomertoadmin' => 'Verschiebe den Kunden zum angegebenen Admin/Reseller
Leerlassen für keine Änderung.
Wird der gewünschte Admin/Reseller hier nicht aufgelistet, hat er sein Kunden-Kontigent erreicht.', + 'note' => 'Hinweis', + 'mod_fcgid_umask' => [ + 'title' => 'Umask (Standard: 022)', + ], + 'letsencrypt' => [ + 'title' => 'SSL Zertifikat erstellen (Let\'s Encrypt)', + 'description' => 'Holt ein kostenloses Zertifikat von Let\'s Encrypt. Das Zertifikat wird automatisch erstellt und verlängert.
ACHTUNG: Wenn Wildcards aktiviert sind, wird diese Option automatisch deaktiviert.', + ], + 'autoupdate' => 'Auto-Update', + 'dnsenabled' => 'Zugriff auf DNS Editor', + 'froxlorvhost' => 'Froxlor VirtualHost Einstellungen', + 'hostname' => 'Hostname', + 'memory' => 'Speicherauslastung', + 'webserversettings_ssl' => 'Webserver SSL-Einstellungen', + 'domain_hsts_maxage' => [ + 'title' => 'HTTP Strict Transport Security (HSTS)', + 'description' => '"max-age" Wert für den Strict-Transport-Security Header
Der Wert 0 deaktiviert HSTS für diese Domain. Meist wird der Wert 31536000 gerne genutzt (ein Jahr).', + ], + 'domain_hsts_incsub' => [ + 'title' => 'Inkludiere HSTS für jede Subdomain', + 'description' => 'Die optionale "includeSubDomains" Direktive, wenn vorhanden, signalisiert dem UA, dass die HSTS Regel für diese Domain und auch jede Subdomain dieser gilt.', + ], + 'domain_hsts_preload' => [ + 'title' => 'Füge Domain in die HSTS preload Liste hinzu', + 'description' => 'Wenn die Domain in die HSTS preload Liste, verwaltet von Chrome (und genutzt von Firefox und Safari), hinzugefügt werden soll, dann aktivieren Sie diese Einstellung.
Die preload-Direktive zu senden kann PERMANTENTE KONSEQUENZEN haben und dazu führen, dass Benutzer auf diese Domain und auch Subdomains nicht zugreifen können.
Beachten Sie die Details unter hstspreload.appspot.com/#removal bevor ein Header mit "preload" gesendet wird.', + ], + 'domain_ocsp_stapling' => [ + 'title' => 'OCSP stapling', + 'description' => 'Siehe Wikipedia für eine ausführliche Beschreibung von OCSP-Stapling', + 'nginx_version_warning' => '
WARNUNG: Nginx unterstützt OCSP-Stapling erst ab Version 1.3.7. Wenn Ihre Version älter ist, wird der Webserver bei aktiviertem OCSP-Stapling NICHT korrekt starten.', + ], + 'domain_http2' => [ + 'title' => 'HTTP2 Unterstützung', + 'description' => 'Siehe Wikipedia für eine ausführliche Beschreibung von HTTP2', + ], + 'testmail' => 'SMTP Test', + 'phpsettingsforsubdomains' => 'PHP-Config für alle Subdomains übernehmen:', + 'plans' => [ + 'name' => 'Plan Name', + 'description' => 'Beschreibung', + 'last_update' => 'Zuletzt aktualisiert', + 'plans' => 'Hosting Pläne', + 'plan_details' => 'Plan Details', + 'add' => 'Neuen Plan anlegen', + 'edit' => 'Plan editieren', + 'use_plan' => 'Plan übernehmen', + ], + 'notryfiles' => [ + 'title' => 'Keine generierte try_files Anweisung', + 'description' => 'Wählen Sie "Ja", wenn eine eigene try_files Direktive in den "eigenen Vhost Einstellungen" angegeben werden soll (z.B. nötig für manche Wordpress Plugins).', + ], + 'logviewenabled' => 'Zugriff auf access/error-Logdateien', + 'novhostcontainer' => '

Keine der IPs und Ports hat die Option "Erstelle vHost-Container" aktiviert, einige Einstellungen sind daher nicht verfügbar.', + 'ownsslvhostsettings' => 'Eigene SSL vHost-Einstellungen', + 'domain_override_tls' => 'Überschreibe System TLS Einstellungen', + 'domain_sslenabled' => 'Aktiviere Nutzung von SSL', + 'domain_honorcipherorder' => 'Bevorzuge die serverseitige Cipher Reihenfolge, Standardwert nein', + 'domain_sessiontickets' => 'Aktiviere TLS Sessiontickets (RFC 5077), Standardwert ja', + 'domain_sessionticketsenabled' => [ + 'title' => 'Aktiviere Nutzung von TLS Sessiontickets systemweit', + 'description' => 'Standardwert yes
Erfordert apache-2.4.11+ oder nginx-1.5.9+', + ], + 'domaindefaultalias' => 'Standard ServerAlias-Angabe für neue Domains', + 'smtpsettings' => 'SMTP Einstellungen', + 'smtptestaddr' => 'Test-Email senden an', + 'smtptestnote' => 'Bitte beachten: Die untenstehenden Werte reflektieren die aktuellen Einstellungen und können auch nur dort angepasst werden (siehe Link in der oberen rechten Ecke)', + ], + 'apikeys' => [ + 'no_api_keys' => 'Keine API Keys gefunden', + 'key_add' => 'API Key hinzufügen', + 'apikey_removed' => 'Der API Key mit der ID #%s wurde erfolgreich gelöscht.', + 'allowed_from' => 'Erlaube Zugriff von', + 'allowed_from_help' => 'Komma getrennte Liste von IPs oder Netzen.
Standard ist leer (von überall erlaubt).', + 'valid_until' => 'Gültig bis', + 'valid_until_help' => 'Datum Gültigkeitsende, Format JJJJ-MM-TT', + ], + 'changepassword' => [ + 'old_password' => 'Altes Passwort', + 'new_password' => 'Neues Passwort', + 'new_password_confirm' => 'Neues Passwort bestätigen', + 'new_password_ifnotempty' => 'Neues Passwort (leer für keine Änderung)', + 'also_change_ftp' => 'Auch Passwort des Haupt-FTP-Zugangs ändern', + 'also_change_stats' => ' Auch Passwort der Statistikseite ändern', + ], + 'cron' => [ + 'cronname' => 'Cronjob-Name', + 'lastrun' => 'Zuletzt gestartet', + 'interval' => 'Intervall', + 'isactive' => 'Aktiv', + 'description' => 'Beschreibung', + 'changewarning' => 'Änderungen an diesen Werten können einen negativen Effekt auf das Verhalten von Froxlor und seinen automatisierten Aufgaben haben.
Ändern Sie hier bitte nur etwas, wenn Sie sich über die Folgen im Klaren sind.', + ], + 'crondesc' => [ + 'cron_unknown_desc' => 'Keine Beschreibung angegeben', + 'cron_tasks' => 'Erstellen von Konfigurationsdateien', + 'cron_legacy' => 'Legacy (alter) Cronjob', + 'cron_traffic' => 'Traffic-Berechnung', + 'cron_usage_report' => 'Webspace- und Trafficreport', + 'cron_mailboxsize' => 'Berechnung der Mailbox-Größen', + 'cron_letsencrypt' => 'Aktualisierung der Let\'s Encrypt Zertifikate', + 'cron_backup' => 'Ausstehende Sicherungen erstellen', + ], + 'cronjob' => [ + 'cronjobsettings' => 'Cronjob-Einstellungen', + 'cronjobintervalv' => 'Laufzeit-Intervall Wert', + 'cronjobinterval' => 'Laufzeit-Intervall', + ], + 'cronjobs' => [ + 'notyetrun' => 'Bisher nicht gestartet', + ], + 'cronmgmt' => [ + 'minutes' => 'Minuten', + 'hours' => 'Stunden', + 'days' => 'Tage', + 'weeks' => 'Wochen', + 'months' => 'Monate', + ], + 'customer' => [ + 'documentroot' => 'Heimatverzeichnis', + 'name' => 'Name', + 'firstname' => 'Vorname', + 'company' => 'Firma', + 'street' => 'Straße', + 'zipcode' => 'PLZ', + 'city' => 'Ort', + 'phone' => 'Telefon', + 'fax' => 'Fax', + 'email' => 'E-Mail-Adresse', + 'customernumber' => 'Kundennummer', + 'diskspace' => 'Webspace', + 'traffic' => 'Traffic', + 'mysqls' => 'MySQL-Datenbanken', + 'emails' => 'E-Mail-Adressen', + 'accounts' => 'E-Mail-Konten', + 'forwarders' => 'E-Mail-Weiterleitungen', + 'ftps' => 'FTP-Konten', + 'subdomains' => 'Subdomain(s)', + 'domains' => 'Domain(s)', + 'title' => 'Titel', + 'country' => 'Land', + 'email_quota' => 'E-Mail-Kontingent', + 'email_imap' => 'IMAP', + 'email_pop3' => 'POP3', + 'mail_quota' => 'E-Mail-Kontingent', + 'sendinfomail' => 'Daten per E-Mail an mich senden', + 'generated_pwd' => 'Passwortvorschlag', + 'usedmax' => 'Benutzt / Max.', + 'services' => 'Dienste', + 'letsencrypt' => [ + 'title' => 'SSL Zertifikat erstellen (Let\'s Encrypt)', + 'description' => 'Holt ein kostenloses Zertifikat von Let\'s Encrypt. Das Zertifikat wird automatisch erstellt und verlängert.', + ], + 'selectserveralias_addinfo' => 'Diese Option steht beim Bearbeiten der Domain zur Verfügung. Als Initial-Wert wird die Einstellung der Hauptdomain vererbt.', + 'total_diskspace' => 'Gesamtspeicherplatz', + ], + 'diskquota' => 'Quota', + 'dkim' => [ + 'dkim_prefix' => [ + 'title' => 'Prefix', + 'description' => 'Wie lautet der Pfad zu den DKIM-RSA-Dateien sowie den Einstellungsdateien des Milter-Plugins?', + ], + 'dkim_domains' => [ + 'title' => 'Domains-Dateiname', + 'description' => 'Dateiname der DKIM-Domains-Angabe aus der DKIM-Milter-Konfigurationsdatei.', + ], + 'dkim_dkimkeys' => [ + 'title' => 'KeyList Dateiname', + 'description' => 'Dateiname der DKIM-KeyList-Angabe aus der DKIM-Milter-Konfigurationsdatei.', + ], + 'dkimrestart_command' => [ + 'title' => 'Milter-Restart-Kommando', + 'description' => 'Wie lautet das Kommando zum Neustarten des DKIM-Milter-Dienstes?', + ], + 'privkeysuffix' => [ + 'title' => 'Suffix für Private Keys', + 'description' => 'Hier kann eine (optionale) Dateiendung für die generierten Private Keys angegeben werden. Manche Dienste, wie dkim-filter, erwarten, dass die Schlüssel keine Dateiendung haben (leer).', + ], + 'use_dkim' => [ + 'title' => 'DKIM-Support aktivieren?', + 'description' => 'Wollen Sie das Domain-Keys-System (DKIM) benutzen?
Hinweis: Derzeit wird DKIM nur via dkim-filter unterstützt, nicht opendkim.', + ], + 'dkim_algorithm' => [ + 'title' => 'Gültige Hash-Algorithmen', + 'description' => 'Wählen Sie einen Algorithmus, "All" für alle Algorithmen oder einen oder mehrere von den verfügbaren Algorithmen.', + ], + 'dkim_servicetype' => 'Service Typen', + 'dkim_keylength' => [ + 'title' => 'Schlüssel-Länge', + 'description' => 'Achtung: Bei Änderung dieser Einstellung müssen alle private/public Schlüssel in "%s" gelöscht werden.', + ], + 'dkim_notes' => [ + 'title' => 'DKIM Notiz', + 'description' => 'Eine Notiz, welche für Menschen interessant sein könnte, z.B. eine URL wie http://www.dnswatch.info. Es gibt keine programmgesteuerte Interpretation für dieses Feld. Gehen Sie sparsam mit der Anzahl der Zeichen um, da es Einschränkungen seitens des DNS-Dienstes gibt. Dieses Feld ist für Administratoren gedacht, nicht für Benutzer.', + ], + ], + 'dns' => [ + 'destinationip' => 'Domain-IP-Adresse(n)', + 'standardip' => 'Server-Standard-IP-Adresse', + 'a_record' => 'A-Eintrag (IPv6 optional)', + 'cname_record' => 'CNAME-Eintrag', + 'mxrecords' => 'MX Einträge definieren', + 'standardmx' => 'Server Standard MX Eintrag', + 'mxconfig' => 'Eigene MX Einträge', + 'priority10' => 'Priorität 10', + 'priority20' => 'Priorität 20', + 'txtrecords' => 'TXT-Einträge definieren', + 'txtexample' => 'Beispiel (SPF-Eintrag):
v=spf1 ip4:xxx.xxx.xx.0/23 -all', + 'howitworks' => 'Hier können DNS Einträge für die Domain verwaltet werden. Beachten Sie, dass Froxlor automatisch NS/MX/A/AAAA Einträge generiert. Die benutzerdefinierten Einträge werden bevorzugt, nur fehlende Einträge werden automatisch generiert.', + ], + 'dnseditor' => [ + 'edit' => 'DNS editieren', + 'records' => 'Einträge', + ], + 'domain' => [ + 'openbasedirpath' => 'OpenBasedir-Pfad', + 'docroot' => 'Oben angegebener Pfad', + 'homedir' => 'Heimverzeichnis', + ], + 'domains' => [ + 'description' => 'Hier können Sie (Sub-)Domains erstellen und deren Pfade ändern.
Nach jeder Änderung braucht das System etwas Zeit, um die Konfiguration neu einzulesen.', + 'domainsettings' => 'Domaineinstellungen', + 'domainname' => 'Domainname', + 'subdomain_add' => 'Subdomain anlegen', + 'subdomain_edit' => '(Sub-)Domain bearbeiten', + 'wildcarddomain' => 'Als Wildcarddomain eintragen?', + 'aliasdomain' => 'Alias für Domain', + 'noaliasdomain' => 'Keine Aliasdomain', + 'hasaliasdomains' => 'Hat Aliasdomain(s)', + 'statstics' => 'Statistiken', + 'isassigneddomain' => 'zugewiesene Domain', + 'add_date' => 'Zu Froxlor hinzugefügt', + 'registration_date' => 'Registriert am', + 'topleveldomain' => 'Top-Level-Domain', + 'associated_with_domain' => 'Verbunden mit', + 'aliasdomains' => 'Aliasdomains', + 'redirectifpathisurl' => 'Redirect-Code (Standard: leer)', + 'redirectifpathisurlinfo' => 'Der Redirect-Code kann gewählt werden, wenn der eingegebene Pfad eine URL ist.
HINWEIS:Änderungen werden nur wirksam wenn der Pfad eine URL ist.', + 'issubof' => 'Diese Domain ist eine Subdomain von der Domain', + 'issubofinfo' => 'Diese Einstellung muss gesetzt werden, wenn Sie eine Subdomain einer Hauptdomain als Hauptdomain anlegen (z. B. soll "www.domain.tld" hinzugefügt werden, somit muss hier "domain.tld" ausgewählt werden).', + 'nosubtomaindomain' => 'Keine Subdomain einer Hauptdomain', + 'ipandport_multi' => [ + 'title' => 'IP-Adresse(n)', + 'description' => 'Definieren Sie eine oder mehrere IP-Adresse(n) für diese Domain.

Hinweis: Die IP-Adressen können nicht geändert werden, sollte die Domain als Alias-Domain für eine andere Domain konfiguriert worden sein.
', + ], + 'ipandport_ssl_multi' => [ + 'title' => 'SSL-IP-Adresse(n)', + ], + 'ssl_redirect' => [ + 'title' => 'SSL-Weiterleitung', + 'description' => 'Diese Option erstellt für alle Nicht-SSL-vHosts eine Weiterleitung (Redirect), so dass alle Anfragen an den SSL-vHost übermittelt werden (z. B. würde eine Anfrage an http://domain.tld/ weitergeleitet werden zu https://domain.tld/).', + ], + 'serveraliasoption_wildcard' => 'Wildcard (*.domain.tld)', + 'serveraliasoption_www' => 'www (www.domain.tld)', + 'serveraliasoption_none' => 'Kein Alias', + 'domain_import' => 'Domains importieren', + 'import_separator' => 'Trennzeichen', + 'import_offset' => 'Versatz (offset)', + 'import_file' => 'CSV-Datei', + 'import_description' => 'Detaillierte Informationen über den Aufbau der Importdatei und einen erfolgreichen Import gibt es hier: https://docs.froxlor.org/adminguide/domainimport.html (englisch)', + 'ssl_redirect_temporarilydisabled' => '
Die SSL-Umleitung ist, während ein neues Let\'s Encrypt - Zertifikat erstellt wird, temporär deaktiviert. Die Umleitung wird nach der Zertifikatserstellung wieder aktiviert.', + 'termination_date' => 'Kündigungsdatum', + 'termination_date_overview' => 'gekündigt zum ', + 'ssl_certificates' => 'SSL Zertifikate', + 'ssl_certificate_removed' => 'Das Zertifikat mit der ID #%s wurde erfolgreich gelöscht.', + 'ssl_certificate_error' => 'Fehler beim Lesen des Zertifikats für die Domain: %s', + 'no_ssl_certificates' => 'Es wurden keine SSL-Zertifikate gefunden', + 'isaliasdomainof' => 'Ist Aliasdomain für %s', + ], + 'emails' => [ + 'description' => 'Hier können Sie Ihre E-Mail-Adressen einrichten.
Ein Konto ist wie Ihr Briefkasten vor der Haustür. Wenn jemand eine E-Mail an Sie schreibt, wird diese in dieses Konto gelegt.

Die Zugangsdaten lauten wie folgt: (Die Angaben in kursiver Schrift sind durch die jeweiligen Einträge zu ersetzen)

Hostname: Domainname
Benutzername: Kontoname / E-Mail-Adresse
Passwort: das gewählte Passwort', + 'emailaddress' => 'E-Mail-Adresse', + 'emails_add' => 'E-Mail-Adresse anlegen', + 'emails_edit' => 'E-Mail-Adresse ändern', + 'catchall' => 'Catchall', + 'iscatchall' => 'Als Catchall-Adresse definieren?', + 'account' => 'Konto', + 'account_add' => 'Konto anlegen', + 'account_delete' => 'Konto löschen', + 'from' => 'Von', + 'to' => 'Nach', + 'forwarders' => 'Weiterleitungen', + 'forwarder_add' => 'Weiterleitung hinzufügen', + 'alternative_emailaddress' => 'Alternative E-Mail-Adresse', + 'quota' => 'Kontingent', + 'noquota' => 'Kein Kontingent', + 'updatequota' => 'Update Kontingent', + 'quota_edit' => 'E-Mail-Kontingent ändern', + 'noemaildomainaddedyet' => 'Sie haben bisher noch keine (E-Mail-)Domain in Ihrem Konto.', + 'back_to_overview' => 'Zurück zur Übersicht', + ], + 'error' => [ + 'error' => 'Fehlermeldung', + 'directorymustexist' => 'Das Verzeichnis "%s" muss existieren. Legen Sie es bitte mit Ihrem FTP-Programm an.', + 'filemustexist' => 'Die Datei "%s" muss existieren.', + 'allresourcesused' => 'Sie haben bereits alle Ihnen zur Verfügung stehenden Ressourcen verbraucht.', + 'domains_cantdeletemaindomain' => 'Sie können keine Domain, die als E-Mail-Domain verwendet wird, löschen. ', + 'domains_canteditdomain' => 'Sie können diese Domain nicht bearbeiten. Dies wurde durch den Admin verweigert.', + 'domains_cantdeletedomainwithemail' => 'Sie können keine Domain löschen, die noch als E-Mail-Domain verwendet wird. Löschen Sie zuerst alle E-Mail-Adressen dieser Domain.', + 'firstdeleteallsubdomains' => 'Sie müssen zuerst alle Subdomains löschen, bevor Sie eine Wildcarddomain anlegen können.', + 'youhavealreadyacatchallforthisdomain' => 'Sie haben bereits eine E-Mail-Adresse als Catchall für diese Domain definiert.', + 'ftp_cantdeletemainaccount' => 'Sie können Ihren Hauptaccount nicht löschen.', + 'login' => 'Die Kombination aus Benutzername und Passwort ist ungültig.', + 'login_blocked' => 'Dieser Account wurde aufgrund zu vieler Fehlversuche vorübergehend geschlossen.
Bitte versuchen Sie es in "%s" Sekunden erneut.', + 'notallreqfieldsorerrors' => 'Sie haben nicht alle Felder bzw. ein Feld mit fehlerhaften Angaben ausgefüllt.', + 'oldpasswordnotcorrect' => 'Das alte Passwort ist nicht korrekt.', + 'youcantallocatemorethanyouhave' => 'Sie können nicht mehr Ressourcen verteilen als Ihnen noch zur Verfügung stehen.', + 'mustbeurl' => 'Sie müssen eine vollständige URL angeben (z. B. http://domain.de/error404.htm).', + 'invalidpath' => 'Sie haben keine gültige URL angegeben (evtl. Probleme beim Verzeichnislisting?).', + 'stringisempty' => 'Fehlende Eingabe im Feld', + 'stringiswrong' => 'Falsche Eingabe im Feld', + 'newpasswordconfirmerror' => 'Das neue Passwort und dessen Bestätigung sind nicht identisch.', + 'mydomain' => '\'Domain\'', + 'mydocumentroot' => '\'Documentroot\'', + 'loginnameexists' => 'Der Login-Name "%s" existiert bereits.', + 'emailiswrong' => 'Die E-Mail-Adresse "%s" enthält ungültige Zeichen oder ist nicht vollständig.', + 'alternativeemailiswrong' => 'Die angegebene alternative E-Mail Adresse "%s", an welche die Zugangsdaten geschickt werden soll, scheint ungültig zu sein.', + 'loginnameiswrong' => 'Der Login-Name "%s" enthält ungültige Zeichen.', + 'loginnameiswrong2' => 'Der Login-Name enthält zu viele Zeichen, es sind maximal %s Zeichen erlaubt.', + 'userpathcombinationdupe' => 'Die Kombination aus Benutzername und Pfad existiert bereits.', + 'patherror' => 'Allgemeiner Fehler! Pfad darf nicht leer sein.', + 'errordocpathdupe' => 'Option für Pfad "%s" existiert bereits.', + 'adduserfirst' => 'Sie müssen zuerst einen Kunden anlegen.', + 'domainalreadyexists' => 'Die Domain "%s" wurde bereits einem Kunden zugeordnet.', + 'nolanguageselect' => 'Es wurde keine Sprache ausgewählt.', + 'nosubjectcreate' => 'Sie müssen einen Betreff angeben.', + 'nomailbodycreate' => 'Sie müssen einen E-Mail-Text eingeben.', + 'templatenotfound' => 'Vorlage wurde nicht gefunden.', + 'alltemplatesdefined' => 'Sie können keine weiteren Vorlagen anlegen, da bereits für alle Sprachen eine Vorlage existiert.', + 'wwwnotallowed' => 'Ihre Subdomain darf nicht \'www\' heißen.', + 'subdomainiswrong' => 'Die Subdomain "%s" enthält ungültige Zeichen.', + 'domaincantbeempty' => 'Der Domainname darf nicht leer sein.', + 'domainexistalready' => 'Die Domain "%s" existiert bereits.', + 'domainisaliasorothercustomer' => 'Die ausgewählte Aliasdomain ist entweder selbst eine Aliasdomain, hat nicht die gleiche IP/Port-Kombination oder gehört einem anderen Kunden.', + 'emailexistalready' => 'Die E-Mail-Adresse "%s" existiert bereits.', + 'maindomainnonexist' => 'Die Hauptdomain "%s" existiert nicht.', + 'destinationnonexist' => 'Bitte geben Sie Ihre Weiterleitungsadresse im Feld \'Nach\' ein.', + 'destinationalreadyexistasmail' => 'Die Weiterleitung zu "%s" existiert bereits als aktive E-Mail-Adresse.', + 'destinationalreadyexist' => 'Es existiert bereits eine Weiterleitung nach "%s".', + 'destinationiswrong' => 'Die Weiterleitungsadresse "%s" enthält ungültige Zeichen oder ist nicht vollständig.', + 'backupfoldercannotbedocroot' => 'Der Ordner für Backups darf nicht das Heimatverzeichnis sein, wählen Sie einen Ordner unterhalb des Heimatverzeichnisses, z.B. /backups', + 'templatelanguagecombodefined' => 'Die gewählte Kombination aus Sprache und Vorlage ist bereits definiert.', + 'ipstillhasdomains' => 'Die IP/Port-Kombination, die Sie löschen wollen, ist noch bei einer oder mehreren Domains eingetragen. Bitte ändern Sie die Domains vorher auf eine andere IP/Port-Kombination, um diese löschen zu können.', + 'cantdeletedefaultip' => 'Sie können die Standard-IP/Port-Kombination für Reseller nicht löschen. Bitte setzen Sie eine andere IP/Port-Kombination als Standard, um diese löschen zu können.', + 'cantdeletesystemip' => 'Sie können die letzte System-IP-Adresse nicht löschen. Entweder legen Sie eine neue IP/Port-Kombination an oder Sie ändern die System-IP-Adresse.', + 'myipaddress' => '\'IP-Adresse\'', + 'myport' => '\'Port\'', + 'myipdefault' => 'Sie müssen eine IP/Port-Kombination auswählen, die den Standard definieren soll.', + 'myipnotdouble' => 'Diese Kombination aus IP-Adresse und Port existiert bereits.', + 'cantchangesystemip' => 'Sie können die letzte System-IP-Adresse nicht löschen. Entweder legen Sie eine neue IP/Port-Kombination an oder Sie ändern die System-IP-Adresse.', + 'sessiontimeoutiswrong' => '"Session-Timeout" muss ein numerischer Wert sein.', + 'maxloginattemptsiswrong' => '"Maximale Loginversuche" muss ein numerischer Wert sein.', + 'deactivatetimiswrong' => '"Länge der Deaktivierung" muss numerisch sein.', + 'accountprefixiswrong' => 'Das "Kundenpräfix" ist falsch.', + 'mysqlprefixiswrong' => 'Das "MySQL-Präfix" ist falsch.', + 'ftpprefixiswrong' => 'Das "FTP-Präfix" ist falsch.', + 'ipiswrong' => 'Die "IP-Adresse" ist falsch. Bitte geben Sie eine gültige IP-Adresse an.', + 'vmailuidiswrong' => 'Die "Mail-UID" ist falsch. Es ist nur eine numerische UID erlaubt.', + 'vmailgidiswrong' => 'Die "Mail-GID" ist falsch. Es ist nur eine numerische GID erlaubt.', + 'adminmailiswrong' => 'Die "Absenderadresse" ist fehlerhaft. Bitte geben Sie eine gültige E-Mail-Adresse an.', + 'pagingiswrong' => 'Die "Einträge pro Seite"-Einstellung ist falsch. Es sind nur numerische Zeichen erlaubt.', + 'phpmyadminiswrong' => 'Die "phpMyAdmin-URL" ist keine gültige URL.', + 'webmailiswrong' => 'Die "Webmail-URL" ist keine gültige URL.', + 'webftpiswrong' => 'Die "WebFTP-URL" ist keine gültige URL.', + 'stringformaterror' => 'Der Wert des Feldes "%s" hat nicht das erwartete Format.', + 'loginnameissystemaccount' => 'Sie können keinen Account anlegen, der wie ein Systemaccount aussieht (also zum Beispiel mit "%s" anfängt). Bitte wählen Sie einen anderen Accountnamen.', + 'youcantdeleteyourself' => 'Aus Sicherheitsgründen können Sie sich nicht selbst löschen.', + 'youcanteditallfieldsofyourself' => 'Hinweis: Aus Sicherheitsgründen können Sie nicht alle Felder Ihres eigenen Accounts bearbeiten.', + 'documentrootexists' => 'Es existiert noch ein Verzeichnis "%s" für diesen Kunden. Bitte löschen Sie dieses vorher.', + 'formtokencompromised' => 'Das Formular scheint manipuliert worden zu sein. Aus Sicherheitsgründen wurden Sie ausgelogged.', + 'logerror' => 'Log-Fehler: "%s"', + 'nomessagetosend' => 'Keine Nachricht angegeben', + 'norecipientsgiven' => 'Keine Empfänger angegeben', + 'errorsendingmail' => 'Das Versenden der Nachricht an "%s" schlug fehl.', + 'cannotreaddir' => 'Der Ordner "%s" kann nicht gelesen werden', + 'invalidip' => 'Ungültige IP-Adresse: "%s"', + 'invalidmysqlhost' => 'Ungültige MySQL-Host-Adresse: "%s"', + 'cannotuseawstatsandwebalizeratonetime' => 'Webalizer und AWstats können nicht zur gleichen Zeit aktiviert werden, bitte wählen Sie eines aus.', + 'cannotwritetologfile' => 'Logdatei "%s" konnte nicht für Schreiboperationen geöffnet werden.', + 'vmailquotawrong' => 'Die Kontingent-Größe muss positiv sein.', + 'allocatetoomuchquota' => 'Sie versuchen "%s" MB Kontingent zu zuweisen, haben aber nicht genug übrig.', + 'missingfields' => 'Es wurden nicht alle Felder augefüllt.', + 'accountnotexisting' => 'Der angegebene E-Mail-Account existiert nicht.', + 'nopermissionsorinvalidid' => 'Entweder fehlen Ihnen die nötigen Rechte diese Einstellung zu ändern oder es wurde eine ungültige ID übergeben', + 'phpsettingidwrong' => 'Eine PHP-Konfiguration mit dieser ID existiert nicht', + 'descriptioninvalid' => 'Der Beschreibungstext ist zu kurz, zu lang oder enthält ungültige Zeichen', + 'info' => 'Info', + 'filecontentnotset' => 'Diese Datei darf nicht leer sein!', + 'index_file_extension' => 'Die Dateiendung für die index Datei muss zwischen 1 und 6 Zeichen lang sein und darf nur aus den Zeichen a-z, A-Z und 0-9 bestehen', + 'customerdoesntexist' => 'Der ausgewählte Kunde existiert nicht.', + 'admindoesntexist' => 'Der ausgewählte Admin existiert nicht.', + 'ipportdoesntexist' => 'Die gewählte IP/Port-Kombination existiert nicht.', + 'hiddenfieldvaluechanged' => 'Der Wert des verborgenen Feldes "%s" hat sich während dem Ändern der Einstellungen geändert.

Dies ist im Grunde kein schwerwiegendes Problem, allerdings konnten so die Einstellungen nicht gespeichert werden.', + 'notrequiredpasswordlength' => 'Das Passwort ist zu kurz. Bitte geben Sie mindestens "%s" Zeichen an.', + 'overviewsettingoptionisnotavalidfield' => 'Hoppla, ein Feld, das als Option in der Konfigurationsübersicht angezeigt werden soll, hat nicht den erwarteten Wert. Sie können den Entwicklern die Schuld geben. Dies sollte nicht passieren!', + 'usernamealreadyexists' => 'Der Benutzername "%s" existiert bereits.', + 'plausibilitychecknotunderstood' => 'Die Antwort des Plausibilitätschecks wurde nicht verstanden', + 'errorwhensaving' => 'Bei dem Speichern des Feldes "%s" trat ein Fehler auf', + 'pathmaynotcontaincolon' => 'Der eingegebene Pfad sollte keinen Doppelpunkt (":") enthalten. Bitte geben Sie einen korrekten Wert für den Pfad ein.', + 'notrequiredpasswordcomplexity' => 'Die vorgegebene Passwort-Komplexität wurde nicht erfüllt.
Bitte kontaktieren Sie Ihren Administrator, wenn Sie Fragen zur Komplexitäts-Vorgabe haben.', + 'stringerrordocumentnotvalidforlighty' => 'Ein Text als Fehlerdokument funktioniert leider in LigHTTPd nicht, bitte geben Sie einen Pfad zu einer Datei an', + 'urlerrordocumentnotvalidforlighty' => 'Eine URL als Fehlerdokument funktioniert leider in LigHTTPd nicht, bitte geben Sie einen Pfad zu einer Datei an', + 'intvaluetoolow' => 'Die angegebene Zahl ist zu klein (Feld "%s")', + 'intvaluetoohigh' => 'Die angegebene Zahl ist zu groß (Feld "%s")', + 'phpfpmstillenabled' => 'PHP-FPM ist derzeit aktiviert. Bitte deaktivieren Sie es, um FCGID zu aktivieren', + 'fcgidstillenabled' => 'FCGID ist derzeit aktiviert. Bitte deaktivieren Sie es, um PHP-FPM zu aktivieren', + 'domains_cantdeletedomainwithaliases' => 'Sie können keine Domain löschen, die noch von Alias-Domains verwendet wird. Löschen Sie zuerst alle Alias-Domains dieser Domain.', + 'user_banned' => 'Ihr Benutzerkonto wurde gesperrt. Bitte kontaktieren Sie Ihren Administrator für weitere Informationen.', + 'admin_domain_emailsystemhostname' => 'Der System-Hostname kann nicht als Kundendomain verwendet werden.', + 'session_timeout' => 'Wert zu niedrig', + 'session_timeout_desc' => 'Der Wert der Session-Timeout sollte nicht unter einer Minute liegen.', + 'invalidhostname' => 'Hostname muss eine gültige Domain sein. Er darf weder leer sein noch nur aus Leerzeichen bestehen', + 'operationnotpermitted' => 'Diese Aktion ist nicht erlaubt!', + 'featureisdisabled' => 'Die Funktion "%s" wurde deaktiviert. Kontaktieren Sie bitte Ihren Dienstleister.', + 'usercurrentlydeactivated' => 'Der Benutzer "%s" ist derzeit deaktiviert', + 'setlessthanalreadyused' => 'Es können nicht weniger Resourcen von "%s" gesetzt werden, als der Benutzer bereits vergeben hat
', + 'stringmustntbeempty' => 'Der Wert für das Feld "%s" darf nicht leer sein', + 'sslcertificateismissingprivatekey' => 'Für das Zertifikat muss eine Key-Datei (Private-Key) angegeben werden.', + 'sslcertificatewrongdomain' => 'Das angegebene Zertifikat gilt nicht für die gewählte Domain.', + 'sslcertificateinvalidcert' => 'Der angegebene Zertifikatsinhalt scheint kein gültiges Zertifikat zu sein.', + 'sslcertificateinvalidcertkeypair' => 'Der angegebene Key (Private-Key) gehört nicht zum angegebenen Zertifikat.', + 'sslcertificateinvalidca' => 'Das angegebene CA-Zertifikat scheint nicht gültig zu sein.', + 'sslcertificateinvalidchain' => 'Das angegebene CertificateChainFile scheint nicht gültig zu sein.', + 'givendirnotallowed' => 'Das angegebene Verzeichnis im Feld %s ist nicht erlaubt.', + 'sslredirectonlypossiblewithsslipport' => 'Die Nutzung von Let\'s Encrypt ist nur möglich, wenn die Domain mindestens eine IP/Port - Kombination mit aktiviertem SSL zugewiesen hat.', + 'fcgidstillenableddeadlock' => 'FCGID ist derzeit aktiviert.
Bitte deaktiviere es, um einen anderen Webserver als Apache2 oder lighttpd auswählen zu können.', + 'send_report_title' => 'Fehler melden', + 'send_report_desc' => 'Danke, dass Sie uns diesen Fehler melden und damit helfen Froxlor zu verbessern.
Folgender Bericht wird per Mail an das Froxlor Entwickler Team gesendet.', + 'send_report' => 'Fehlerbericht senden', + 'send_report_error' => 'Fehler beim Senden des Berichts:
%s', + 'notallowedtouseaccounts' => 'Ihrem Konto ist die Nutzung von IMAP/POP3 nicht erlaubt, daher können keine E-Mail-Konten angelegt werden', + 'cannotdeletehostnamephpconfig' => 'Diese PHP-Konfiguration ist dem Froxlor-Vhost zugewiesen und kann daher nicht gelöscht werden.', + 'cannotdeletedefaultphpconfig' => 'Diese PHP-Konfiguration ist als Standard hinterlegt und kann daher nicht gelöscht werden.', + 'passwordshouldnotbeusername' => 'Das Passwort sollte nicht mit dem Benutzernamen übereinstimmen.', + 'no_phpinfo' => 'Entschuldigung, es ist nicht möglich die phpinfo() auszulesen.', + 'moveofcustomerfailed' => 'Das Verschieben des Kunden ist fehlgeschlagen. Alle übrigen Änderungen wurden durchgeführt und gespeichert.

Fehlermeldung: %s', + 'domain_import_error' => 'Der folgende Fehler trat beim Importieren der Domains auf: %s', + 'fcgidandphpfpmnogoodtogether' => 'FCGID und PHP-FPM können nicht gleichzeitig aktiviert werden.', + 'nowildcardwithletsencrypt' => 'Let\'s Encrypt kann mittels ACME Wildcard-Domains nur via DNS validieren, sorry. Bitte den ServerAlias auf WWW setzen oder deaktivieren', + 'customized_version' => 'Es scheint als wäre die Froxlor Installation angepasst worden. Kein Support, sorry.', + 'autoupdate_0' => 'Unbekannter Fehler', + 'autoupdate_1' => 'PHP Einstellung allow_url_fopen ist deaktiviert. Autoupdate benötigt diese Option, bitte in der php.ini aktivieren.', + 'autoupdate_2' => 'PHP zip Erweiterung nicht gefunden, bitte prüfen, ob diese installiert und aktiviert ist.', + 'autoupdate_4' => 'Das froxlor Archiv konnte nicht auf der Festplatte gespeichert werden :(', + 'autoupdate_5' => 'version.froxlor.org gab ungültige Werte zurück :(', + 'autoupdate_6' => 'Woops, keine (gültige) Version angegeben für den Download :(', + 'autoupdate_7' => 'Das heruntergeladene Archiv konnte nicht gefunden werden :(', + 'autoupdate_8' => 'Das Archiv konnte nicht entpackt werden :(', + 'autoupdate_9' => 'Die heruntergeladene Datei konnte nicht verifiziert werden. Bitte erneut versuchen zu aktualisieren.', + 'autoupdate_10' => 'Minimum unterstützte Version von PHP ist 7.4.0', + 'autoupdate_11' => 'Webupdate ist deaktiviert', + 'mailaccistobedeleted' => 'Ein vorheriges Konto mit dem gleichen Namen (%s) wird aktuell noch gelöscht und kann daher derzeit nicht angelegt werden', + 'customerhasongoingbackupjob' => 'Es gibt noch einen austehenden Backup-Job. Bitte haben Sie etwas Geduld.', + 'backupfunctionnotenabled' => 'Die Sicherungs-Funktion is nicht aktiviert', + 'dns_domain_nodns' => 'DNS ist für diese Domain nicht aktiviert', + 'dns_content_empty' => 'Keinen Inhalt angegeben', + 'dns_content_invalid' => 'DNS Eintrag ungültig', + 'dns_arec_noipv4' => 'Keine gültige IP-Adresse für A-Eintrag angegeben', + 'dns_aaaarec_noipv6' => 'Keine gültige IP-Adresse für AAAA-Eintrag angegeben', + 'dns_mx_prioempty' => 'Ungültige MX Priorität angegeben', + 'dns_mx_needdom' => 'Der Wert des MX Eintrags muss ein gültiger Domainname sein', + 'dns_mx_noalias' => 'Der MX Eintrag darf kein CNAME Eintrag sein.', + 'dns_cname_invaliddom' => 'Ungültiger Domain-Name für CNAME Eintrag', + 'dns_cname_nomorerr' => 'Es existiert bereits ein Eintrag mit dem gleichen Namen. Dieser Eintrag kann daher nicht für CNAME genutzt werden.', + 'dns_other_nomorerr' => 'Es existiert bereits ein CNAME Eintrag mit dem gleichen Namen. Dieser Eintrag kann daher nicht für einen anderen genutzt werden.', + 'dns_ns_invaliddom' => 'Ungültiger Domain-Name für NS Eintrag', + 'dns_srv_prioempty' => 'Ungültige SRV Priorität angegeben', + 'dns_srv_invalidcontent' => 'Ungültiger Wert des SRV Eintrags, dieser muss aus den Feldern weight, port und target, bestehen. Bsp.: 5 5060 sipserver.example.com.', + 'dns_srv_needdom' => 'Der Wert des SRV Eintrags muss ein gültiger Domainname sein', + 'dns_srv_noalias' => 'Der SRV Eintrag darf kein CNAME Eintrag sein.', + 'dns_duplicate_entry' => 'Eintrag existiert bereits', + 'dns_notfoundorallowed' => 'Domain nicht gefunden oder keine Berechtigung', + 'domain_nopunycode' => 'Die Eingabe von Punycode (IDNA) ist nicht notwendig. Die Domain wird automatisch konvertiert.', + 'dns_record_toolong' => 'Records/Labels können maximal 63 Zeichen lang sein', + 'noipportgiven' => 'Keine IP/Port angegeben', + 'jsonextensionnotfound' => 'Diese Funktion benötigt die PHP json-Erweiterung.', + 'cannotdeletesuperadmin' => 'Der erste Administrator kann nicht gelöscht werden.', + 'no_wwwcnamae_ifwwwalias' => 'Es kann kein CNAME Eintrag für "www" angelegt werden, da die Domain einen www-Alias aktiviert hat. Ändere diese Einstellung auf "Kein Alias" oder "Wildcard Alias"', + 'local_group_exists' => 'Die angegebene Gruppe existiert bereits auf dem System', + 'local_group_invalid' => 'Der angegebene Gruppen-Name ist nicht gültig', + 'invaliddnsforletsencrypt' => 'Die DNS-Einträge der Domain enhalten keine der gewählten IP Adressen. Let\'s Encrypt Zertifikats-Erstellung ist nicht möglich.', + 'notallowedphpconfigused' => 'Nutzung einer PHP-Konfiguration welche nicht dem Kunden zugeordnet ist', + 'pathmustberelative' => 'Der Benutzer hat nicht die benötigten Berechtigungen, um Pfade außerhalb des Kunden-Heimatverzeichnisses anzugeben. Bitte einen relativen Pfad angeben (kein führendes /).', + ], + 'extras' => [ + 'description' => 'Hier können Sie zusätzliche Extras einrichten, wie zum Beispiel einen Verzeichnisschutz.
Die Änderungen sind erst nach einer kurzen Zeit wirksam.', + 'directoryprotection_add' => 'Verzeichnisschutz anlegen', + 'view_directory' => 'Verzeichnis anzeigen', + 'pathoptions_add' => 'Pfadoptionen hinzufügen', + 'directory_browsing' => 'Verzeichnisinhalt anzeigen', + 'pathoptions_edit' => 'Pfadoptionen bearbeiten', + 'error404path' => '404', + 'error403path' => '403', + 'error500path' => '500', + 'error401path' => '401', + 'errordocument404path' => 'Fehlerdokument 404', + 'errordocument403path' => 'Fehlerdokument 403', + 'errordocument500path' => 'Fehlerdokument 500', + 'errordocument401path' => 'Fehlerdokument 401', + 'execute_perl' => 'Perl/CGI ausführen', + 'htpasswdauthname' => 'Grund der Authentifizierung (AuthName)', + 'directoryprotection_edit' => 'Verzeichnisschutz bearbeiten', + 'backup' => 'Sicherung erstellen', + 'backup_web' => 'Web-Daten sichern', + 'backup_mail' => 'E-Mail Daten sichern', + 'backup_dbs' => 'Datenbanken sichern', + 'path_protection_label' => 'Wichtig', + 'path_protection_info' => 'Wir raten dringend dazu den angegebenen Pfad zu schützen, siehe "Extras" -> "Verzeichnisschutz"', + ], + 'ftp' => [ + 'description' => 'Hier können Sie zusätzliche FTP-Konten einrichten.
Die Änderungen sind sofort wirksam und die FTP-Konten sofort benutzbar.', + 'account_add' => 'Benutzerkonto anlegen', + 'account_edit' => 'FTP-Konto bearbeiten', + 'editpassdescription' => 'Neues Passwort setzen oder leer für keine Änderung.', + ], + 'gender' => [ + 'title' => 'Geschlecht', + 'male' => 'Herr', + 'female' => 'Frau', + 'undef' => '', + ], + 'imprint' => 'Impressum', + 'index' => [ + 'customerdetails' => 'Kundendaten', + 'accountdetails' => 'Kontodaten', + ], + 'integrity_check' => [ + 'databaseCharset' => 'Characterset der Datenbank (sollte UTF-8 sein)', + 'domainIpTable' => 'IP <‐> Domain Verknüpfung', + 'subdomainSslRedirect' => 'Falsches SSL-redirect Flag bei nicht-SSL Domains', + 'froxlorLocalGroupMemberForFcgidPhpFpm' => 'froxlor-Benutzer in Kunden-Gruppen (für FCGID/php-fpm)', + 'webserverGroupMemberForFcgidPhpFpm' => 'Webserver-Benutzer in Kunden-Gruppen (für FCGID/php-fpm)', + 'subdomainLetsencrypt' => 'Hauptdomains ohne zugewiesenen SSL-Port haben keine Subdomain mit aktiviertem SSL-Redirect', + ], + 'logger' => [ + 'date' => 'Datum', + 'type' => 'Typ', + 'action' => 'Aktion', + 'user' => 'Benutzer', + 'truncate' => 'Log leeren', + 'reseller' => 'Reseller', + 'admin' => 'Administrator', + 'cron' => 'Cronjob', + 'login' => 'Login', + 'intern' => 'Intern', + 'unknown' => 'Unbekannt', + ], + 'login' => [ + 'username' => 'Benutzername', + 'password' => 'Passwort', + 'language' => 'Sprache', + 'login' => 'Anmelden', + 'logout' => 'Abmelden', + 'profile_lng' => 'Profilsprache', + 'welcomemsg' => 'Bitte melden Sie sich an, um auf Ihr Konto zuzugreifen.', + 'forgotpwd' => 'Passwort vergessen?', + 'presend' => 'Passwort zurücksetzen', + 'email' => 'E-Mail-Adresse', + 'remind' => 'Passwort zurücksetzen', + 'usernotfound' => 'Fehler: Unbekannter Benutzer!', + 'backtologin' => 'Zurück zum Login', + 'combination_not_found' => 'Kombination aus Benutzername und E-Mail Adresse stimmen nicht überein.', + '2fa' => 'Zwei-Faktor Authentifizierung (2FA)', + '2facode' => 'Bitte 2FA Code angeben', + ], + 'mails' => [ + 'pop_success' => [ + 'mailbody' => 'Hallo,\\n\\nIhr E-Mail-Konto {USERNAME}\\nwurde erfolgreich eingerichtet.\\n\\nDies ist eine automatisch generierte\\nE-Mail, bitte antworten Sie nicht auf\\ndiese Mitteilung.\\n\\nIhr Administrator', + 'subject' => 'E-Mail-Konto erfolgreich eingerichtet', + ], + 'createcustomer' => [ + 'mailbody' => 'Hallo {FIRSTNAME} {NAME},\\n\\nhier Ihre Accountinformationen:\\n\\nBenutzername: {USERNAME}\\nPasswort: {PASSWORD}\\n\\nVielen Dank,\\nIhr Administrator', + 'subject' => 'Kontoinformationen', + ], + 'pop_success_alternative' => [ + 'mailbody' => 'Hallo,\\n\\nihr E-Mail-Konto {USERNAME}\\nwurde erfolgreich eingerichtet.\\nIhr Passwort lautet {PASSWORD}.\\n\\nDies ist eine automatisch generierte\\neMail, bitte antworten Sie nicht auf\\ndiese Mitteilung.\\n\\nIhr Administrator', + 'subject' => 'E-Mail-Konto erfolgreich eingerichtet', + ], + 'password_reset' => [ + 'subject' => 'Passwort zurückgesetzt', + 'mailbody' => 'Hallo {SALUTATION},\\n\\nhiermit erhalten Sie den Link, um ein neues Passwort zu setzen. Dieser Link ist für die nächsten 24 Stunden gültig.\\n\\n{LINK}\\n\\nVielen Dank,\\nIhr Administrator', + ], + 'new_database_by_customer' => [ + 'subject' => '[Froxlor] Neue Datenbank erstellt', + 'mailbody' => 'Hallo {CUST_NAME}, + +du hast gerade eine neue Datenbank angelegt. Hier die angegebenen Informationen: + +Datenbankname: {DB_NAME} +Passwort: {DB_PASS} +Beschreibung: {DB_DESC} +Datenbank-Server: {DB_SRV} +phpMyAdmin: {PMA_URI} +Vielen Dank, Ihr Administrator', + ], + 'new_ftpaccount_by_customer' => [ + 'subject' => 'Neuer FTP-Benutzer erstellt', + 'mailbody' => 'Hallo {CUST_NAME}, + +du hast gerade einen neuen FTP-Benutzer angelegt. Hier die angegebenen Informationen: + +Benutzername: {USR_NAME} +Passwort: {USR_PASS} +Pfad: {USR_PATH} + +Vielen Dank, Ihr Administrator', + ], + 'trafficmaxpercent' => [ + 'mailbody' => 'Sehr geehrte(r) {NAME},\\n\\nSie haben bereits {TRAFFICUSED} MB von Ihren insgesamt {TRAFFIC} MB Traffic verbraucht.\\nDies sind mehr als {MAX_PERCENT}%.\\n\\nVielen Dank,\\nIhr Administrator', + 'subject' => 'Sie erreichen bald Ihr Traffic-Limit', + ], + 'diskmaxpercent' => [ + 'mailbody' => 'Sehr geehrte(r) {NAME},\\n\\nSie haben bereits {DISKUSED} MB von Ihren insgesamt {DISKAVAILABLE} MB Speicherplatz verbraucht.\\nDies sind mehr als {MAX_PERCENT}%.\\n\\nVielen Dank,\\nIhr Administrator', + 'subject' => 'Sie erreichen bald Ihr Speicherplatz-Limit', + ], + '2fa' => [ + 'mailbody' => 'Hallo,\\n\\nihr 2FA-Login Code lautet: {CODE}\\n\\nDies ist eine automatisch generierte\\neMail, bitte antworten Sie nicht auf\\ndiese Mitteilung.\\n\\nIhr Administrator', + 'subject' => 'Froxlor - 2FA Code', + ], + ], + 'menu' => [ + 'message' => 'Nachrichten', + ], + 'menue' => [ + 'main' => [ + 'main' => 'Allgemein', + 'changepassword' => 'Passwort ändern', + 'changelanguage' => 'Sprache ändern', + 'username' => 'Angemeldet als ', + 'changetheme' => 'Theme wechseln', + 'apihelp' => 'API Hilfe', + 'apikeys' => 'API Keys', + ], + 'email' => [ + 'email' => 'E-Mail', + 'emails' => 'Adressen', + 'webmail' => 'Webmail', + ], + 'mysql' => [ + 'mysql' => 'MySQL', + 'databases' => 'Datenbanken', + 'phpmyadmin' => 'phpMyAdmin', + ], + 'domains' => [ + 'domains' => 'Domains', + 'settings' => 'Einstellungen', + ], + 'ftp' => [ + 'ftp' => 'FTP', + 'accounts' => 'Benutzerkonten', + 'webftp' => 'WebFTP', + ], + 'extras' => [ + 'extras' => 'Extras', + 'directoryprotection' => 'Verzeichnisschutz', + 'pathoptions' => 'Pfadoptionen', + 'backup' => 'Sicherung', + ], + 'traffic' => [ + 'traffic' => 'Traffic', + 'current' => 'Aktueller Monat', + 'table' => 'Übersicht', + ], + 'phpsettings' => [ + 'maintitle' => 'PHP-Konfigurationen', + 'fpmdaemons' => 'PHP-FPM Versionen', + ], + ], + 'message' => [ + 'norecipients' => 'Es wurde keine E-Mail versendet, da sich keine Empfänger in der Datenbank befinden', + ], + 'mysql' => [ + 'databasename' => 'Benutzer-/Datenbankname', + 'databasedescription' => 'Datenbankbeschreibung', + 'database_create' => 'Datenbank anlegen', + 'description' => 'Hier können Sie MySQL-Datenbanken anlegen und löschen.
Die Änderungen werden sofort wirksam und die Datenbanken sind sofort benutzbar.
Im Menü finden Sie einen Link zu phpMyAdmin, mit dem Sie Ihre Datenbankinhalte komfortabel bearbeiten können.

Die Zugangsdaten sind wie folgt: (Die Angaben in kursiver Schrift sind durch die jeweiligen Einträge zu ersetzen)
Hostname:
Benutzername: Datenbankname
Passwort: das gewählte Passwort
Datenbank: Datenbankname', + 'mysql_server' => 'MySQL-Server', + 'database_edit' => 'Datenbank bearbeiten', + 'size' => 'Datenbankgröße', + ], + 'panel' => [ + 'edit' => 'bearbeiten', + 'delete' => 'löschen', + 'create' => 'anlegen', + 'save' => 'Speichern', + 'yes' => 'Ja', + 'no' => 'Nein', + 'emptyfornochanges' => 'leer für keine Änderung', + 'emptyfordefault' => 'Leer für Standardeinstellung.', + 'path' => 'Pfad', + 'toggle' => 'Umschalten', + 'next' => 'Weiter', + 'dirsmissing' => 'Das angegebene Verzeichnis konnte nicht gefunden werden.', + 'urloverridespath' => 'URL (überschreibt Pfad)', + 'pathorurl' => 'Pfad oder URL', + 'ascending' => 'aufsteigend', + 'descending' => 'absteigend', + 'search' => 'Suche', + 'used' => 'genutzt', + 'translator' => 'Übersetzung', + 'reset' => 'Änderungen verwerfen', + 'pathDescription' => 'Sollte das Verzeichnis nicht existieren, wird es automatisch erstellt.', + 'pathDescriptionEx' => '
Sollte eine Weiterleitung auf eine andere Domain gewünscht sein, muss der Eintrag mit http:// oder https:// beginnen.', + 'pathDescriptionSubdomain' => 'Sollte das Verzeichnis nicht existieren, wird es automatisch erstellt.
Sollte eine Weiterleitung auf eine andere Domain gewünscht sein, muss der Eintrag mit http:// oder https:// beginnen.
Endet die URL mit einem / (Slash) geht Froxlor von einem Ordner aus, wenn nicht, wird es wie eine Datei behandelt.', + 'back' => 'Zurück', + 'reseller' => 'Reseller', + 'admin' => 'Administrator', + 'customer' => 'Kunde/n', + 'send' => 'Versenden', + 'nosslipsavailable' => 'Für diesen Server wurden noch keine SSL IP/Port Kombinationen eingetragen', + 'backtooverview' => 'Zurück zur Übersicht', + 'dateformat' => 'JJJJ-MM-TT', + 'dateformat_function' => 'd.m.Y', + 'timeformat_function' => 'H:i:s', + 'default' => 'Standard', + 'never' => 'Nie', + 'active' => 'Aktiv', + 'please_choose' => 'Bitte auswählen', + 'allow_modifications' => 'Änderungen zulassen', + 'megabyte' => 'Megabyte', + 'not_supported' => 'Nicht unterstützt in: ', + 'view' => 'ansehen', + 'toomanydirs' => 'Zu viele Unterverzeichnisse. Weiche auf manuelle Verzeichniseingabe aus.', + 'abort' => 'Abbrechen', + 'not_activated' => 'Nicht aktiviert', + 'off' => 'aus', + 'options' => 'Optionen', + 'neverloggedin' => 'Keine Anmeldung bisher', + 'descriptionerrordocument' => 'Mögliche Werte sind: URL, Pfad zu einer Datei oder ein Text, umgeben von Anführungszeichen (" ").
Leer für Server-Standardwert.', + 'unlock' => 'entsperren', + 'theme' => 'Theme', + 'variable' => 'Variable', + 'description' => 'Beschreibung', + 'ssleditor' => 'SSL-Einstellungen für diese Domain', + 'dashboard' => 'Dashboard', + 'assigned' => 'zugewiesen', + 'available' => 'verfügbar', + 'news' => 'Neuigkeiten', + 'newsfeed_disabled' => 'Das Newsfeed ist deaktiviert. Klicken Sie auf das Editier-Icon, um zu den Einstellungen zu gelangen.', + 'ftpdesc' => 'FTP-Beschreibung', + 'letsencrypt' => 'Benutzt Let\'s encrypt', + 'set' => 'Setzen', + 'backuppath' => [ + 'title' => 'Pfad zur Ablage der Backups', + 'description' => 'In diesem Ordner werden die Backups abgelegt. Wenn das Sichern von Web-Daten aktiviert ist, werden alle Dateien aus dem Heimatverzeichnis gesichert, exklusive des hier angegebenen Backup-Ordners.', + ], + 'none_value' => 'Keine', + 'viewlogs' => 'Logdateien einsehen', + 'not_configured' => 'Das System wurde noch nicht konfiguriert. Klicke auf den Button um die Installation zu starten.', + 'ihave_configured' => 'Ich habe die Dienste konfiguriert', + 'system_is_configured' => 'Das System ist bereits konfiguriert', + 'settings_before_configuration' => 'Stelle sicher, dass die Einstellungen angepasst wurden bevor die Dienste konfiguriert werden.', + 'image_field_delete' => 'Das momentan vorhandene Bild löschen', + 'usage_statistics' => 'Resourcen-Verbrauch', + 'security_question' => 'Sicherheitsabfrage', + 'listing_empty' => 'Keine Einträge gefunden', + 'unspecified' => 'keine Angabe', + 'settingsmode' => 'Modus', + 'settingsmodebasic' => 'Einfach', + 'settingsmodeadvanced' => 'Erweitert', + 'settingsmodetoggle' => 'Modus umschalten', + 'modalclose' => 'Schließen', + 'managetablecolumnsmodal' => [ + 'title' => 'Tabellenspalten verwalten', + 'description' => 'Hier können die angezeigten Tabellenspalten angepasst werden', + ], + ], + 'phpfpm' => [ + 'vhost_httpuser' => 'Lokaler Benutzer für PHP-FPM (Froxlor-Vhost)', + 'vhost_httpgroup' => 'Lokale Gruppe für PHP-FPM (Froxlor-Vhost)', + 'ownvhost' => [ + 'title' => 'Verwende PHP-FPM im Froxlor-Vhost', + 'description' => 'Wenn verwendet, wird Froxlor selbst unter einem lokalen Benutzer ausgeführt', + ], + 'use_mod_proxy' => [ + 'title' => 'Verwende mod_proxy / mod_proxy_fcgi', + 'description' => 'Muss gesetzt sein bei Debian 9.x (Stretch) oder neuer. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus', + ], + 'ini_flags' => 'Mögliche php_flags für die php.ini. Pro Zeile eine Direktive', + 'ini_values' => 'Mögliche php_values für die php.ini. Pro Zeile eine Direktive', + 'ini_admin_flags' => 'Mögliche php_admin_flags für die php.ini. Pro Zeile eine Direktive', + 'ini_admin_values' => 'Mögliche php_admin_values für die php.ini. Pro Zeile eine Direktive', + ], + 'privacy' => 'Datenschutzerklärung', + 'pwdreminder' => [ + 'success' => 'Das Zurücksetzen des Passworts wurde erfolgreich angefordert. Sie sollten nun eine E-Mail mit weiteren Anweisungen erhalten.', + 'notallowed' => 'Das Zurücksetzen des Passworts ist deaktiviert.', + 'changed' => 'Ihr Passwort wurde erfolgreich geändert. Sie können sich nun damit anmelden.', + 'wrongcode' => 'Der verwendete Aktivierungscode ist entweder nicht gültig oder bereits abgelaufen.', + 'choosenew' => 'Neues Passwort auswählen', + ], + 'question' => [ + 'question' => 'Sicherheitsabfrage', + 'admin_customer_reallydelete' => 'Wollen Sie den Kunden "%s" wirklich löschen?
ACHTUNG! Alle Daten gehen unwiderruflich verloren! Nach dem Vorgang müssen die Daten manuell aus dem Dateisystem entfernt werden.', + 'admin_domain_reallydelete' => 'Wollen Sie die Domain "%s" wirklich löschen?', + 'admin_domain_reallydisablesecuritysetting' => 'Wollen Sie die wichtige Sicherheitseinstellung \'OpenBasedir\' wirklich deaktivieren?', + 'admin_admin_reallydelete' => 'Wollen Sie den Admin "%s" wirklich löschen?
Alle Kunden und Domains dieses Admins werden Ihnen zugeteilt.', + 'admin_template_reallydelete' => 'Wollen Sie die Vorlage "%s" wirklich löschen?', + 'domains_reallydelete' => 'Wollen Sie die Domain "%s" wirklich löschen?', + 'email_reallydelete' => 'Wollen Sie die E-Mail-Adresse "%s" wirklich löschen?', + 'email_reallydelete_account' => 'Wollen Sie das Konto von "%s" wirklich löschen?', + 'email_reallydelete_forwarder' => 'Wollen Sie die Weiterleitung "%s" wirklich löschen?', + 'extras_reallydelete' => 'Wollen Sie den Verzeichnisschutz für "%s" wirklich löschen?', + 'extras_reallydelete_pathoptions' => 'Wollen Sie die Optionen für den Pfad "%s" wirklich löschen?', + 'ftp_reallydelete' => 'Wollen Sie das FTP-Benutzerkonto "%s" wirklich löschen?', + 'mysql_reallydelete' => 'Wollen Sie die Datenbank "%s" wirklich löschen?
ACHTUNG! Alle Daten gehen unwiderruflich verloren!', + 'admin_configs_reallyrebuild' => 'Wollen Sie wirklich alle Konfigurationsdateien neu erstellen lassen?', + 'admin_customer_alsoremovefiles' => 'Kundendaten löschen?', + 'admin_customer_alsoremovemail' => 'E-Mail-Daten auf dem Dateisystem löschen?', + 'admin_customer_alsoremoveftphomedir' => 'Heimatverzeichnis des FTP-Benutzers löschen?', + 'admin_ip_reallydelete' => 'Wollen Sie wirklich die IP-Adresse "%s" löschen?', + 'admin_domain_reallydocrootoutofcustomerroot' => 'Sind Sie sicher, dass der DocumentRoot dieser Domain außerhalb des Heimatverzeichnisses des Kunden liegen soll?', + 'admin_counters_reallyupdate' => 'Wollen Sie den Ressourcenverbrauch neu berechnen?', + 'admin_cleartextmailpws_reallywipe' => 'Wollen Sie wirklich alle unverschlüsselten Passwörter aus der Tabelle mail_users entfernen? Dieser Schritt kann nicht rückgängig gemacht werden! Die Einstellung für das Speichern der E-Mail-Konten-Passwörter in Klartext wird hierbei ebenfalls deaktiviert.', + 'logger_reallytruncate' => 'Wollen Sie die Tabelle "%s" wirklich leeren?', + 'admin_quotas_reallywipe' => 'Sind Sie sicher, dass alle E-Mail-Kontingente aus der Tabelle mail_users entfernt werden sollen? Dieser Schritt kann nicht rückgängig gemacht werden!', + 'admin_quotas_reallyenforce' => 'Sind Sie sicher, dass Sie allen Benutzern das Default-Quota zuweisen wollen? Dies kann nicht rückgängig gemacht werden!', + 'phpsetting_reallydelete' => 'Wollen Sie diese PHP-Einstellungen wirklich löschen? Alle Domains die diese Einstellungen bis jetzt verwendet haben, werden dann auf die Standardeinstellungen umgestellt.', + 'fpmsetting_reallydelete' => 'Wollen Sie diese PHP-FPM Einstellungen wirklich löschen? Alle PHP Konfigurationen die diese Einstellungen bis jetzt verwendet haben, werden dann auf die Standardeinstellungen umgestellt.', + 'remove_subbutmain_domains' => 'Auch Domains entfernen, welche als volle Domains hinzugefügt wurden, aber Subdomains von dieser Domain sind?', + 'customer_reallyunlock' => 'Wollen Sie den Kunden "%s" wirklich entsperren?', + 'admin_integritycheck_reallyfix' => 'Möchten Sie wirklich versuchen sämtliche Datenbank-Integritätsprobleme automatisch zu beheben?', + 'plan_reallydelete' => 'Wollen Sie den Api-Key wirklich löschen?', + ], + 'serversettings' => [ + 'session_timeout' => [ + 'title' => 'Session-Timeout', + 'description' => 'Wie lange muss ein Benutzer inaktiv sein, damit die Session ungültig wird? (in Sekunden)', + ], + 'accountprefix' => [ + 'title' => 'Kundenpräfix', + 'description' => 'Welchen Präfix sollen die Kundenaccounts haben?', + ], + 'mysqlprefix' => [ + 'title' => 'MySQL-Präfix', + 'description' => 'Welchen Präfix sollen die MySQL-Benutzerkonten haben?
Mit "RANDOM" als Wert wird ein 3-stelliger Zufallswert als Präfix verwendet.
Mit "DBNAME" als Wert wird ein Feld Databankname zusammen mit dem Kundennamen als Präfix genutzt.', + ], + 'ftpprefix' => [ + 'title' => 'FTP-Präfix', + 'description' => 'Welchen Präfix sollen die FTP-Benutzerkonten haben?
Falls FTP-Quoatas verwendet werden, ist es notwendig das Quota-SQL-Query in der FTP-Server-Config ebenfalls zu ändern!', + ], + 'documentroot_prefix' => [ + 'title' => 'Heimatverzeichnis', + 'description' => 'Wo sollen die Heimatverzeichnisse der Kunden liegen?', + ], + 'logfiles_directory' => [ + 'title' => 'Webserver-Logdateien-Verzeichnis', + 'description' => 'Wo sollen die Logdateien des Webservers liegen?', + ], + 'logfiles_script' => [ + 'title' => 'Eigenes Script zu dem Log-Files übergeben werden', + 'description' => 'Hier kann ein Script an das die Loginhalte übergeben werden hinterlegt und die Platzhalter {LOGFILE}, {DOMAIN} und {CUSTOMER} genutzt werden, sofern nötig. Falls ein Script angegeben wird, muss die Option Webserver Logdateien umleiten gesetzt werden', + ], + 'logfiles_format' => [ + 'title' => 'Access-Log Format', + 'description' => 'Hier kann ein angepasstes Log-format entsprechend der Webserver-Dokumentation angegeben werden, leer lassen für Standard. Abhängig vom LogFormat muss die Angabe unter Anführungszeichen stehen.
Wenn verwendet mit nginx, so kann es wie folgt aussehen: log_format frx_custom {EINGESTELLTES_FORMAT}.
Wenn verwendet mit Apache, so kann es wie folgt aussehen: LogFormat {EINGESTELLTES_FORMAT} frx_custom.
ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden auch übernommen und der Webserver könnte nicht mehr starten!', + ], + 'logfiles_type' => [ + 'title' => 'Access-Log Typ', + 'description' => 'Wähle zwischen combined oder vhost_combined.', + ], + 'logfiles_piped' => [ + 'title' => 'Webserver Logdateien zu eigenem Script umleiten (siehe oben)', + 'description' => 'Wenn ein Script für die Logdateien verwendet wird, muss diese Option aktiviert werden, damit der Webserver die Ausgabe an das Script weitergibt.', + ], + 'ipaddress' => [ + 'title' => 'IP-Adresse', + 'description' => 'Welche Haupt-IP-Adresse hat der Server?', + ], + 'hostname' => [ + 'title' => 'Hostname', + 'description' => 'Welchen Hostnamen hat der Server?', + ], + 'apachereload_command' => [ + 'title' => 'Webserver-Reload-Befehl', + 'description' => 'Wie heißt das Skript zum Neuladen der Webserver-Konfigurationsdateien?', + ], + 'bindenable' => [ + 'title' => 'Nameserver aktivieren', + 'description' => 'Hier können Sie den Nameserver global aktivieren bzw. deaktivieren.', + ], + 'bindconf_directory' => [ + 'title' => 'DNS-Server Konfigurationsordner', + 'description' => 'Wo liegen die DNS-Server Konfigurationsdateien?', + ], + 'bindreload_command' => [ + 'title' => 'DNS-Server Reload-Befehl', + 'description' => 'Wie heißt das Skript zum Neuladen der DNS-Server Konfigurationsdateien?', + ], + 'vmail_uid' => [ + 'title' => 'Mail-UID', + 'description' => 'Welche UID sollen die E-Mails haben?', + ], + 'vmail_gid' => [ + 'title' => 'Mail-GID', + 'description' => 'Welche GID sollen die E-Mails haben?', + ], + 'vmail_homedir' => [ + 'title' => 'Mail-Homedir', + 'description' => 'Wo sollen die E-Mails liegen?', + ], + 'adminmail' => [ + 'title' => 'Absenderadresse', + 'description' => 'Wie lautet die Absenderadresse für E-Mails aus dem Panel?', + ], + 'phpmyadmin_url' => [ + 'title' => 'phpMyAdmin-URL', + 'description' => 'Wo liegt phpMyAdmin? (muss mit http(s):// beginnen)', + ], + 'webmail_url' => [ + 'title' => 'Webmail-URL', + 'description' => 'Wo liegt der Webmail-Client? (muss mit http(s):// beginnen)', + ], + 'webftp_url' => [ + 'title' => 'WebFTP-URL', + 'description' => 'Wo liegt der WebFTP-Client? (muss mit http(s):// beginnen)', + ], + 'language' => [ + 'description' => 'Welche Sprache ist Ihre Standardsprache?', + ], + 'maxloginattempts' => [ + 'title' => 'Maximale Loginversuche', + 'description' => 'Maximale Anzahl an Loginversuchen bis der Account deaktiviert wird.', + ], + 'deactivatetime' => [ + 'title' => 'Länge der Deaktivierung', + 'description' => 'Zeitraum (in Sekunden) für den der Account deaktiviert ist.', + ], + 'pathedit' => [ + 'title' => 'Pfad-Eingabemethode', + 'description' => 'Soll ein Pfad via Auswahlliste ausgewählt oder manuell eingegeben werden können?', + ], + 'nameservers' => [ + 'title' => 'Nameserver', + 'description' => 'Eine durch Komma getrennte Liste mit den Hostnamen aller Nameserver. Der Erste ist der Primäre.', + ], + 'mxservers' => [ + 'title' => 'MX-Server', + 'description' => 'Eine durch Komma getrenne Liste, die ein Paar mit einer Nummer und den Hostnamen einen MX-Servers, getrennt durch ein Leerzeichen, enthält (z. B. \'10 mx.example.tld\').', + ], + 'paging' => [ + 'title' => 'Einträge pro Seite', + 'description' => 'Wie viele Einträge sollen auf einer Seite angezeigt werden? (0 = Paging deaktivieren)', + ], + 'defaultip' => [ + 'title' => 'Standard-IP/Port-Kombination', + 'description' => 'Welche IP/Port-Kombination sollen standardmäßig verwendet werden?', + ], + 'defaultsslip' => [ + 'title' => 'Standard SSL IP/Port-Kombination', + 'description' => 'Welche ssl-fähigen IP/Port-Kombination sollen standardmäßig verwendet werden?', + ], + 'phpappendopenbasedir' => [ + 'title' => 'Anzuhängende Pfade bei OpenBasedir', + 'description' => 'Diese (durch Doppelpunkte getrennten) Pfade werden dem OpenBasedir-Statement in jedem vHost-Container angehängt.', + ], + 'natsorting' => [ + 'title' => 'Natürliche Sortierung in der Listenansicht nutzen', + 'description' => 'Sortiert die Liste in der Reihenfolge web1 -> web2 -> web11 statt web1 -> web11 -> web2.', + ], + 'deactivateddocroot' => [ + 'title' => 'Docroot für deaktivierte Benutzer', + 'description' => 'Dieser Pfad wird als Docroot für deaktivierte Benutzer verwendet. Ist das Feld leer, wird kein vHost erstellt.', + ], + 'mailpwcleartext' => [ + 'title' => 'Passwörter der Mail-Konten auch im Klartext in der Datenbank speichern', + 'description' => 'Wenn diese Einstellung auf Ja gesetzt wird, werden alle Passwörter auch unverschlüsselt (also im Klartext, für jeden mit Zugriff auf die Froxlor-Datenbank sofort lesbar) in der mail_users-Tabelle gespeichert. Aktivieren Sie diese Option nur dann, wenn Sie SASL nutzen!', + ], + 'ftpdomain' => [ + 'title' => 'FTP-Benutzerkonten @domain', + 'description' => 'Können Kunden FTP-Benutzerkonten user@domain anlegen?', + ], + 'mod_fcgid' => [ + 'title' => 'PHP über mod_fcgid/suexec einbinden', + 'description' => 'PHP wird unter dem Benutzer des Kunden ausgeführt.

Dies benötigt eine spezielle Webserver-Konfiguration für Apache, siehe FCGID-Handbuch.', + 'configdir' => [ + 'title' => 'Konfigurations-Verzeichnis', + 'description' => 'Wo sollen alle Konfigurationsdateien von fcgid liegen? Wenn Sie keine selbst kompilierte suexec Binary benutzen, was in der Regel der Fall ist, muss dieser Pfad unter /var/www/ liegen.

ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.
', + ], + 'tmpdir' => [ + 'title' => 'Temporäres Verzeichnis', + 'description' => 'Wo sollen die temporären Verzeichnisse erstellt werden', + ], + 'starter' => [ + 'title' => 'Prozesse je Domain', + 'description' => 'Wieviele PHP-Prozesse pro Domain sollen gestartet/erlaubt werden. Der Wert 0 wird empfohlen, da PHP die Anzahl dann selbst effizient verwaltet.', + ], + 'wrapper' => [ + 'title' => 'Wrappereinbindung in Vhosts', + 'description' => 'Wie sollen die Wrapper in den Vhosts eingebunden werden', + ], + 'peardir' => [ + 'title' => 'Globale PEAR Verzeichnisse', + 'description' => 'Welche globalen PEAR Verzeichnisse sollen in den php.ini-Einstellungen ersetzt werden? Einzelne Verzeichnisse sind mit einem Doppelpunkt zu trennen.', + ], + 'maxrequests' => [ + 'title' => 'Maximale Requests pro Domain', + 'description' => 'Wieviele PHP-Requests pro Domain sollen erlaubt werden?', + ], + 'defaultini' => 'Voreingestellte PHP-Konfiguration für neue Domains', + 'defaultini_ownvhost' => 'Voreingestellte PHP-Konfiguration für den Froxlor-Vhost', + 'idle_timeout' => [ + 'title' => 'Idle-Timeout', + 'description' => 'Timeout-Einstellung für mod_FastCGI.', + ], + ], + 'sendalternativemail' => [ + 'title' => 'Alternative E-Mail-Adresse benutzen', + 'description' => 'Während des Erstellens eines Accounts das Passwort an eine andere E-Mail-Adresse senden', + ], + 'apacheconf_vhost' => [ + 'title' => 'Webserver vHost-Konfigurations-Datei/Verzeichnis-Name', + 'description' => 'Wo sollen die vHost-Konfigurationen abgelegt werden? Sie können entweder eine Datei (also mit allen vHosts) oder einen Ordner (mit einer Datei pro vHost) angeben.', + ], + 'apacheconf_diroptions' => [ + 'title' => 'Webserver Verzeichnisoption-Konfigurations-Datei/Verzeichnis-Name', + 'description' => 'Wo sollen die Verzeichnisoption-Konfigurationen abgelegt werden? Sie können entweder eine Datei (also mit allen vHosts) oder einen Ordner (mit einer Datei pro vHost) angeben.', + ], + 'apacheconf_htpasswddir' => [ + 'title' => 'Webserver htpasswd Verzeichnisname', + 'description' => 'Wo sollen die htpasswd-Dateien für den Verzeichnisschutz abgelegt werden?', + ], + 'mysql_access_host' => [ + 'title' => 'MySQL-Access-Hosts', + 'description' => 'Eine durch Komma getrennte Liste mit den Hostnamen aller Hostnames/IP-Adressen, von denen sich die Benutzer einloggen dürfen. Um ein Subnetz zu erlauben ist die Netzmaske oder CIDR Syntax erlaubt.', + ], + 'webalizer_quiet' => [ + 'title' => 'Webalizerausgabe', + 'description' => 'Ausgabefreudigkeit des Webalizer-Programms', + ], + 'logger' => [ + 'enable' => 'Logging ja/nein', + 'severity' => 'Logging Level', + 'types' => [ + 'title' => 'Log-Art(en)', + 'description' => 'Wählen Sie hier die gewünschten Logtypen. Für Mehrfachauswahl, halten Sie während der Auswahl STRG gedrückt
Mögliche Logtypen sind: syslog, file, mysql', + ], + 'logfile' => 'Log-Datei Pfad inklusive Dateinamen', + 'logcron' => 'Logge Cronjobs', + 'logcronoption' => [ + 'never' => 'Nie', + 'once' => 'Einmalig', + 'always' => 'Immer', + ], + ], + 'ssl' => [ + 'use_ssl' => [ + 'title' => 'Aktiviere SSL', + 'description' => 'Erlaubt die Nutzung von SSL für den Webserver', + ], + 'ssl_cert_file' => [ + 'title' => 'Pfad zum SSL-Zertifikat', + 'description' => 'Geben Sie den Pfad inklusive Dateinamen des Zertifikats an (meist .crt or .pem).', + ], + 'openssl_cnf' => 'Standardwerte zum Erstellen eines Zertifikats', + 'ssl_key_file' => [ + 'title' => 'Pfad zum SSL Private-Key', + 'description' => 'Geben Sie den Pfad inklusive Dateinamen der Schlüssel-Datei an (der private-key, meist .key).', + ], + 'ssl_ca_file' => [ + 'title' => 'Pfad zum SSL-CA-Zertifikat (optional)', + 'description' => 'Client Authentifizierung, dieses Feld sollte nur gesetzt werden, wenn es wirklich gebraucht wird.', + ], + 'ssl_cipher_list' => [ + 'title' => 'Erlaubte SSL Ciphers festlegen', + 'description' => 'Dies ist eine Liste von Ciphers, die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn eine SSL Verbindung besteht. Eine Liste aller Ciphers und wie diese hinzugefügt/ausgeschlossen werden ist in den Abschnitten "CIPHER LIST FORMAT" und "CIPHER STRINGS" in der man-page für Ciphers zu finden.

Standard-Wert ist:
ECDH+AESGCM:ECDH+AES256:!aNULL:!MD5:!DSS:!DH:!AES128
', + ], + 'apache24_ocsp_cache_path' => [ + 'title' => 'Apache 2.4: Pfad zum OCSP-Stapling-Cache', + 'description' => 'Konfiguriert den Cache-Pfad zum Zwischenspeichern der OCSP-Antworten,
die an TLS-Handshakes angehängt werden.', + ], + 'ssl_protocols' => [ + 'title' => 'SSL Protokollversion festlegen', + 'description' => 'Dies ist eine Liste von SSL/TLS Protokollversionen die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn SSL verwendet wird. Hinweis: Ältere Browser sind möglicherweise nicht vollständig zum neusten Protokoll kompatibel.

Standard-Wert ist:
TLSv1.2
', + ], + 'tlsv13_cipher_list' => [ + 'title' => 'Explizite TLSv1.3 Ciphers, wenn genutzt', + 'description' => 'Dies ist eine Liste von Ciphers, die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn eine TLSv1.3 Verbindung hergestellt werden soll. Eine Liste aller Ciphers und wie diese hinzugefügt/ausgeschlossen werden ist der Dokumentation für TLSv1.3 zu entnehmen.

Standard-Wert ist leer', + ], + ], + 'default_vhostconf' => [ + 'title' => 'Standard vHost-Einstellungen', + 'description' => 'Der Inhalt dieses Feldes wird direkt in den IP/Port-vHost-Container übernommen. Die folgenden Variablen können verwendet werden:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (wenn zutreffend)

ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Der Webserver könnte nicht mehr starten!', + ], + 'default_vhostconf_domain' => [ + 'description' => 'Der Inhalt dieses Feldes wird direkt in jeden Domain-vHost-Container übernommen. Die folgenden Variablen können verwendet werden:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (wenn zutreffend)
ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Der Webserver könnte nicht mehr starten!', + ], + 'apache_globaldiropt' => [ + 'title' => 'Kunden-Prefix Ordner-Optionen', + 'description' => 'Der Inhalt dieses Feldes wird in die 05_froxlor_dirfix_nofcgid.conf Apache Konfigurationsdatei eingefügt. Wenn leer werden folgende Standardwerte verwendet:

apache >=2.4
Require all granted
AllowOverride All

apache <=2.2
Order allow,deny
allow from all', + ], + 'decimal_places' => 'Nachkommastellen bei der Ausgabe von Traffic/Webspace', + 'webalizer_enabled' => 'Nutze Webalizer-Statistiken', + 'awstats_enabled' => 'Nutze AWStats-Statistiken', + 'selfdns' => [ + 'title' => 'Manuelle DNS-Einstellungen für Domains', + ], + 'selfdnscustomer' => [ + 'title' => 'Erlaube Kunden eigene DNS-Einstellungen vorzunehmen.', + ], + 'unix_names' => [ + 'title' => 'Benutze UNIX-kompatible Benutzernamen.', + 'description' => 'Erlaubt die Nutzung von - und _ in Benutzernamen wenn Nein.', + ], + 'allow_password_reset' => [ + 'title' => 'Erlaube das Zurücksetzen des Kundenpassworts.', + 'description' => 'Kunden können ihr Passwort zurücksetzen und bekommen einen Aktivierungs-Link per E-Mail zugesandt', + ], + 'allow_password_reset_admin' => [ + 'title' => 'Erlaube das Zurücksetzen von Admin-/Reseller-Passwörtern.', + 'description' => 'Admins/Reseller können ihr Passwort zurücksetzen und bekommen einen Aktivierungs-Link per E-Mail zugesandt', + ], + 'mail_quota' => [ + 'title' => 'Mailbox-Kontingent', + 'description' => 'Standard-Kontingent für neu erstellte E-Mail-Benutzerkonten (Megabyte).', + ], + 'mail_quota_enabled' => [ + 'title' => 'Nutze E-Mail-Kontingent für Kunden', + 'description' => 'Aktiviere Kontingent für E-Mail-Konten. Standard ist Nein, da dies eine spezielle Konfiguration voraussetzt.', + 'removelink' => 'Hier klicken, um alle E-Mail-Kontingente zu entfernen', + 'enforcelink' => 'Hier klicken, um allen Benutzern das Standard-Kontingent zu zuweisen.', + ], + 'index_file_extension' => [ + 'description' => 'Welche Dateiendung soll die index Datei in neu erstellten Kundenverzeichnissen haben? Diese Dateiendung wird dann verwendet, wenn Sie bzw. einer Ihrer Admins eigene index Dateivorlagen erstellt haben.', + 'title' => 'Dateiendung für index Datei in neu erstellen Kundenverzeichnissen', + ], + 'session_allow_multiple_login' => [ + 'title' => 'Erlaube gleichzeitigen Login', + 'description' => 'Wenn diese Option aktiviert ist, können sich Nutzer mehrmals gleichzeitig anmelden.', + ], + 'panel_allow_domain_change_admin' => [ + 'title' => 'Erlaube Verschieben von Domains unter Admins', + 'description' => 'Wenn diese Option aktiviert ist, kann unter Domaineinstellungen die Domain einem anderen Admin zugewiesen werden.
Achtung: Wenn der Kunde einer Domain nicht dem gleichen Admin zugeordnet ist wie die Domain selbst, kann dieser Admin alle anderen Domains des Kunden sehen!', + ], + 'panel_allow_domain_change_customer' => [ + 'title' => 'Erlaube Verschieben von Domains unter Kunden', + 'description' => 'Wenn diese Option aktiviert ist, kann unter Domaineinstellungen die Domain einem anderen Kunden zugewiesen werden.
Achtung: Der Dokumenten-Pfad der Domain wird auf den Heimatpfad (+ Domain-Ordner, sofern aktiviert) des neuen Kunden gesetzt.', + ], + 'cron' => [ + 'debug' => [ + 'title' => 'Debuggen des Cronscripts', + 'description' => 'Wenn aktiviert, wird die Lockdatei nach dem Cronlauf zum Debuggen nicht gelöscht
Achtung: Eine alte Lockdatei kann weitere Cronjobs behindern und dafür sorgen, dass diese nicht vollständig ausgeführt werden.', + ], + ], + 'specialsettingsforsubdomains' => [ + 'description' => 'Wenn ja, werden die individuellen Einstellungen für alle Subdomains übernommen.
Wenn nein, werden Subdomain-Specialsettings entfernt.', + ], + 'panel_password_min_length' => [ + 'title' => 'Mindestlänge von Passwörtern', + 'description' => 'Hier können Sie die Mindestlänge für Passwörter festlegen. \'0\' bedeutet: Keine Mindestlänge', + ], + 'system_store_index_file_subs' => [ + 'title' => 'Erstelle Index-Datei auch in neuen Unterordnern', + 'description' => 'Wenn aktiviert, wird für jede Subdomain mit neuem Unterordner die Standard-Index Datei angelegt.', + ], + 'adminmail_return' => [ + 'title' => 'Antwort-Adresse', + 'description' => 'Standard-Antwort-Adresse für E-Mails aus dem Panel.', + ], + 'adminmail_defname' => 'Panel-Absender-Name', + 'stdsubdomainhost' => [ + 'title' => 'Kunden Standard-Subdomain', + 'description' => 'Welcher Hostname soll für das Erstellen der Kunden-Standard-Subdomain verwendet werden? Falls leer wird der System-Hostname verwendet.', + ], + 'awstats_path' => 'Pfad zu AWStats \'awstats_buildstaticpages.pl\'', + 'awstats_conf' => 'AWStats Konfigurations-Pfad', + 'defaultttl' => 'Domain TTL für Bind in Sekunden (default \'604800\' = 1 Woche)', + 'defaultwebsrverrhandler_enabled' => 'Verwende Standard-Fehlerdokumente für alle Kunden', + 'defaultwebsrverrhandler_err401' => [ + 'title' => 'Datei/URL für Fehler 401', + 'description' => '
Nicht unterstützt in: lighttpd
', + ], + 'defaultwebsrverrhandler_err403' => [ + 'title' => 'Datei/URL für Fehler 403', + 'description' => '
Nicht unterstützt in: lighttpd
', + ], + 'defaultwebsrverrhandler_err404' => 'Datei/URL für Fehler 404', + 'defaultwebsrverrhandler_err500' => [ + 'title' => 'Datei/URL für Fehler 500', + 'description' => '
Nicht unterstützt in: lighttpd
', + ], + 'ftpserver' => [ + 'desc' => 'Wenn pureftpd ausgewählt ist, werden die .ftpquota Dateien für das Quota erstellt und täglich aktualisiert.', + ], + 'customredirect_enabled' => [ + 'title' => 'Erlaube Kunden-Redirect', + 'description' => 'Erlaubt es Kunden den HTTP-Status Code für einen Redirect zu wählen', + ], + 'customredirect_default' => [ + 'title' => 'Standard-Redirect', + 'description' => 'Dieser Redirect wird immer genutzt, sofern der Kunde keinen anderen auswählt.', + ], + 'mail_also_with_mxservers' => 'Erstelle mail-, imap-, pop3- and smtp-"A Record" auch wenn MX-Server angegeben sind', + 'froxlordirectlyviahostname' => 'Froxlor direkt über den Hostnamen erreichbar machen', + 'panel_password_regex' => [ + 'title' => 'Regulärer Ausdruck für Passwörter', + 'description' => 'Hier können Sie einen regulären Ausdruck für Passwort-Komplexität festlegen.
Leer = keine bestimmten Anforderungen', + ], + 'perl_path' => [ + 'title' => 'Pfad zu Perl', + 'description' => 'Standard ist /usr/bin/perl', + ], + 'mod_fcgid_ownvhost' => [ + 'title' => 'Verwende FCGID im Froxlor-Vhost', + 'description' => 'Wenn verwendet, wird Froxlor selbst unter einem lokalen Benutzer ausgeführt', + ], + 'perl' => [ + 'suexecworkaround' => [ + 'title' => 'Aktiviere SuExec-Workaround', + 'description' => 'Aktivieren Sie den Workaround nur, wenn die Kunden-Heimatverzeichnisse sich nicht unterhalb des suexec-Pfades liegen.
Wenn aktiviert erstellt Froxlor eine Verknüpfung des vom Kunden für Perl aktiviertem Pfad + /cgi-bin/ im angegebenen suexec-Pfad.
Bitte beachten Sie, dass Perl dann nur im Unterordner /cgi-bin/ des Kunden-Ordners funktioniert und nicht direkt in diesem Ordner (wie es ohne den Workaround wäre!)', + ], + 'suexeccgipath' => [ + 'title' => 'Pfad für Verknüpfungen zu Kunden-Perl-Verzeichnis', + 'description' => 'Diese Einstellung wird nur benötigt, wenn der SuExec-Workaround aktiviert ist.
ACHTUNG: Stellen Sie sicher, dass sich der angegebene Pfad innerhalb des Suexec-Pfades befindet ansonsten ist der Workaround nutzlos', + ], + ], + 'awstats_awstatspath' => 'Pfad zu AWStats \'awstats.pl\'', + 'awstats_icons' => [ + 'title' => 'Pfad zum AWstats-Icon-Ordner', + 'description' => 'z. B. /usr/share/awstats/htdocs/icon/', + ], + 'login_domain_login' => 'Erlaube Anmeldung mit Domains', + 'perl_server' => [ + 'title' => 'Perl Server-Socket', + 'description' => 'Eine einfache Anleitung hier zu findet man unter nginx.com', + ], + 'nginx_php_backend' => [ + 'title' => 'Nginx-PHP-Backend', + 'description' => 'Dies ist das Backend, auf dem PHP auf Anfragen von Nginx hört. Kann ein UNIX Socket oder eine IP:Port Kombination sein
*NICHT relevant bei php-fpm', + ], + 'phpreload_command' => [ + 'title' => 'PHP-Reload-Befehl', + 'description' => 'Dieser wird benötigt, um das PHP-Backend bei Bedarf durch den Cronjob neu zu laden. (Standard: leer)
*NICHT relevant bei php-fpm', + ], + 'phpfpm' => [ + 'title' => 'Aktiviere PHP-FPM', + 'description' => 'Dies benötigt eine spezielle Webserver-Konfiguration, siehe PHP-FPM Handbuch', + ], + 'phpfpm_settings' => [ + 'configdir' => 'Pfad zu php-fpm-Konfigurationen', + 'aliasconfigdir' => 'Alias-Ordner der php-fpm Konfiguration', + 'reload' => 'Kommando zum Neustarten von php-fpm', + 'pm' => 'Prozess Manager Control (PM)', + 'max_children' => [ + 'title' => 'Anzahl der Kind-Prozesse', + 'description' => 'Die Anzahl der zu startenden Kind-Prozesse wenn PM auf \'static\' steht und die maximale Anzahl der Prozesse wenn PM auf \'dynamic/ondemand\' steht.
Equivalent zu PHP_FCGI_CHILDREN', + ], + 'start_servers' => [ + 'title' => 'Anzahl der beim Starten zu erstellenden Kind-Prozesse', + 'description' => 'Hinweis: Nur wenn PM auf \'dynamic\' steht', + ], + 'min_spare_servers' => [ + 'title' => 'Mindestanzahl der Idle-Prozesse', + 'description' => 'Hinweis: Nur wenn PM auf \'dynamic\' steht
Wichtig: Pflichtangabe wenn PM auf \'dynamic\' steht', + ], + 'max_spare_servers' => [ + 'title' => 'Maximale Anzahl der Idle-Prozesse', + 'description' => 'Hinweis: Nur wenn PM auf \'dynamic\' steht
Wichtig: Pflichtangabe wenn PM auf \'dynamic\' steht', + ], + 'max_requests' => [ + 'title' => 'Requests pro Kindprozess bevor Neuerstellung (respawning)', + 'description' => 'Für keine Begrenzung \'0\' angeben. Equivalent zu PHP_FCGI_MAX_REQUESTS.', + ], + 'idle_timeout' => [ + 'title' => 'Idle-Timeout', + 'description' => 'Timeout-Einstellung für PHP-FPM FastCGI.', + ], + 'ipcdir' => [ + 'title' => 'FastCGI IPC Verzeichnis', + 'description' => 'In dieses Verzeichnis werden die php-fpm Sockets vom Webserver abgelegt.
Das Verzeichnis muss für den Webserver lesbar sein.', + ], + 'limit_extensions' => [ + 'title' => 'Erlaubte Dateiendungen', + 'description' => 'Beschränkt die Dateierweiterungen des Haupt-Skripts, das FPM zu parsen erlaubt. Dies kann Konfigurationsfehler auf der Webserverseite verhindern. Sie sollten FPM nur auf .php Erweiterungen beschränken, um zu verhindern, dass bösartige Nutzter andere Erweiterungen verwenden, um PHP Code auszuführen. Standardwert: .php', + ], + 'envpath' => 'Pfade für die PATH Umgebungsvariable. Leerlassen, um keine PATH Umgebungsvariable zu setzen.', + 'override_fpmconfig' => 'Überschreibe FPM-Daemon Einstellungen (pm, max_children, etc.)', + 'override_fpmconfig_addinfo' => '
Nur verwendet wenn "Überschreibe FPM-Daemon Einstellungen" auf "Ja" gestellt ist', + 'restart_note' => 'Achtung: Der Code wird nicht auf Fehler geprüft. Bei etwaigen Fehlern könnte der PHP-FPM-Prozess nicht mehr starten!', + 'custom_config' => [ + 'title' => 'Benutzerdefinierte Konfiguration', + 'description' => 'Füge eine benutzerdefinierte Einstellungen zur PHP-FPM Instanz hinzu, beispielsweise pm.status_path = /status für Monitoring. Unten ersichtliche Variablen können verwendet werden. Achtung: Der Code wird nicht auf Fehler geprüft. Bei etwaigen Fehlern könnte der PHP-FPM-Prozess nicht mehr starten!', + ], + 'allow_all_customers' => [ + 'title' => 'Für aktuelle Kunden automatisch hinzufügen', + 'description' => 'Ist diese Einstellung aktiv, wird die Konfiguration automatisch allen aktuell existierenden Kunden-Accounts zugewiesen. Diese Einstellung ist nicht permanent, kann aber mehrfach / nach Bedarf ausgeführt werden.', + ], + ], + 'report' => [ + 'report' => 'Aktiviere das Senden von Reports über Webspace- und Trafficverbrauch', + 'webmax' => [ + 'title' => 'Warn-Level in Prozent für Webspace', + 'description' => 'Gültige Werte sind von 0 bis 150. Der Wert 0 deaktiviert diesen Report.', + ], + 'trafficmax' => [ + 'title' => 'Warn-Level in Prozent für Traffic', + 'description' => 'Gültige Werte sind von 0 bis 150. Der Wert 0 deaktiviert diesen Report.', + ], + ], + 'dropdown' => 'Auswahlliste', + 'manual' => 'Manuelle Eingabe', + 'default_theme' => 'Standard-Theme', + 'validate_domain' => 'Validiere Domainnamen', + 'diskquota_enabled' => 'Quota aktiviert?', + 'diskquota_repquota_path' => [ + 'description' => 'Pfad zu repquota', + ], + 'diskquota_quotatool_path' => [ + 'description' => 'Pfad zu quotatool', + ], + 'diskquota_customer_partition' => [ + 'description' => 'Partition, auf welcher die Kundendaten liegen', + ], + 'vmail_maildirname' => [ + 'title' => 'Maildir-(Unter-)Ordner', + 'description' => 'Der Maildir-Ordner innerhalb des Kontos des Benutzers (normalerweise \'Maildir\', in manchen Fällen auch \'.maildir\'). Sollen die E-Mails direkt in das Verzeichnis, diese Option leer lassen.', + ], + 'catchall_enabled' => [ + 'title' => 'Catchall verwenden', + 'description' => 'Möchten Sie Ihren Kunden die Funktion Catchall zur Verfügung stellen?', + ], + 'apache_24' => [ + 'title' => 'Anpassungen für Apache 2.4 verwenden', + 'description' => '
Achtung: Bitte nur verwenden, wenn wirklich Apache mit Version 2.4 oder höher installiert ist, ansonsten wird der Webserver nicht starten.
', + ], + 'nginx_fastcgiparams' => [ + 'title' => 'Pfad zur fastcgi_params Datei', + 'description' => 'Geben Sie den Pfad zu nginx\'s fastcgi_params Datei an. Inklusive Dateiname!', + ], + 'documentroot_use_default_value' => [ + 'title' => 'Verwende Domainnamen im Documentroot', + 'description' => 'Wenn aktiviert wird dem standard Documentroot zusätzlich der Domain-Name angehängt.

Beispiel:
/var/customers/customer_name/example.tld/
/var/customers/customer_name/subdomain.example.tld/', + ], + 'panel_phpconfigs_hidestdsubdomain' => [ + 'title' => 'Verstecke Standard-Subdomains in PHP-Konfigurations-Übersicht', + 'description' => 'Wenn aktiviert, werden die Standard-Subdomains der Kunden nicht mehr in der PHP-Konfigurations-Übersicht angezeigt.

Hinweis: Nur relevant, wenn FCGID oder PHP-FPM aktiviert ist.', + ], + 'passwordcryptfunc' => [ + 'title' => 'Wählen Sie die zu verwendende Passwort-Verschlüsselungsmethode', + ], + 'systemdefault' => 'Systemstandard', + 'panel_allow_theme_change_admin' => 'Erlaube Admins das Theme zu wechseln', + 'panel_allow_theme_change_customer' => 'Erlaube Kunden das Theme zu wechseln', + 'axfrservers' => [ + 'title' => 'AXFR Server', + 'description' => 'Eine durch Kommas getrennte Liste von IP Adressen, die DNS-Zonen transferieren dürfen (AXFR).', + ], + 'powerdns_mode' => [ + 'title' => 'PowerDNS Operation Mode', + 'description' => 'Wählen Sie den PowerDNS-Modus: Native für keine DNS-Replikation (Standard) / Master wenn eine DNS-Replikation benötigt wird.', + ], + 'customerssl_directory' => [ + 'title' => 'Webserver-Kunden-SSL-Zertifikatsverzeichnis', + 'description' => 'Wo sollen kundenspezifizierte SSL-Zertifikate erstellt werden?

ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.
', + ], + 'allow_error_report_admin' => [ + 'title' => 'Erlaube Administrator/Reseller das Melden von Datenbankfehlern an Froxlor', + 'description' => 'Bitte beachten: Senden Sie zu keiner Zeit irgendwelche datenschutzrelevanten/persönlichen (Kunden-)Daten an uns!', + ], + 'allow_error_report_customer' => [ + 'title' => 'Erlaube Kunden das Melden von Datenbankfehlern an Froxlor', + 'description' => 'Bitte beachten: Senden Sie zu keiner Zeit irgendwelche datenschutzrelevanten/persönlichen (Kunden-)Daten an uns!', + ], + 'mailtraffic_enabled' => [ + 'title' => 'Analysiere Mailtraffic', + 'description' => 'Aktiviere das Analysieren der Logdateien des Mailsystems, um den verbrauchten Traffic zu berechnen.', + ], + 'mdaserver' => [ + 'title' => 'Typ des MDA', + 'description' => 'Der eingesetzte Mail Delivery Server', + ], + 'mdalog' => [ + 'title' => 'Logdatei des MDA', + 'description' => 'Die Logdatei des Mail Delivery Server', + ], + 'mtaserver' => [ + 'title' => 'Typ des MTA', + 'description' => 'Der eingesetzte Mail Transfer Agent', + ], + 'mtalog' => [ + 'title' => 'Logdatei des MTA', + 'description' => 'Die Logdatei des Mail Transfer Agent', + ], + 'system_cronconfig' => [ + 'title' => 'Cron-Konfigurationsdatei', + 'description' => 'Pfad zur Konfigurationsdatei des Cron-Dienstes. Diese Datei wird von Froxlor automatisch aktualisiert.
Hinweis: Bitte verwenden Sie exakt die gleiche Datei wie für den Froxlor-Haupt-Cronjob (Standard: /etc/cron.d/froxlor)!

Wird FreeBSD verwendet, sollte hier /etc/crontab angegeben werden!', + ], + 'system_crondreload' => [ + 'title' => 'Cron-Daemon reload Befehl', + 'description' => 'Geben Sie hier den Befehl zum Neuladen des Cron-Daemons an', + ], + 'system_croncmdline' => [ + 'title' => 'Cron Startbefehl (php Programm)', + 'description' => 'Befehl zum Ausführen des Cronjobs. Ändern dieser Einstellung nur wenn nötig (Standard: "/usr/bin/nice -n 5 /usr/bin/php -q")!', + ], + 'system_cron_allowautoupdate' => [ + 'title' => 'Erlaube automatische Datenbank-Aktualisierungen', + 'description' => 'WARNUNG: Diese Einstellung erlaubt es dem Cronjob die Prüfung der Dateien- und Datenbank-Version zu umgehen und bei einem Versions-Unterschied die Datenbank-Aktualisierungen automatisiert auszuführen.

Das automatische Update setzt für neue Einstellungen und Änderungen immer die default-Werte. Diese müssen nicht zwingend zu dem genutzten System passen. Bitte zwei mal nachdenken, bevor diese Option aktiviert wird.
', + ], + 'dns_createhostnameentry' => 'Erstelle bind-Zone/Konfiguration für den System-Hostnamen', + 'panel_password_alpha_lower' => [ + 'title' => 'Kleinbuchstaben', + 'description' => 'Das Passwort muss mindestens einen Kleinbuchstaben (a-z) enthalten.', + ], + 'panel_password_alpha_upper' => [ + 'title' => 'Großbuchstaben', + 'description' => 'Das Passwort muss mindestens einen Großbuchstaben (A-Z) enthalten.', + ], + 'panel_password_numeric' => [ + 'title' => 'Zahlen', + 'description' => 'Das Passwort muss mindestens eine Zahl (0-9) enhalten.', + ], + 'panel_password_special_char_required' => [ + 'title' => 'Sonderzeichen', + 'description' => 'Das Passwort muss mindestens eines der untenstehenden Sonderzeichen enthalten', + ], + 'panel_password_special_char' => [ + 'title' => 'Sonderzeichen-Liste', + 'description' => 'Mindestens eines dieser Sonderzeichen muss in dem Passwort vorkommen, sofern die Sonderzeichen-Option aktiviert ist.', + ], + 'apache_itksupport' => [ + 'title' => 'Anpassungen für Apache ITK-MPM verwenden', + 'description' => '
Achtung: Bitte nur verwenden, wenn wirklich Apache itk-mpm verwendet wird, ansonsten wird der Webserver nicht starten.
', + ], + 'letsencryptca' => [ + 'title' => 'ACME Umgebung', + 'description' => 'Umgebung, welche genutzt wird um Zertifikate zu bestellen.', + ], + 'letsencryptcountrycode' => [ + 'title' => 'Let\'s Encrypt Ländercode', + 'description' => '2 - stelliger Ländercode, welcher benutzt wird um Let\'s Encrypt - Zertifikate zu bestellen.', + ], + 'letsencryptstate' => [ + 'title' => 'Let\'s Encrypt Bundesland', + 'description' => 'Bundesland, welches benutzt wird, um Let\'s Encrypt - Zertifikate zu bestellen.', + ], + 'letsencryptchallengepath' => [ + 'title' => 'Verzeichnis für Let\'s Encrypt challenges', + 'description' => 'Let\'s Encrypt challenges werden aus diesem Verzeichnis über einen globalen Alias ausgeliefert.', + ], + 'letsencryptkeysize' => [ + 'title' => 'Schlüsselgröße für neue Let\'s Encrypt Zertifikate', + 'description' => 'Größe des Schlüssels in Bit für neue Let\'s Encrypt Zertifikate.', + ], + 'letsencryptreuseold' => [ + 'title' => 'Let\'s Encrypt Schlüssel wiederverwenden', + 'description' => 'Wenn dies aktiviert ist, wird der alte Schlüssel bei jeder Verlängerung verwendet, andernfalls wird ein neues Paar generiert.', + ], + 'leenabled' => [ + 'title' => 'Let\'s Encrypt verwenden', + 'description' => 'Wenn dies aktiviert ist, können Kunden durch Froxlor automatisch generierte und verlängerbare Let\'s Encrypt SSL-Zertifikate für Domains mit SSL IP/Port nutzen.

Bitte die Webserver-Konfiguration beachten wenn aktiviert, da dieses Feature eine spezielle Konfiguration benötigt.', + ], + 'caa_entry' => [ + 'title' => 'CAA DNS Einträge generieren', + 'description' => 'Generiert CAA Einträge automatisch für alle Domains mit aktiviertem SSL und Let\'s Encrypt', + ], + 'caa_entry_custom' => [ + 'title' => 'Zusätzliche CAA DNS Einträge', + 'description' => 'DNS Certification Authority Authorization (CAA) verwendet das Domain Name System, um dem Besitzer einer Domain die Möglichkeit zu bieten, gewisse Zertifizierungsstellen (CAs) dazu zu berechtigen,
ein Zertifikat für die betroffene Domain auszustellen. CAA Records sollen verhindern, dass Zertifikate fälschlicherweise für eine Domain ausgestellt werden.

Der Inhalt dieses Feldes wird direkt in die DNS Zone übernommen (eine Zeile pro CAA Record). Wenn Let\'s Encrypt für eine Domain aktiviert wurde und die obige Option aktiviert wurde, wird immer automatisch dieser Eintrag angefügt und muss nicht selber angegeben werden:
0 issue "letsencrypt.org" (Wenn wildcard aktiviert ist, wird statdessen issuewild benutzt).
Um Incident Reporting per Mail zu aktivieren, muss eine iodef Zeile angefügt werden. Ein Beispiel für einen Report an me@example.com wäre:
0 iodef "mailto:me@example.com"

ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Die CAA finalen Einträge könnten daher falsch sein!', + ], + 'backupenabled' => [ + 'title' => 'Backup für Kunden aktivieren', + 'description' => 'Wenn dies aktiviert ist, kann der Kunde Sicherungen planen (cron-backup) welche ein Archiv in sein Heimatverzeichnis ablegt (Unterordner vom Kunden wählbar)', + ], + 'dnseditorenable' => [ + 'title' => 'DNS Editor aktivieren', + 'description' => 'Erlaubt es Admins und Kunden die DNS Einträge ihrer Domains zu verwalten.', + ], + 'dns_server' => [ + 'title' => 'DNS Server Dienst', + 'description' => 'Dienste müssen mit den froxlor Konfigurationstemplates konfiguriert werden', + ], + 'panel_customer_hide_options' => [ + 'title' => 'Menüpunkte und Traffic-Charts im Kundenbereich ausblenden', + 'description' => 'Wählen Sie hier die gewünschten Menüpunkte und Traffic-Charts aus, welche im Kundenbereich ausgeblendet werden sollen. Für Mehrfachauswahl, halten Sie während der Auswahl STRG gedrückt.', + ], + 'allow_allow_customer_shell' => [ + 'title' => 'Erlaube Kunden für FTP Benutzer eine Shell auszuwählen', + 'description' => 'Bitte beachten: Shell Zugriff gestattet dem Benutzer verschiedene Programme auf Ihrem System auszuführen. Mit großer Vorsicht verwenden. Bitte aktiviere dies nur wenn WIRKLICH bekannt ist, was das bedeutet!!!', + ], + 'available_shells' => [ + 'title' => 'Liste der verfügbaren Shells', + 'description' => 'Komma-getrennte Liste von Shells, die der Kunde für seine FTP-Konten wählen kann.

Hinweis: Die Standard-Shell /bin/false wird immer eine Auswahlmöglichkeit sein (wenn aktiviert), auch wenn diese Einstellung leer ist. Sie ist in jedem Fall der Standardwert für alle FTP-Konten', + ], + 'le_froxlor_enabled' => [ + 'title' => 'Let\'s Encrypt für den froxlor Vhost verwenden', + 'description' => 'Wenn dies aktiviert ist, erstellt froxlor für seinen vhost automatisch ein Let\'s Encrypt Zertifikat.', + ], + 'le_froxlor_redirect' => [ + 'title' => 'SSL-Weiterleitung für den froxlor Vhost aktivieren', + 'description' => 'Wenn dies aktiviert ist, werden alle HTTP Anfragen an die entsprechende SSL Seite weitergeleitet.', + ], + 'option_unavailable_websrv' => '
Nur verfügbar für: %s', + 'option_unavailable' => '
Option aufgrund anderer Einstellungen nicht verfügbar.', + 'letsencryptacmeconf' => [ + 'title' => 'Pfad zu acme.conf', + 'description' => 'Dateiname der Konfiguration, die dem Webserver erlaubt, die ACME-Challenges zu bedienen.', + ], + 'mail_use_smtp' => 'Nutze SMTP für das Senden von E-Mails', + 'mail_smtp_host' => 'SMTP Server', + 'mail_smtp_usetls' => 'Aktiviere TLS Verschlüsselung', + 'mail_smtp_auth' => 'Nutze SMTP Authentifizierung', + 'mail_smtp_port' => 'TCP Port für SMTP', + 'mail_smtp_user' => 'SMTP Benutzer', + 'mail_smtp_passwd' => 'SMTP Passwort', + 'http2_support' => [ + 'title' => 'HTTP2 Unterstützung', + 'description' => 'Aktiviere HTTP2 Unterstützung für SSL.
NUR AKTIVIEREN, WENN DER WEBSERVER DIESE FUNKTION UNTERSTÜTZT (nginx version 1.9.5+, apache2 version 2.4.17+)', + ], + 'nssextrausers' => [ + 'title' => 'Verwende libnss-extrausers anstatt libnss-mysql', + 'description' => 'Lese Benutzer nicht direkt aus der Datenbank sondern über Dateien. Bitte nur aktivieren, wenn die entsprechende Konfiguration vorgenommen wurde (System -> libnss-extrausers).
Nur für Debian/Ubuntu (oder wenn libnss-extrausers manuell kompiliert wurde!)', + ], + 'le_domain_dnscheck' => [ + 'title' => 'Validiere DNS der Domains wenn Let\'s Encrypt genutzt wird', + 'description' => 'Wenn aktiviert wird froxlor überprüfen ob die DNS Einträge der Domains, welche ein Let\'s Encrypt Zertifikat beantragt, mindestens auf eine der System IP Adressen auflöst.', + ], + 'phpsettingsforsubdomains' => [ + 'description' => 'Wenn ja, wird die gewählte PHP-Config für alle Subdomains übernommen', + ], + 'leapiversion' => [ + 'title' => 'Wählen Sie die Let\'s Encrypt ACME Implementierung', + 'description' => 'Aktuell unterstützt froxlor lediglich die ACME v2 Implementierung von Let\'s Encrypt.', + ], + 'enable_api' => [ + 'title' => 'Aktiviere externe API Nutzung', + 'description' => 'Um die froxlor API nutzen zu können, muss diese Option aktiviert sein. Für detaillierte Informationen siehe https://docs.froxlor.org/', + ], + 'dhparams_file' => [ + 'title' => 'DHParams Datei (Diffie–Hellman key exchange)', + 'description' => 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.
Beispiel: /etc/ssl/webserver/dhparams.pem

Existiert die Datei nicht, wird sie wie folgt erstellt: openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.', + ], + 'errorlog_level' => [ + 'title' => 'Ausführlichkeit des Fehlerprotokolls', + 'description' => 'Steuert die Ausführlichkeit des Fehlerprotokolls. Voreinstellung ist "warn" bei Apache und "error" bei Nginx.', + ], + 'letsencryptecc' => [ + 'title' => 'ECC / ECDSA Zertifikate ausstellen', + 'description' => 'Wenn eine Schlüsselgröße ausgewählt wird, werden ECC / ECDSA Zertifikate erstellt', + ], + 'froxloraliases' => [ + 'title' => 'Domain Aliase für Froxlor Vhost', + 'description' => 'Komma getrennte Liste von Domains, welche als Server Alias zum Froxlor Vhost hinzugefügt werden', + ], + 'default_sslvhostconf' => [ + 'title' => 'Standard SSL vHost-Einstellungen', + ], + 'includedefault_sslvhostconf' => 'Nicht-SSL vHost-Einstellungen in SSL-vHost inkludieren', + 'apply_specialsettings_default' => [ + 'title' => 'Standardwert für "Übernehme Einstellungen für alle Subdomains (*.beispiel.de)\' Einstellung beim Bearbeiten einer Domain', + ], + 'apply_phpconfigs_default' => [ + 'title' => 'Standardwert für "PHP-Config für alle Subdomains übernehmen:\' Einstellung beim Bearbeiten einer Domain', + ], + 'awstats' => [ + 'logformat' => [ + 'title' => 'LogFormat Einstellung', + 'description' => 'Wenn ein benutzerdefiniertes LogFormat beim Webserver verwendet wird, muss LogFormat von awstats ebenso angepasst werden.
Standard ist 1. Für weitere Informationen siehe Dokumentation unter hier.', + ], + ], + 'hide_incompatible_settings' => 'Inkompatible Einstellungen ausblenden', + 'soaemail' => 'Mail-Adresse für SOA-Einträge (verwendet Panel-Absender-Name der Panel-Einstellungen falls leer)', + 'imprint_url' => [ + 'title' => 'URL zum Impressum', + 'description' => 'Die URL zur Impressums-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.', + ], + 'terms_url' => [ + 'title' => 'URL zu den AGB', + 'description' => 'Die URL zur AGB-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.', + ], + 'privacy_url' => [ + 'title' => 'URL zur Datenschutzerklärung', + 'description' => 'Die URL zur Datenschutzerklärungs-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.', + ], + 'logo_image_header' => [ + 'title' => 'Logo Bild (Header)', + 'description' => 'Das hochgeladene Bild wird als Logo oben links nach dem Login angezeigt (empfohlene Höhe sind 30px)', + ], + 'logo_image_login' => [ + 'title' => 'Logo Bild (Login)', + 'description' => 'Das hochgeladene Bild wird als Logo während des Logins angezeigt', + ], + 'logo_overridetheme' => [ + 'title' => 'Überschreibe Theme-Logo mit "Logo Bild" (Header und Login, siehe unten)', + 'description' => 'Ist die Nutzung eines hochgeladenen Logos gewünscht, muss diese Einstellung auf "Ja" gesetzt werden. Alternativ kann weiterhin das Theme-basierte Überschreiben via "logo_custom.png" und "logo_custom_login.png" genutzt werden.', + ], + 'logo_overridecustom' => [ + 'title' => 'Überschreibe benutzerdefinierte Theme-Logos (logo_custom.png und logo_custom_login.png) mit "Logo Bold" (Header und Login, siehe unten)', + 'description' => 'Ist diese Einstellung aktiv, werden benutzerdefinierte Logos im Theme-Ordner mit dem "Logo Bild" ersetzt', + ], + 'createstdsubdom_default' => [ + 'title' => 'Standardwert für "Standardsubdomain anlegen" bei Erstellung eines Kunden', + ], + 'froxlorusergroup' => [ + 'title' => 'Benutzerdefinierte Gruppe für alle Kunden-Benutzer', + 'description' => 'Voraussetzung hierfür ist die Nutzung von libnss-extrausers (System-Einstellungen). Ein leerer Wert bedeutet, es wird keine Gruppe erstellt, bzw. vorhandene Gruppe wird entfernt.', + ], + 'acmeshpath' => [ + 'title' => 'Pfad zu acme.sh', + 'description' => 'Installationspfad zu acme.sh, inklusive acme.sh Script
Standard ist /root/.acme.sh/acme.sh', + ], + ], + 'spf' => [ + 'use_spf' => 'Aktiviere SPF für Domains?', + 'spf_entry' => 'SPF-Eintrag für alle Domains', + ], + 'success' => [ + 'messages_success' => 'Nachricht erfolgreich an "%s" Empfänger gesendet', + 'success' => 'Information', + 'clickheretocontinue' => 'Hier klicken, um fortzufahren', + 'settingssaved' => 'Die Einstellungen wurden erfolgreich gespeichert.', + 'rebuildingconfigs' => 'Task für Neuerstellung der Konfigurationen wurde erfolgreich eingetragen', + 'domain_import_successfully' => 'Erfolgreich %s Domains importiert.', + 'backupscheduled' => 'Ihre Sicherung wurde erfolgreich geplant. Bitte warten Sie nun, bis diese abgearbeitet wurde.', + 'backupaborted' => 'Die geplante Sicherung wurde abgebrochen', + 'dns_record_added' => 'Eintrag erfolgreich hinzugefügt', + 'dns_record_deleted' => 'Eintrag erfolgreich entfernt', + 'testmailsent' => 'Test E-Mail erfolgreich gesendet', + 'settingsimported' => 'Einstellungnen erfolgreich importiert', + ], + 'tasks' => [ + 'outstanding_tasks' => 'Ausstehende Cron-Aufgaben', + 'REBUILD_VHOST' => 'Neuerstellung der Webserver-Konfiguration', + 'CREATE_HOME' => 'Erstelle neuen Kunden %loginname%', + 'REBUILD_DNS' => 'Neuerstellung der Bind-Konfiguration', + 'CREATE_FTP' => 'Erstelle Verzeichnis für neuen FTP-Benutzer', + 'DELETE_CUSTOMER_FILES' => 'Löschen von Kunden-Dateien %loginname%', + 'noneoutstanding' => 'Zur Zeit gibt es keine ausstehenden Aufgaben für Froxlor', + 'CREATE_QUOTA' => 'Quota auf dem Dateisystem setzen', + 'DELETE_EMAIL_DATA' => 'E-Mail-Dateien des Kunden löschen', + 'DELETE_FTP_DATA' => 'Kunden FTP-Konto Dateien löschen', + 'REBUILD_CRON' => 'Neuerstellung der cron.d-Datei', + 'CREATE_CUSTOMER_BACKUP' => 'Datensicherung für Kunde %loginname%', + 'DELETE_DOMAIN_PDNS' => 'Lösche Domain %domain% von PowerDNS Datenbank', + 'DELETE_DOMAIN_SSL' => 'Lösche SSL Dateien von Domain %domain%', + ], + 'terms' => 'AGB', + 'traffic' => [ + 'month' => 'Monat', + 'months' => [ + 1 => 'Januar', + 2 => 'Februar', + 3 => 'März', + 4 => 'April', + 5 => 'Mai', + 6 => 'Juni', + 7 => 'Juli', + 8 => 'August', + 9 => 'September', + 10 => 'Oktober', + 11 => 'November', + 12 => 'Dezember', + 'jan' => 'Jan', + 'feb' => 'Feb', + 'mar' => 'Mär', + 'apr' => 'Apr', + 'may' => 'Mai', + 'jun' => 'Jun', + 'jul' => 'Jul', + 'aug' => 'Aug', + 'sep' => 'Sep', + 'oct' => 'Okt', + 'nov' => 'Nov', + 'dec' => 'Dez', + 'total' => 'Gesamt', + ], + 'mb' => 'Traffic', + 'day' => 'Tag', + 'distribution' => 'FTP | HTTP | Mail', + 'sumhttp' => 'Gesamt HTTP-Traffic', + 'sumftp' => 'Gesamt FTP-Traffic', + 'summail' => 'Gesamt Mail-Traffic', + 'customer' => 'Kunde', + 'trafficoverview' => 'Übersicht Traffic je', + 'details' => 'Details', + 'http' => 'HTTP', + 'ftp' => 'FTP', + 'mail' => 'Mail', + ], + 'translator' => '', + 'update' => [ + 'updateinprogress_onlyadmincanlogin' => 'Eine neuere Version von Froxlor wurde installiert, aber noch nicht eingerichtet.
Nur der Administrator kann sich anmelden und die Aktualisierung abschließen.', + 'update' => 'Froxlor Aktualisierung', + 'proceed' => 'Ausführen', + 'update_information' => [ + 'part_a' => 'Die Froxlor-Dateien wurden aktualisiert. Neue Version ist %newversion. Die bisher installierte Version ist %curversion', + 'part_b' => '

Ein Kunden-Login ist vor Abschluss des Aktualisierungsvorganges nicht möglich.
Aktualisierung ausführen?', + ], + 'noupdatesavail' => 'Ihre Froxlor-Version ist aktuell.', + 'description' => 'Aktualisierung der froxlor Datenbank', + ], + 'usersettings' => [ + 'custom_notes' => [ + 'title' => 'Eigene Notizen', + 'description' => 'Hier können Notizen je nach Lust und Laune eingetragen werden. Diese werden in der Administrator/Kunden-Übersicht bei dem jeweiligen Benutzer angezeigt.', + 'show' => 'Zeige die Notizen auf dem Dashboard des Benutzers', + ], + 'api_allowed' => [ + 'title' => 'Erlaube API Zugriff', + 'description' => 'Wenn in den Einstellungen aktiviert, kann der Benutzer API Schlüssel erstellen und auf die froxlor API Zugreifen', + 'notice' => 'API Zugriff ist für dieses Konto deaktiviert.', + ], + ], +]; diff --git a/lng/dutch.lng.php b/lng/dutch.lng.php deleted file mode 100644 index cb14d9fc..00000000 --- a/lng/dutch.lng.php +++ /dev/null @@ -1,1103 +0,0 @@ - - * @author Frits Letteboer - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Global - */ -$lng['translator'] = 'Sander Klein/Frits Letteboer'; -$lng['panel']['edit'] = 'bewerken'; -$lng['panel']['delete'] = 'verwijderen'; -$lng['panel']['create'] = 'nieuw'; -$lng['panel']['save'] = 'opslaan'; -$lng['panel']['yes'] = 'ja'; -$lng['panel']['no'] = 'nee'; -$lng['panel']['emptyfornochanges'] = 'leeg laten voor huidige instelling'; -$lng['panel']['emptyfordefault'] = 'leeg laten voor de standaard instellingen'; -$lng['panel']['path'] = 'Pad'; -$lng['panel']['toggle'] = 'In- of uitschalen'; -$lng['panel']['next'] = 'volgende'; -$lng['panel']['dirsmissing'] = 'Kan de map niet lezen of vinden!'; - -/** - * Login - */ - -$lng['login']['username'] = 'Gebruikersnaam'; -$lng['login']['password'] = 'Wachtwoord'; -$lng['login']['language'] = 'Taal'; -$lng['login']['login'] = 'Inloggen'; -$lng['login']['logout'] = 'Uitloggen'; -$lng['login']['profile_lng'] = 'Profiel taal'; - -/** - * Customer - */ - -$lng['customer']['name'] = 'Naam'; -$lng['customer']['firstname'] = 'Voornaam'; -$lng['customer']['company'] = 'Bedrijfsnaam'; -$lng['customer']['street'] = 'Straat'; -$lng['customer']['zipcode'] = 'Postcode'; -$lng['customer']['city'] = 'Plaats'; -$lng['customer']['phone'] = 'Telefoonnummer'; -$lng['customer']['fax'] = 'Faxnummer'; -$lng['customer']['email'] = 'Email'; -$lng['customer']['customernumber'] = 'Klant ID'; -$lng['customer']['diskspace'] = 'Webruimte (MB)'; -$lng['customer']['traffic'] = 'Verkeer (GB)'; -$lng['customer']['emails'] = 'E-mail-Adressen'; -$lng['customer']['subdomains'] = 'Sub-Domein(en)'; -$lng['customer']['domains'] = 'Domein(en)'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Main'; -$lng['menue']['main']['changepassword'] = 'Wijzig wachtwoord'; -$lng['menue']['main']['changelanguage'] = 'Wijzig taal'; -$lng['menue']['email']['emails'] = 'Adressen'; -$lng['menue']['domains']['domains'] = 'Domeinen'; -$lng['menue']['domains']['settings'] = 'Instellingen'; -$lng['menue']['extras']['directoryprotection'] = 'Map beveiliging'; -$lng['menue']['extras']['pathoptions'] = 'pad opties'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Klant Details'; -$lng['index']['accountdetails'] = 'Account Details'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Oud wachtwoord'; -$lng['changepassword']['new_password'] = 'Nieuw wachtwoord'; -$lng['changepassword']['new_password_confirm'] = 'Nieuw wachtwoord (bevestigen)'; -$lng['changepassword']['new_password_ifnotempty'] = 'Nieuw wachtwoord (leeg = niet veranderen)'; -$lng['changepassword']['also_change_ftp'] = ' wijzig ook het wachtwoord van het hoofd FTP account'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Hier kunt u nieuwe (sub-) domeinen maken en de paden aanpassen.
Het systeem heeft een paar minuten nodig om de wijzigingen door te voeren na iedere varandering.'; -$lng['domains']['domainsettings'] = 'Domein instellingen'; -$lng['domains']['domainname'] = 'Domeinnaam'; -$lng['domains']['subdomain_add'] = 'Maak subdomein'; -$lng['domains']['subdomain_edit'] = 'Bewerk (sub)domein'; -$lng['domains']['wildcarddomain'] = 'Maak als wildcarddomein?'; -$lng['domains']['aliasdomain'] = 'Alias voor domein'; -$lng['domains']['noaliasdomain'] = 'Geen alias domein'; - -/** - * E-mails - */ - -$lng['emails']['description'] = 'Hier kunt u e-mail adressen maken en wijzigen.
Een account is net als een brievenbus voor uw huis. Als iemand u mail stuurt wordt dit op uw account bezorgd.

Om uw emails te downloaden moet u het volgende instellen in uw mailprogramma: (De schuingedrukte gegevens moeten gewijzigd worden in wat u ingegeven heeft!)
Servernaam: Domeinnaam
Gebruikersnaam: Account naam / E-mailadres
Wachtwoord: het door u ingegeven wachtwoord'; -$lng['emails']['emailaddress'] = 'E-mailadres'; -$lng['emails']['emails_add'] = 'Maak nieuw e-mailadres'; -$lng['emails']['emails_edit'] = 'Bewerk e-mailadres'; -$lng['emails']['catchall'] = 'Catchall'; -$lng['emails']['iscatchall'] = 'Definieer als catchall-adres?'; -$lng['emails']['account_add'] = 'Maak nieuw account'; -$lng['emails']['account_delete'] = 'Verwijder account'; -$lng['emails']['from'] = 'Van'; -$lng['emails']['to'] = 'Aan'; -$lng['emails']['forwarder_add'] = 'Maak forwarder'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Hier kunt u nieuwe FTP accounts maken of bestaande accounts wijzigen.
De wijzigingen worden direct doorgevoerd en het account kan direct gebruikt worden.'; -$lng['ftp']['account_add'] = 'Maak nieuw account'; - -/** - * MySQL - */ - -$lng['mysql']['databasename'] = 'gebruiker/database naam'; -$lng['mysql']['databasedescription'] = 'database omschrijving'; -$lng['mysql']['database_create'] = 'Maak database'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Hier kunt u wat extra instellingen doen zoals map beveiliging.
Het systeem heeft enkele minuten nodig om elke wijziging door te voeren.'; -$lng['extras']['directoryprotection_add'] = 'Map beveiliging toevoegen'; -$lng['extras']['view_directory'] = 'map inhoud laten zien'; -$lng['extras']['pathoptions_add'] = 'Pad opties toevoegen'; -$lng['extras']['directory_browsing'] = 'map inhoud browsen'; -$lng['extras']['pathoptions_edit'] = 'Pad opties bewerken'; -$lng['extras']['errordocument404path'] = 'URL naar Foutdocument 404'; -$lng['extras']['errordocument403path'] = 'URL naar Foutdocument 403'; -$lng['extras']['errordocument500path'] = 'URL naar Foutdocument 500'; -$lng['extras']['errordocument401path'] = 'URL naar Foutducument 401'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Fout'; -$lng['error']['directorymustexist'] = 'De map %s bestaat niet. Maak hem eerst aan met uw FTP client.'; -$lng['error']['filemustexist'] = 'Het bestand %s bestaat niet.'; -$lng['error']['allresourcesused'] = 'U heeft al uw resources al gebruikt.'; -$lng['error']['domains_cantdeletemaindomain'] = 'U kunt een domein dat gebruikt wordt als email-domein niet verwijderen.'; -$lng['error']['domains_canteditdomain'] = 'U kunt dit domein niet aanpassen. Dit is door de admin onbruikbaar gemaakt.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'U kunt een domein dat gebruikt wordt als email-domein niet verwijderen. Verwijder eerst alle e-mail adressen.'; -$lng['error']['firstdeleteallsubdomains'] = 'U moet eerst alle subdomeinen verwijderen voor u een wildcard domein kunt maken.'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'U heeft al een catchall voor dit domein aangemaakt.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'U kunt uw hoofd FTP account niet verwijderen'; -$lng['error']['login'] = 'De door u ingegeven gebruikersnaam en wachtwoord zijn verkeerd. Probeer opnieuw!'; -$lng['error']['login_blocked'] = 'Dit account is inactief vanwege teveel login fouten.
Probeer het nog eens over %s seconden.'; -$lng['error']['notallreqfieldsorerrors'] = 'U heeft niet alle velden goed, of helemaal niet ingevuld.'; -$lng['error']['oldpasswordnotcorrect'] = 'Het oude wachtwoord is niet correct.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'U kunt niet meer resources gebruiken dan die u bezit.'; -$lng['error']['mustbeurl'] = 'U heeft geen goed of compleet URL ingegeven (bijv. http://eenserver.com/error404.htm)'; -$lng['error']['invalidpath'] = 'U heeft geen goed URL ingegeven (misschien een probleem met dirlisting?)'; -$lng['error']['stringisempty'] = 'Geen waarde in invoerveld'; -$lng['error']['stringiswrong'] = 'Verkeerde waarde in invoerveld'; -$lng['error']['newpasswordconfirmerror'] = 'Het nieuwe wachtwoord en de bevestiging zijn niet gelijk'; -$lng['error']['loginnameexists'] = 'Loginnaam %s bestaat al'; -$lng['error']['emailiswrong'] = 'E-mailadres %s bevat illegale karakters of is niet compleet'; -$lng['error']['loginnameiswrong'] = 'Loginnaam %s bevat illegale karakters'; -$lng['error']['userpathcombinationdupe'] = 'Combinatie van Gebruikersnaam en Pad bestaat reeds'; -$lng['error']['patherror'] = 'Generale Fou! Pad kan niet leeg zijn'; -$lng['error']['errordocpathdupe'] = 'Optie voor pad %s bestaat reeds'; -$lng['error']['adduserfirst'] = 'Maak klant eerst aan, aub'; -$lng['error']['domainalreadyexists'] = 'Het domein %s is al aan een klant toegewezen'; -$lng['error']['nolanguageselect'] = 'Geen taal geselecteerd.'; -$lng['error']['nosubjectcreate'] = 'U moet een onderwerp ingeven voor dit e-mail sjabloon.'; -$lng['error']['nomailbodycreate'] = 'U moet een tekst ingeven voor dit e-mail sjabloon.'; -$lng['error']['templatenotfound'] = 'Sjabloon niet gevonden.'; -$lng['error']['alltemplatesdefined'] = 'U kunt niet meer sjablonen definiëren, alle talen worden al ondersteund.'; -$lng['error']['wwwnotallowed'] = 'www is niet toegestaan voor subdomeinen.'; -$lng['error']['subdomainiswrong'] = 'Het subdomein %s bevat illegale karakters.'; -$lng['error']['domaincantbeempty'] = 'De domeinnaam kan niet leeg zijn.'; -$lng['error']['domainexistalready'] = 'Het domein %s bestaat reeds.'; -$lng['error']['domainisaliasorothercustomer'] = 'Het geselecteerde alias domein verwijst naar zichzelf of is van een andere gebruiker.'; -$lng['error']['emailexistalready'] = 'Het e-mail adres %s bestaat reeds.'; -$lng['error']['maindomainnonexist'] = 'Het hoofd-domein %s bestaat niet.'; -$lng['error']['destinationnonexist'] = 'Maak uw forwarder in het veld \'Destination\' alstublieft.'; -$lng['error']['destinationalreadyexistasmail'] = 'De forwarder naar %s bestaat reeds als actief e-mail adres.'; -$lng['error']['destinationalreadyexist'] = 'U heeft al een forwarder die verwijst naar %s .'; -$lng['error']['destinationiswrong'] = 'De forwarder naar %s bevat illegale karakter(s) of is niet compleet.'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Beveiligingsvraag'; -$lng['question']['admin_customer_reallydelete'] = 'Weet u zeker dat u de klant %s wilt verwijderen? Dit kan niet ongedaan worden gemaakt!'; -$lng['question']['admin_domain_reallydelete'] = 'Weet u zeker dat u het domein %s wilt verwijderen?'; -$lng['question']['admin_domain_reallydisablesecuritysetting'] = 'Weet u echt heel zeker dat deze beveiligingsinstellingen wilt deactiveren (OpenBasedir)?'; -$lng['question']['admin_admin_reallydelete'] = 'Weet u zeker dat u de admin %s verwijderen wilt? Iedere klant en domein zal worden toegewezen aan de hoofd administrator.'; -$lng['question']['admin_template_reallydelete'] = 'Weet u zeker dat u het sjabloon \'%s\' verwijderen wilt?'; -$lng['question']['domains_reallydelete'] = 'Weet u zeker dat u het domein %s verwijderen wilt?'; -$lng['question']['email_reallydelete'] = 'Weet u zeker dat u het e-mail adres %s verwijderen wilt?'; -$lng['question']['email_reallydelete_account'] = 'Weet u zeker dat het e-mail account van %s verwijderen wilt?'; -$lng['question']['email_reallydelete_forwarder'] = 'Weet u zeker dat u de forwarder %s verwijderen wilt?'; -$lng['question']['extras_reallydelete'] = 'Weet u zeker dat u de map beveiliging voor de map %s verwijderen wilt?'; -$lng['question']['extras_reallydelete_pathoptions'] = 'Weet u zeker dat u de pad-opties voor %s verwijderen wilt?'; -$lng['question']['ftp_reallydelete'] = 'Weet u zeker dat u het FTP account %s verwijderen wilt?'; -$lng['question']['mysql_reallydelete'] = 'Weet u zeker dat u de database %s verwijderen wilt? Dit kan niet ongedaan gemaakt worden!'; -$lng['question']['admin_configs_reallyrebuild'] = 'Weet u zeker dat u de configuratie bestanden voor Apache en Bind opnieuw wilt opbouwen?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['mailbody'] = 'Hallo,\n\nUw mail account {EMAIL}\nis succesvol aangemaakt.\n\nDit is een automatisch verstuurde\ne-mail, beantwoord deze niet AUB!\n\nMet vriendelijke groet, uw beheerder'; -$lng['mails']['pop_success']['subject'] = 'Mail account succesvol aangemaakt'; -$lng['mails']['createcustomer']['mailbody'] = 'Hallo {FIRSTNAME} {NAME},\n\nhierbij uw account informatie:\n\nGebruikersnaam: {USERNAME}\nWachtwoord: {PASSWORD}\n\nMet vriendelijke groet,\nuw beheerder'; -$lng['mails']['createcustomer']['subject'] = 'Account informatie'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Overzicht'; -$lng['admin']['ressourcedetails'] = 'Gebruikte resources'; -$lng['admin']['systemdetails'] = 'Systeem Details'; -$lng['admin']['installedversion'] = 'Geïnstalleerde Versie'; -$lng['admin']['latestversion'] = 'Laatste Versie'; -$lng['admin']['lookfornewversion']['clickhere'] = 'zoeken via webservice'; -$lng['admin']['lookfornewversion']['error'] = 'Fout tijdens lezen'; -$lng['admin']['customer'] = 'Klant'; -$lng['admin']['customers'] = 'Klanten'; -$lng['admin']['customer_add'] = 'Maak klant'; -$lng['admin']['customer_edit'] = 'Bewerk klant'; -$lng['admin']['domains'] = 'Domeinen'; -$lng['admin']['domain_add'] = 'Maak domein'; -$lng['admin']['domain_edit'] = 'Bewerk domein'; -$lng['admin']['subdomainforemail'] = 'Subdomein als emaildomein'; -$lng['admin']['admin'] = 'Beheerder'; -$lng['admin']['admins'] = 'Beheerders'; -$lng['admin']['admin_add'] = 'Maak beheerder'; -$lng['admin']['admin_edit'] = 'Bewerk beheerder'; -$lng['admin']['customers_see_all'] = 'Kan alle klanten zien?'; -$lng['admin']['domains_see_all'] = 'Kan alle domeinen zien?'; -$lng['admin']['change_serversettings'] = 'Kan server instellingen aanpassen?'; -$lng['admin']['serversettings'] = 'Instellingen'; -$lng['admin']['rebuildconf'] = 'Configuratie bestanden opnieuw aanmaken'; -$lng['admin']['stdsubdomain'] = 'Standaard subdomein'; -$lng['admin']['stdsubdomain_add'] = 'Maak standard subdomein'; -$lng['admin']['deactivated'] = 'Gedeactiveerd'; -$lng['admin']['deactivated_user'] = 'Gebruiker deactiveren'; -$lng['admin']['sendpassword'] = 'Verstuur wachtwoord'; -$lng['admin']['ownvhostsettings'] = 'Eigen vHost-Instellingen'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Configuratie'; -$lng['admin']['templates']['templates'] = 'Sjablonen'; -$lng['admin']['templates']['template_add'] = 'Maak sjabloon'; -$lng['admin']['templates']['template_edit'] = 'Bewerk sjabloon'; -$lng['admin']['templates']['action'] = 'Actie'; -$lng['admin']['templates']['email'] = 'E-Mail'; -$lng['admin']['templates']['subject'] = 'Onderwerp'; -$lng['admin']['templates']['mailbody'] = 'Mail inhoud'; -$lng['admin']['templates']['createcustomer'] = 'Welkomst bericht voor nieuwe klanten'; -$lng['admin']['templates']['pop_success'] = 'Welkomst bericht voor e-mail nieuw account'; -$lng['admin']['templates']['template_replace_vars'] = 'Variabelen die aangepast worden in het sjabloon:'; -$lng['admin']['templates']['FIRSTNAME'] = 'Vervangen door de voornaam van de klant.'; -$lng['admin']['templates']['NAME'] = 'Vervangen door de naam van de klant.'; -$lng['admin']['templates']['USERNAME'] = 'Vervangen door de gebruikersnaam van de klant.'; -$lng['admin']['templates']['PASSWORD'] = 'Vervangen door het wachtwoord van de klant.'; -$lng['admin']['templates']['EMAIL'] = 'Vervangen door het adres van het POP3/IMAP account.'; - -/** - * Serversettings - */ - -$lng['serversettings']['session_timeout']['title'] = 'Sessie Timeout'; -$lng['serversettings']['session_timeout']['description'] = 'Hoe lang moet een gebruiker inactief zijn voor dat de sessie ongeldig wordt (seconden)?'; -$lng['serversettings']['accountprefix']['title'] = 'Klant Voorvoegsel'; -$lng['serversettings']['accountprefix']['description'] = 'Welk voorvoegsel moet een klant account hebben?'; -$lng['serversettings']['mysqlprefix']['title'] = 'SQL Voorvoegsel'; -$lng['serversettings']['mysqlprefix']['description'] = 'Welk voorvoegsel moet een mysql account hebben?'; -$lng['serversettings']['ftpprefix']['title'] = 'FTP Voorvoegsel'; -$lng['serversettings']['ftpprefix']['description'] = 'Welk voorvoegsel moet een FTP account hebben?'; -$lng['serversettings']['documentroot_prefix']['title'] = 'Document map'; -$lng['serversettings']['documentroot_prefix']['description'] = 'Waar zullen alle gegeven opgeslagen worden?'; -$lng['serversettings']['logfiles_directory']['title'] = 'Logfiles map'; -$lng['serversettings']['logfiles_directory']['description'] = 'Waar zullen alle log-file opgeslagen worden?'; -$lng['serversettings']['ipaddress']['title'] = 'IP-Adres'; -$lng['serversettings']['ipaddress']['description'] = 'Wat is het IP-adres van deze server?'; -$lng['serversettings']['hostname']['title'] = 'Hostnaam'; -$lng['serversettings']['hostname']['description'] = 'Wat is de hostnaam van deze server?'; -$lng['serversettings']['apachereload_command']['title'] = 'Apache reload commando'; -$lng['serversettings']['apachereload_command']['description'] = 'Wat is het commando op apache te herladen?'; -$lng['serversettings']['bindconf_directory']['title'] = 'Bind configuratie map'; -$lng['serversettings']['bindconf_directory']['description'] = 'Waar staan de bind configuratie bestanden?'; -$lng['serversettings']['bindreload_command']['title'] = 'Bind reload commando'; -$lng['serversettings']['bindreload_command']['description'] = 'Wat is het command om bind te herladen?'; -$lng['serversettings']['vmail_uid']['title'] = 'Mails-Uid'; -$lng['serversettings']['vmail_uid']['description'] = 'Welk UserID moeten de e-mails hebben?'; -$lng['serversettings']['vmail_gid']['title'] = 'Mails-Gid'; -$lng['serversettings']['vmail_gid']['description'] = 'Welke GroupID moeten e-mails hebben?'; -$lng['serversettings']['vmail_homedir']['title'] = 'Mails-Homedir'; -$lng['serversettings']['vmail_homedir']['description'] = 'Waar moeten alle e-mail opgeslagen worden?'; -$lng['serversettings']['adminmail']['title'] = 'Afzender'; -$lng['serversettings']['adminmail']['description'] = 'Wat is de afzender voor e-mail verstuurd vanuit het Panel?'; -$lng['serversettings']['phpmyadmin_url']['title'] = 'phpMyAdmin URL'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'Wat is de URL die verwijst naar phpMyAdmin? (moet beginnen met http://)'; -$lng['serversettings']['webmail_url']['title'] = 'WebMail URL'; -$lng['serversettings']['webmail_url']['description'] = 'Wat is de URL die verwijst naar WebMail? (moet beginnen met http://)'; -$lng['serversettings']['webftp_url']['title'] = 'WebFTP URL'; -$lng['serversettings']['webftp_url']['description'] = 'Wat is de URL die verwijst naar WebFTP? (moet beginnen met http://)'; -$lng['serversettings']['language']['description'] = 'Wat is uw standaard server taal?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Maximaal aantal inlog pogingen'; -$lng['serversettings']['maxloginattempts']['description'] = 'Maximaal aantal inlog pogingen voor het account gedeactiveerd wordt.'; -$lng['serversettings']['deactivatetime']['title'] = 'Deactiveringstijd'; -$lng['serversettings']['deactivatetime']['description'] = 'Tijd (in seconden) dat een account gedeactiveerd wordt na te veel inlogpogingen.'; -$lng['serversettings']['pathedit']['title'] = 'Manier van Pad ingeven'; -$lng['serversettings']['pathedit']['description'] = 'Moet het pad geselecteerd worden met een \'dropdown\' menu of met een invoerveld?'; - -/** - * CHANGED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['mysql']['description'] = 'Hier kunt u MySQL-Databases maken en wijzigen.
De wijzigingen worden direct gemaakt en de database kan direkt gebruikt worden.
In het menu dat links staat vind u de tool phpMyAdmin welke u kunt gebruiken om uw database makkelijk te beheren.

Om gebruikt te maken van uw database in uw eigen php programmas kunt u de volgende instellingen gebruiken: (De gegeven in italics moeten aangepast worden in wat u ingevoerd heeft!)
Hostnaam:
Gebruikersnaam: Databasenaam
Wachtwoord: het wachtwoord dat u gekozen heeft
Database: Databasenaam'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['serversettings']['paging']['title'] = 'Vermeldingen per pagina'; -$lng['serversettings']['paging']['description'] = 'Hoeveel vermeldingen er getoond moeten worden per pagina? (0 = alles laten zien)'; -$lng['error']['ipstillhasdomains'] = 'De IP/Port combinatie die u verwijderen wilt heeft nog domeinen toegewezen, wijs deze opnieuw to aan andere IP/Poort combinaties voordat u deze IP/Poort combinatie verwijderd.'; -$lng['error']['cantdeletedefaultip'] = 'U kunt de standaard reseller IP/Poort combinatie niet verwijderen, maak eerst een andere IP/Port combinatie standaard voor reseller voor dat u deze IP/Port combinatie verwijderd.'; -$lng['error']['cantdeletesystemip'] = 'U kunt het laatste IP/Poort combinatie van het systeem niet verwijderen, maak eerste een andere IP/Port combinatie aan voor het systeem of wijzig het IP-adres van het systeem.'; -$lng['error']['myipaddress'] = '\'IP\''; -$lng['error']['myport'] = '\'Poort\''; -$lng['error']['myipdefault'] = 'U moet een IP/Poort combinatie selecteren die standaard moet worden.'; -$lng['error']['myipnotdouble'] = 'Deze IP/Poort combinatie bestaat reeds.'; -$lng['question']['admin_ip_reallydelete'] = 'Weet u zeker dat u het IP adres %s verwijderen wilt?'; -$lng['admin']['ipsandports']['ipsandports'] = 'IP-adressen en Poorten'; -$lng['admin']['ipsandports']['add'] = 'Maak IP/Poort'; -$lng['admin']['ipsandports']['edit'] = 'Bewerk IP/Poort'; -$lng['admin']['ipsandports']['ipandport'] = 'IP/Poort'; -$lng['admin']['ipsandports']['ip'] = 'IP'; -$lng['admin']['ipsandports']['port'] = 'Poort'; - -// ADDED IN 1.2.13-rc3 - -$lng['error']['cantchangesystemip'] = 'U kunt het laatste system IP niet wijzigen, maak eerst een nieuwe IP/Poort combinatie aan of wijzig het ip-adres van het systeem.'; -$lng['question']['admin_domain_reallydocrootoutofcustomerroot'] = 'Weet u zeker dat u de document root voor dit domein niet in de klant-root van de klant wil hebben?'; - -// ADDED IN 1.2.14-rc1 - -$lng['admin']['memorylimitdisabled'] = 'Gedeactiveerd'; -$lng['domain']['openbasedirpath'] = 'OpenBasedir-pad'; -$lng['domain']['docroot'] = 'Pad van bovenstaand veld'; -$lng['domain']['homedir'] = 'Home directory'; -$lng['admin']['valuemandatory'] = 'Deze waarde is verplicht'; -$lng['admin']['valuemandatorycompany'] = 'De waarde "naam" en "voornaam" of "bedrijf" moet ingevoerd worden'; -$lng['menue']['main']['username'] = 'Ingelogd als: '; -$lng['panel']['urloverridespath'] = 'URL (Vervangt path)'; -$lng['panel']['pathorurl'] = 'Pad of URL'; -$lng['error']['sessiontimeoutiswrong'] = 'Alleen numerieke "Session Timeout" zijn toegestaan.'; -$lng['error']['maxloginattemptsiswrong'] = 'Alleen numerieke "Maximaal aantal inlogpogingen" zijn toegestaan.'; -$lng['error']['deactivatetimiswrong'] = 'Alleen numerieke "Deactiveringstijd" zijn toegestaan.'; -$lng['error']['accountprefixiswrong'] = 'Het "Klant voorvoegsel" is verkeerd.'; -$lng['error']['mysqlprefixiswrong'] = 'Het "SQL voorvoegsel" is verkeerd.'; -$lng['error']['ftpprefixiswrong'] = 'Het "FTP voorvoegsel" is verkeerd.'; -$lng['error']['ipiswrong'] = 'Het "IP-Adres" is verkeerd. Alleen een geldig ip-adres is toegestaan.'; -$lng['error']['vmailuidiswrong'] = 'Het "Mails-uid" is verkeerd. Alleen een numeriek UID is toegestaan.'; -$lng['error']['vmailgidiswrong'] = 'Het "Mails-gid" is verkeerd. Alleen een numeriek GID is toegestaan.'; -$lng['error']['adminmailiswrong'] = 'Het "Afzender-adres" is verkeerd. Alleen geldige e-mail adressen zijn toegestaan.'; -$lng['error']['pagingiswrong'] = 'Het aantal "Vermeldingen per pagina" is verkeerd. Alleen numerieke karakters zijn toegestaan.'; -$lng['error']['phpmyadminiswrong'] = 'De phpMyAdmin-link is niet een geldige link.'; -$lng['error']['webmailiswrong'] = 'De WebMail-link is niet een geldige link.'; -$lng['error']['webftpiswrong'] = 'De WebFTP-link is niet een geldige link.'; -$lng['domains']['hasaliasdomains'] = 'Heeft alias domein(en)'; -$lng['serversettings']['defaultip']['title'] = 'Standaard IP/Poort'; -$lng['serversettings']['defaultip']['description'] = 'Wat is de standaard IP/Poort combinatie?'; -$lng['domains']['statstics'] = 'Gebruiksstatistieken'; -$lng['panel']['ascending'] = 'oplopend'; -$lng['panel']['descending'] = 'aflopend'; -$lng['panel']['search'] = 'Zoeken'; -$lng['panel']['used'] = 'gebruikt'; - -// ADDED IN 1.2.14-rc3 - -$lng['panel']['translator'] = 'Vertaler'; - -// ADDED IN 1.2.14-rc4 - -$lng['error']['stringformaterror'] = 'De waarde voor het veld "%s" is niet in het verwachte formaat.'; - -// ADDED IN 1.2.15-rc1 - -$lng['admin']['phpversion'] = 'PHP-Versie'; -$lng['admin']['phpmemorylimit'] = 'PHP-Geheugen-Limiet'; -$lng['admin']['mysqlserverversion'] = 'MySQL Server Versie'; -$lng['admin']['mysqlclientversion'] = 'MySQL Client Versie'; -$lng['domains']['isassigneddomain'] = 'Is toegewezen domein'; -$lng['serversettings']['phpappendopenbasedir']['title'] = 'Pad dat toegevoegd wordt aan OpenBasedir'; -$lng['serversettings']['phpappendopenbasedir']['description'] = 'Deze paden (gescheiden door dubbele punten) zullen worden toegevoegd aan het OpenBasedir-statement in iedere vhost-container.'; - -// CHANGED IN 1.2.15-rc1 - -$lng['error']['loginnameissystemaccount'] = 'U kunt geen accounts aanmaken die gelijk zijn aan systeem accounts (bijvoorbeeld beginnend met "%s"). Kies een andere accountnaam aub.'; -$lng['error']['youcantdeleteyourself'] = 'U kunt uw eigen account, omwille van veiligheidsredenen, niet verwijderen.'; -$lng['error']['youcanteditallfieldsofyourself'] = 'Opmerking: U kunt, om veiligheidsredenen, niet alle velden van uw account aanpassen.'; - -// ADDED IN 1.2.16-svn1 - -$lng['serversettings']['natsorting']['title'] = 'Gebruik een natuurlijke manier van sorteren'; -$lng['serversettings']['natsorting']['description'] = 'Lijsten worden gesorteerd zoals web1 -> web2 -> web11 in plaats van web1 -> web11 -> web2.'; - -// ADDED IN 1.2.16-svn2 - -$lng['serversettings']['deactivateddocroot']['title'] = 'Pad naar webinhoud voor gedeactiveerde gebruikers'; -$lng['serversettings']['deactivateddocroot']['description'] = 'Wanneer een gebruiker geactiveerd is, wordt dit pad gebruikt voor zijn/haar webinhoud.'; - -// ADDED IN 1.2.16-svn4 - -$lng['panel']['reset'] = 'wijzigingen verwerpen'; -$lng['admin']['accountsettings'] = 'Account-instellingen'; -$lng['admin']['panelsettings'] = 'Paneel-instellingen'; -$lng['admin']['systemsettings'] = 'Systeem-instellingen'; -$lng['admin']['webserversettings'] = 'Webserver-instellingen'; -$lng['admin']['mailserversettings'] = 'Mailserver-instellingen'; -$lng['admin']['nameserversettings'] = 'Nameserver-instellingen'; -$lng['admin']['updatecounters'] = 'Gebruikte bronnen herberekenen'; -$lng['question']['admin_counters_reallyupdate'] = 'Weet u zeker dat u gebruikte bronnen wilt herberekenen?'; -$lng['panel']['pathDescription'] = 'Indien de map niet bestaat wordt deze automatisch aangemaakt.

Indien u wilt doorverwijzen naar een ander domein dient deze te beginnen met http:// of https://'; - -// ADDED IN 1.2.16-svn6 -$lng['admin']['templates']['TRAFFIC'] = 'Wordt vervangen door aan klant toegewezen dataverkeer.'; -$lng['admin']['templates']['TRAFFICUSED'] = 'Wordt vervangen door het verbruikte dataverkeer.'; - -// ADDED IN 1.2.16-svn7 - -$lng['admin']['subcanemaildomain']['never'] = 'Nooit'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'Kiesbaar, standaard nee'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'Kiesbaar, standaard ja'; -$lng['admin']['subcanemaildomain']['always'] = 'Altijd'; -$lng['changepassword']['also_change_stats'] = ' wijzig ook het wachtwoord van de statistieken'; - -// ADDED IN 1.2.16-svn8 - -$lng['serversettings']['mailpwcleartext']['title'] = 'Sla het wachtwoord ook onversleuteld op in de database'; -$lng['serversettings']['mailpwcleartext']['description'] = 'Indien ingesteld op JA worden wachtwoorden in klare tekst opgeslagen in de database (zichtbaar voor iedereen die toegang heeft tot de tabel mail_users). Activeer dit alleen wanneer u gebruik gaat maken van SASL!'; -$lng['serversettings']['mailpwcleartext']['removelink'] = 'Klik hier om alle onversleutelde wachtwoorden uit de database te verwijderen'; -$lng['question']['admin_cleartextmailpws_reallywipe'] = 'Weet u zeker dat u alle onversleutelde wachtwoorden wilt verwijderen? Deze opdracht is niet terug te draaien!'; -$lng['admin']['configfiles']['overview'] = 'Overzicht'; -$lng['admin']['configfiles']['wizard'] = 'Wizard'; -$lng['admin']['configfiles']['distribution'] = 'Distributie'; -$lng['admin']['configfiles']['service'] = 'Dienst'; -$lng['admin']['configfiles']['etc'] = 'Overigen (Systeem)'; -$lng['admin']['configfiles']['choosedistribution'] = '-- Kies een distributie --'; -$lng['admin']['configfiles']['chooseservice'] = '-- Kies een dienst --'; -$lng['admin']['configfiles']['choosedaemon'] = '-- Kies een daemon --'; - -// ADDED IN 1.2.16-svn10 - -$lng['serversettings']['ftpdomain']['title'] = 'FTP accounts @domein'; -$lng['serversettings']['ftpdomain']['description'] = 'Kunnen klanten FTP-accounts in de vorm gebruiker@domein aanmaken?'; -$lng['panel']['back'] = 'Back'; - -// ADDED IN 1.2.16-svn12 - -$lng['serversettings']['mod_fcgid']['title'] = 'PHP insluiten via mod_fcgid/suexec'; -$lng['serversettings']['mod_fcgid']['description'] = 'Gebruik mod_fcgid/suexec/libnss_mysql om PHP uit te voeren onder het gebruikersaccount.
Dit vereist een aangepaste configuratie van de webserver. Alle volgende optie\'s zijn alleen geldig wanneer deze module actief is.'; -$lng['serversettings']['sendalternativemail']['title'] = 'Gebruik alternatief emailadres'; -$lng['serversettings']['sendalternativemail']['description'] = 'Stuur het wachtwoord naar een ander adres dan het adres dat opgegeven werd tijdens het aanmaken van het emailadres.'; -$lng['emails']['alternative_emailaddress'] = 'Alternatief emailadres'; -$lng['mails']['pop_success_alternative']['mailbody'] = 'Hallo,\n\nuw mailaccount {EMAIL}\nis met succes opgezet.\nUw wachtwoord is {PASSWORD}.\n\nDit is een automatisch gegenereerde\ne-mail, u kunt hierop niet antwoorden!\n\nMet vriendelijk groet, uw beheerder'; -$lng['mails']['pop_success_alternative']['subject'] = 'Mailaccount actief gemaakt'; -$lng['admin']['templates']['pop_success_alternative'] = 'Welkomstmail voor nieuwe emailaccounts, gestuurd naar een alternatief emailadres'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Vervangen door het POP3/IMAP-wachtwoord.'; - -// ADDED IN 1.2.16-svn13 - -$lng['error']['documentrootexists'] = 'De map "%s" voor deze klant bestaat reeds. Verwijder deze map alvorens het account aan te maken.'; - -// ADDED IN 1.2.16-svn14 - -$lng['serversettings']['apacheconf_vhost']['title'] = 'Bestands-/mapnaam voor vhost-configuratie webserver'; -$lng['serversettings']['apacheconf_vhost']['description'] = 'Waar dient het vhost-configuratiebestand opgeslagen te worden? U kunt hier zowel een bestand (alle configuratie\'s in 1 bestand) of een map (apart bestand voor iedere configuratie) opgeven.'; -$lng['serversettings']['apacheconf_diroptions']['title'] = 'Bestands-/mapnaam voor diroptions-configuratie webserver'; -$lng['serversettings']['apacheconf_diroptions']['description'] = 'Waar dient het diroptions-configuratiebestand opgeslagen te worden? U kunt hier zowel een bestand (alle configuratie\'s in 1 bestand) of een map (apart bestand voor iedere configuratie) opgeven.'; -$lng['serversettings']['apacheconf_htpasswddir']['title'] = 'Mapnaam htpasswd-bestanden webserver'; -$lng['serversettings']['apacheconf_htpasswddir']['description'] = 'Waar dienen de htpasswd-bestanden, voor beveiligde toegang, opgeslagen te worden?'; - -// ADDED IN 1.2.16-svn15 - -$lng['error']['formtokencompromised'] = 'Het verzoek lijkt te zijn gecompromitteerd. U bent veiligheidshalve uitgelogd.'; -$lng['serversettings']['mysql_access_host']['title'] = 'Toegangshosts voor MySQL'; -$lng['serversettings']['mysql_access_host']['description'] = 'Een door komma\'s gescheiden lijst met hosts waarvandaan gebruikers verbinding mogen maken met de MySQL-server.'; - -// ADDED IN 1.2.18-svn1 - -$lng['admin']['ipsandports']['create_listen_statement'] = '\'Listen\'-regel genereren'; -$lng['admin']['ipsandports']['create_namevirtualhost_statement'] = '\'NameVirtualHost\'-regel genereren'; -$lng['admin']['ipsandports']['create_vhostcontainer'] = 'vHost-Container genereren'; -$lng['admin']['ipsandports']['create_vhostcontainer_servername_statement'] = '\'ServerName\'-regel vHost-Container genereren'; - -// ADDED IN 1.2.18-svn2 - -$lng['admin']['webalizersettings'] = 'Instellingen voor Webalizer'; -$lng['admin']['webalizer']['normal'] = 'Normaal'; -$lng['admin']['webalizer']['quiet'] = 'Stil'; -$lng['admin']['webalizer']['veryquiet'] = 'Geen uitvoer'; -$lng['serversettings']['webalizer_quiet']['title'] = 'Uitvoer Webalizer'; -$lng['serversettings']['webalizer_quiet']['description'] = 'Informatieniveau van Webalizer'; - -// ADDED IN 1.2.18-svn4 - -$lng['admin']['domain_nocustomeraddingavailable'] = 'Het is niet mogelijk een domein toe te voegen. U dient tenminste een klant aan te maken.'; - -// ADDED IN 1.2.19-svn1 - -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Configuratiemap'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Waar dienen alle configuratiebestanden voor FCGID te worden opgeslagen? Indien u geen aangepaste versie van SuExec gebruikt, zoals gebruikelijk is, dient dit pad onder /var/www/ te liggen'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Map voor tijdelijke bestanden'; - -// ADDED IN 1.2.19-svn4 - -$lng['menue']['traffic']['traffic'] = 'Dataverkeer'; -$lng['menue']['traffic']['current'] = 'Deze maand'; -$lng['traffic']['month'] = "Maand"; -$lng['traffic']['day'] = "Dag"; -$lng['traffic']['months'][1] = "Januari"; -$lng['traffic']['months'][2] = "Februari"; -$lng['traffic']['months'][3] = "Maart"; -$lng['traffic']['months'][4] = "April"; -$lng['traffic']['months'][5] = "Mei"; -$lng['traffic']['months'][6] = "Juni"; -$lng['traffic']['months'][7] = "Juli"; -$lng['traffic']['months'][8] = "Augustus"; -$lng['traffic']['months'][9] = "September"; -$lng['traffic']['months'][10] = "Oktober"; -$lng['traffic']['months'][11] = "November"; -$lng['traffic']['months'][12] = "December"; -$lng['traffic']['mb'] = "Datavekeer (MB)"; -$lng['traffic']['distribution'] = 'FTP | HTTP | Mail'; -$lng['traffic']['sumhttp'] = 'Samenvatting HTTP-verkeer in'; -$lng['traffic']['sumftp'] = 'Samenvatting FTP-verkeer in'; -$lng['traffic']['summail'] = 'Samenvatting Mail-verkeer in'; - -// ADDED IN 1.2.19-svn6 - -$lng['admin']['loggersettings'] = 'Instellingen voor logs'; -$lng['serversettings']['logger']['enable'] = 'Logs in-/uitgeschakeld'; -$lng['serversettings']['logger']['severity'] = 'Logniveau'; -$lng['admin']['logger']['normal'] = 'normaal'; -$lng['admin']['logger']['paranoid'] = 'paranoide'; -$lng['serversettings']['logger']['types']['title'] = 'Log-type(s)'; -$lng['serversettings']['logger']['types']['description'] = 'Om meerdere types te selecteren, houd u CTRL ingedrukt terwijl u selecteert.
Beschikbare types zijn: syslog, bestand, mysql'; -$lng['serversettings']['logger']['logfile'] = 'Pad naar logfile, inclusief bestandsnaam'; -$lng['error']['logerror'] = 'Log-Fout: %s'; -$lng['serversettings']['logger']['logcron'] = 'Cronjobs loggen'; -$lng['serversettings']['logger']['logcronoption']['never'] = 'Nooit'; -$lng['serversettings']['logger']['logcronoption']['once'] = 'Eenmalig'; -$lng['serversettings']['logger']['logcronoption']['always'] = 'Altijd'; -$lng['question']['logger_reallytruncate'] = 'Weet u zeker dat u de tabel "%s" wilt legen?'; -$lng['admin']['loggersystem'] = 'Systeemlog'; -$lng['logger']['date'] = 'Datum'; -$lng['logger']['type'] = 'Type'; -$lng['logger']['action'] = 'Actie'; -$lng['logger']['user'] = 'Gebruiker'; -$lng['logger']['truncate'] = 'Log legen'; - -// ADDED IN 1.2.19-svn7 -$lng['serversettings']['ssl']['openssl_cnf'] = 'Standaardinstellingen certificaat'; -$lng['panel']['reseller'] = 'wederverkoper'; -$lng['panel']['admin'] = 'beheerder'; -$lng['panel']['customer'] = 'klant(en)'; -$lng['error']['nomessagetosend'] = 'U hebt geen bericht opgegeven.'; -$lng['error']['norecipientsgiven'] = 'U hebt geen ontvanger opgegeven'; -$lng['admin']['emaildomain'] = 'Emaildomein'; -$lng['admin']['email_only'] = 'Alleen email?'; -$lng['admin']['wwwserveralias'] = 'Voeg een "www." ServerAlias toe'; -$lng['admin']['ipsandports']['enable_ssl'] = 'Is dit een SSL-poort?'; -$lng['admin']['ipsandports']['ssl_cert_file'] = 'Pad naar SSL-certificaat'; -$lng['panel']['send'] = 'verzenden'; -$lng['admin']['subject'] = 'Onderwerp'; -$lng['admin']['recipient'] = 'Ontvanger'; -$lng['admin']['message'] = 'Bericht schrijven'; -$lng['admin']['text'] = 'Bericht'; -$lng['menu']['message'] = 'Berichten'; -$lng['error']['errorsendingmail'] = 'Het versturen van het bericht naar "%s" is mislukt'; -$lng['error']['cannotreaddir'] = 'De map "%s" kan niet gelezen worden'; -$lng['success']['messages_success'] = 'Bericht verzonden naar ontvangers %s'; -$lng['message']['norecipients'] = 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn'; -$lng['admin']['sslsettings'] = 'Instellingen voor SSL'; -$lng['cronjobs']['notyetrun'] = 'Nog niet uitgevoerd'; -$lng['serversettings']['default_vhostconf']['title'] = 'Standaard vhost-instellingen'; -$lng['serversettings']['default_vhostconf']['description'] = 'De inhoud van dit veld wordt rechtstreeks in de vhost-container geplaatst. N.B.: Deze code wordt niet op fouten gecontroleerd. In geval van fouten kan het zijn dat de webserver niet meer start!'; -$lng['error']['invalidip'] = '%s is een ongeldig IP-adres'; -$lng['serversettings']['decimal_places'] = 'Aantal getallen achter de komma in uitvoer dataverkeer'; - -// ADDED IN 1.2.19-svn8 - -$lng['admin']['dkimsettings'] = 'Instellingen voor DomainKeys'; -$lng['dkim']['dkim_prefix']['title'] = 'Prefix'; -$lng['dkim']['dkim_prefix']['description'] = 'Geef het pad naar de DKIM RSA-files alsook naar de configuratie van de Milter-plugin'; -$lng['dkim']['dkim_domains']['title'] = 'Bestandsnaam domeinen'; -$lng['dkim']['dkim_domains']['description'] = 'Bestandsnaam van het DKIM Domains-parameter zoals aangegeven in de configuratie van dkim-milter'; -$lng['dkim']['dkim_dkimkeys']['title'] = 'KeyList filename'; -$lng['dkim']['dkim_dkimkeys']['description'] = 'Bestandsnaam van het DKIM KeyList-parameter zoals aangegeven in de configuratie van dkim-milter'; -$lng['dkim']['dkimrestart_command']['title'] = 'Herstart-commando voor Milter'; -$lng['dkim']['dkimrestart_command']['description'] = 'Geef het commando om de milter-plugin te herstarten'; - -// ADDED IN 1.2.19-svn12 - -$lng['admin']['allips'] = 'Alle IP\'s'; -$lng['panel']['nosslipsavailable'] = 'Er zijn op dit moment geen SSL IP/poorten beschikbaar'; -$lng['dkim']['use_dkim']['title'] = 'Activeer ondersteuning voor DKIM?'; -$lng['dkim']['use_dkim']['description'] = 'Wilt u gebruikmaken van Domain Keys (DKIM) systeem?'; -$lng['error']['invalidmysqlhost'] = 'Ongeldig adres voor MySQL-host: %s'; -$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'U kunt Webalizer en AWstats niet tegelijkertijd gebruiken. Kies een van de twee.'; -$lng['serversettings']['webalizer_enabled'] = 'Webalizer activeren'; -$lng['serversettings']['awstats_enabled'] = 'AWstats activeren'; -$lng['admin']['awstatssettings'] = 'Instellingen voor AWstats'; - -// ADDED IN 1.2.19-svn16 - -$lng['admin']['domain_dns_settings'] = 'DNS-instellingen voor domein'; -$lng['dns']['destinationip'] = 'IP domein'; -$lng['dns']['standardip'] = 'Standaard server IP'; -$lng['dns']['a_record'] = 'A-record (IPv6 optioneel)'; -$lng['dns']['cname_record'] = 'CNAME-record'; -$lng['dns']['mxrecords'] = 'MX-records'; -$lng['dns']['standardmx'] = 'Standaard server MX-record'; -$lng['dns']['mxconfig'] = 'Aangepaste MX-records'; -$lng['dns']['priority10'] = 'Prioriteit 10'; -$lng['dns']['priority20'] = 'Prioriteit 20'; -$lng['dns']['txtrecords'] = 'TXT-records'; -$lng['dns']['txtexample'] = 'Voorbeeld (SPF-regel):
v=spf1 ip4:xxx.xxx.xx.0/23 -all'; -$lng['serversettings']['selfdns']['title'] = 'Instellingen voor klantdomein'; -$lng['serversettings']['selfdnscustomer']['title'] = 'Klanten toestaan de DNS-instellingen van het domein te wijzigen'; -$lng['admin']['activated'] = 'Geactiveerd'; -$lng['admin']['statisticsettings'] = 'Instellingen voor statistieken'; -$lng['admin']['or'] = 'of'; - -// ADDED IN 1.2.19-svn17 - -$lng['serversettings']['unix_names']['title'] = 'Gebruik gebruikersnamen die compatible zijn met UNIX'; -$lng['serversettings']['unix_names']['description'] = 'Staat het gebruik van - en _ in gebruikersnaam toe, indien ingesteld op Nee'; -$lng['error']['cannotwritetologfile'] = 'Kan logbestand %s niet openen om naartoe te schrijven'; -$lng['admin']['sysload'] = 'Systeembelasting'; -$lng['admin']['noloadavailable'] = 'niet beschikbaar'; -$lng['admin']['nouptimeavailable'] = 'niet beschikbaar'; -$lng['panel']['backtooverview'] = 'Terug naar overzicht'; -$lng['admin']['nosubject'] = '(Geen onderwerp)'; -$lng['admin']['configfiles']['statistics'] = 'Statistieken'; -$lng['login']['forgotpwd'] = 'Wachtwoord vergeten?'; -$lng['login']['presend'] = 'Wachtwoord opnieuw instellen'; -$lng['login']['email'] = 'E-mailadres'; -$lng['login']['remind'] = 'Mijn wachtwoord opnieuw instellen'; -$lng['login']['usernotfound'] = 'Gebruiker niet gevonden!'; -$lng['mails']['password_reset']['subject'] = 'Wachtwoord opnieuw instellen'; -$lng['mails']['password_reset']['mailbody'] = 'Hallo {USERNAME},\n\nuw wachtwoord voor Froxlor is opnieuw ingesteld!\nHet nieuwe wachtwoord is: {LINK}\n\nMet vriendelijke groet,\nuw beheerder'; -$lng['pwdreminder']['success'] = 'Wachtwoord opnieuw ingesteld.
U ontvangt spoedig een e-mail met uw nieuwe wachtwoord.'; - -// ADDED IN 1.2.19-svn18 - -$lng['serversettings']['allow_password_reset']['title'] = 'Klanten toestaan hun wachtwoord opnieuw in te stellen'; -$lng['pwdreminder']['notallowed'] = 'Het opnieuw instellen van wachtwoorden is uitgeschakeld'; - -// ADDED IN 1.2.19-svn21 - -$lng['customer']['title'] = 'Titel'; -$lng['customer']['country'] = 'Land'; -$lng['panel']['dateformat'] = 'YYYY-MM-DD'; -$lng['panel']['dateformat_function'] = 'Y-m-d'; - -// Y = Year, m = Month, d = Day - -$lng['panel']['timeformat_function'] = 'H:i:s'; - -// H = Hour, i = Minute, s = Second - -$lng['panel']['default'] = 'Standaard'; -$lng['panel']['never'] = 'Nooit'; -$lng['panel']['active'] = 'Actief'; -$lng['panel']['please_choose'] = 'Maak een keuze'; -$lng['panel']['allow_modifications'] = 'Aanpassingen toestaan'; -$lng['domains']['add_date'] = 'Toegevoegd aan Froxlor'; -$lng['domains']['registration_date'] = 'Toegevoegd aan register'; -$lng['domains']['topleveldomain'] = 'Top-Level-Domein'; - -// ADDED IN 1.2.19-svn22 - -$lng['serversettings']['allow_password_reset']['description'] = 'Klanten kunnen hun wachtwoorden opnieuw instellen. Het nieuwe wachtwoord wordt hen per e-mail toegestuurd.'; -$lng['serversettings']['allow_password_reset_admin']['title'] = 'Beheerders/wederverkopers toestaan hun wachtwoorden opnieuw in te stellen.'; -$lng['serversettings']['allow_password_reset_admin']['description'] = 'Beheerders/wederverkopers kunnen hun wachtwoorden opnieuw instellen. Het nieuwe wachtwoord wordt hen per e-mail toegestuurd.'; - -// ADDED IN 1.2.19-svn25 - -$lng['emails']['quota'] = 'Quotum'; -$lng['emails']['noquota'] = 'Geen quotum'; -$lng['emails']['updatequota'] = 'Quotum aanpassen'; -$lng['serversettings']['mail_quota']['title'] = 'Quotum voor mailbox'; -$lng['serversettings']['mail_quota']['description'] = 'Het standaard quotum voor nieuwe mailboxen (MegaByte).'; -$lng['serversettings']['mail_quota_enabled']['title'] = 'Gebruik mailbox-quota voor mailboxen'; -$lng['serversettings']['mail_quota_enabled']['description'] = 'Activeert het gebruik van quota voor mailboxen. Standaard is Nee, aangezien dit verdere configuratie vereist.'; -$lng['serversettings']['mail_quota_enabled']['removelink'] = 'Klik hier om alle quota van mailbox te verwijderen.'; -$lng['serversettings']['mail_quota_enabled']['enforcelink'] = 'Klik hier om het standaard quotum af te dwingen voor alle accounts.'; -$lng['question']['admin_quotas_reallywipe'] = 'Weet u zeker dat u alle quota wilt verwijderen? Dit is niet terug te draaien!'; -$lng['question']['admin_quotas_reallyenforce'] = 'Weet u zeker dat u quota wilt afdwingen? Dit is niet terug te draaien!'; -$lng['error']['vmailquotawrong'] = 'Het quotum dient een positief getal te zijn.'; -$lng['customer']['email_quota'] = 'quotem voor e-mail'; -$lng['customer']['email_imap'] = 'E-mail IMAP'; -$lng['customer']['email_pop3'] = 'E-mail POP3'; -$lng['customer']['mail_quota'] = 'Mailquotum'; -$lng['panel']['megabyte'] = 'MegaByte'; -$lng['panel']['not_supported'] = 'Wordt niet ondersteund in: '; -$lng['emails']['quota_edit'] = 'E-mailquotum aanpassen'; -$lng['error']['allocatetoomuchquota'] = 'U probeerde %s MB Quotum toe te kennen, maar u heeft niet voldoende over.'; -$lng['error']['missingfields'] = 'Niet alle vereiste velden zijn ingevuld.'; -$lng['error']['accountnotexisting'] = 'Het opgegeven e-mailaccount bestaat niet.'; -$lng['admin']['security_settings'] = 'Beveiliging'; -$lng['admin']['know_what_youre_doing'] = 'Verander dit alleen wanneer u zeker weet wat u doet!'; -$lng['admin']['show_version_login']['title'] = 'Toon versie van Froxlor bij het inloggen'; -$lng['admin']['show_version_login']['description'] = 'Toont de versie van Froxlor in de voettekst van de inlogpagina'; -$lng['admin']['show_version_footer']['title'] = 'Toon versie van Froxlor in de voettekst'; -$lng['admin']['show_version_footer']['description'] = 'Toont de versie van Froxlor in de voettekst op de rest van de pagina\'s'; -$lng['admin']['froxlor_graphic']['title'] = 'Kopgrafiek voor Froxlor'; -$lng['admin']['froxlor_graphic']['description'] = 'Afbeelding die getoond wordt in de kop'; - -// improved froxlor - -$lng['menue']['phpsettings']['maintitle'] = 'PHP Configuratie\'s'; -$lng['admin']['phpsettings']['title'] = 'PHP Configuratie'; -$lng['admin']['phpsettings']['description'] = 'Korte omschrijven'; -$lng['admin']['phpsettings']['actions'] = 'Actie\'s'; -$lng['admin']['phpsettings']['activedomains'] = 'Wordt gebruikt door domein(en)'; -$lng['admin']['phpsettings']['notused'] = 'Configuratie niet in gebruik'; -$lng['admin']['misc'] = 'Diversen'; -$lng['admin']['phpsettings']['editsettings'] = 'Instellingen voor PHP aanpassen'; -$lng['admin']['phpsettings']['addsettings'] = 'Nieuwe instellingen voor PHP aanmaken'; -$lng['admin']['phpsettings']['viewsettings'] = 'Instellingen voor PHP weergeven'; -$lng['admin']['phpsettings']['phpinisettings'] = 'Instellingen in php.ini'; -$lng['error']['nopermissionsorinvalidid'] = 'U hebt geen toestemming om deze instellingen te wijzigen, of u hebt een ongeldig ID opgegeven.'; -$lng['panel']['view'] = 'weergeven'; -$lng['question']['phpsetting_reallydelete'] = 'Weet u zeker dat u deze instellingen wilt verwijderen? Alle domeinen die deze configuratie gebruiken zullen terugvallen op de standaardinstellingen.'; -$lng['admin']['phpsettings']['addnew'] = 'Nieuwe instellingen aanmaken'; -$lng['error']['phpsettingidwrong'] = 'Een configuratie voor PHP met dit ID bestaat niet'; -$lng['error']['descriptioninvalid'] = 'De omschrijving is te kort, te lang of bevat ongeldige karakters.'; -$lng['error']['info'] = 'Informatie'; -$lng['admin']['phpconfig']['template_replace_vars'] = 'Variabelen die worden vervangen in de instellingen'; -$lng['admin']['phpconfig']['pear_dir'] = 'Wordt vervangen door de globale pear-map.'; -$lng['admin']['phpconfig']['open_basedir_c'] = 'Voegt een ; (puntkomma) toe om open_basedir in- of uit te schakelen'; -$lng['admin']['phpconfig']['open_basedir'] = 'Wordt vervangen door de open_basedir-instellingen voor het domein.'; -$lng['admin']['phpconfig']['tmp_dir'] = 'Wordt vervangen door de tijdelijke map voor dit domein'; -$lng['admin']['phpconfig']['open_basedir_global'] = 'Wordt vervangen door de globale waarde van het pad dat wordt toegevoegd aan de open_basedir.'; -$lng['admin']['phpconfig']['customer_email'] = 'Wordt vervangen door het e-mailadres van de klant van het domein.'; -$lng['admin']['phpconfig']['admin_email'] = 'Wordt vervangen door het e-mailadres van de beheerder van het domein.'; -$lng['admin']['phpconfig']['domain'] = 'Wordt vervangen door het domein.'; -$lng['admin']['phpconfig']['customer'] = 'Wordt vervangen door de loginnaam van de eigenaar van het domein.'; -$lng['admin']['phpconfig']['admin'] = 'Wordt vervangen door de loginnaam van de beheerder van het domein.'; -$lng['login']['backtologin'] = 'Terug naar inlogpagina'; -$lng['serversettings']['mod_fcgid']['starter']['title'] = 'Processen per domein'; -$lng['serversettings']['mod_fcgid']['starter']['description'] = 'Hoeveel processen moeten gestart/toegestaan worden per domein? De waarde 0 wordt aangeraden, aangezien PHP zelf het aantal processen goed kan inschatten.'; -$lng['serversettings']['mod_fcgid']['wrapper']['title'] = 'Wrapper in vhosts'; -$lng['serversettings']['mod_fcgid']['wrapper']['description'] = 'Hoe moet de wrapper ingesloten worden in vhosts?'; -$lng['serversettings']['mod_fcgid']['tmpdir']['description'] = 'Waar dienen de tijdelijke mappen te worden opgeslagen?'; -$lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Globale PEAR-mappen'; -$lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Welke PEAR-mappen dienen te worden ingesloten in elke php.ini? Bij meerdere mappen dienen deze te worden gescheiden door dubbele punten.'; - -// improved Froxlor 2 - -$lng['admin']['templates']['index_html'] = 'Standaardpagina voor nieuwe mappen/domeinen'; -$lng['admin']['templates']['SERVERNAME'] = 'Wordt vervangen door de naam van de server.'; -$lng['admin']['templates']['CUSTOMER'] = 'Wordt vervangen door de inlognaam van de klant.'; -$lng['admin']['templates']['ADMIN'] = 'Wordt vervangen door de inlognaam van de beheerder.'; -$lng['admin']['templates']['CUSTOMER_EMAIL'] = 'Wordt vervangen door het e-mailadres van de klant.'; -$lng['admin']['templates']['ADMIN_EMAIL'] = 'Wordt vervangen door het e-mailadres van de beheerder.'; -$lng['admin']['templates']['filetemplates'] = 'Bestandssjablonen'; -$lng['admin']['templates']['filecontent'] = 'Bestandsinhoud'; -$lng['error']['filecontentnotset'] = 'Het bestand mag niet leeg zijn!'; -$lng['serversettings']['index_file_extension']['description'] = 'Welk achtervoegsel moet gebruikt worden voor het indexbestand? Dit achtervoegsel wordt gebruikt wanneer een van de beheerders een eigen indexsjabloon heeft gemaakt.'; -$lng['serversettings']['index_file_extension']['title'] = 'Achtervoegsel van het indexbestand in nieuwe mappen voor klanten.'; -$lng['error']['index_file_extension'] = 'Het achtervoegsel dient tussen de 1 en 6 tekens lang te zijn. Het mag alleen tekens zal a-z, A-Z en 0-9 bevatten.'; -$lng['admin']['expert_settings'] = 'Instellingen voor experts!'; -$lng['admin']['mod_fcgid_starter']['title'] = 'Aantal PHP-processen voor dit domein. (Leeg betekent standaardinstellingen.)'; - -$lng['error']['customerdoesntexist'] = 'De gekozen klant bestaat niet.'; -$lng['error']['admindoesntexist'] = 'De gekozen beheerder bestaat niet.'; - -// ADDED IN 1.2.19-svn37 -$lng['serversettings']['session_allow_multiple_login']['title'] = 'Meerdere logins toestaan'; -$lng['serversettings']['session_allow_multiple_login']['description'] = 'Indien dit is ingeschakeld kan een klant meerdere malen tegelijkertijd inloggen.'; -$lng['serversettings']['panel_allow_domain_change_admin']['title'] = 'Het verplaatsen van domeinen tussen beheerders toestaan'; -$lng['serversettings']['panel_allow_domain_change_admin']['description'] = 'Indien actief, kunt u een domein toewijzen aan een andere beheerder.
Let op: Indien een klant niet is toegewezen aan de beheerder van het domein, kan de betreffende beheerde alle domeinen van deze klant zien!'; -$lng['serversettings']['panel_allow_domain_change_customer']['title'] = 'Het verplaatsen van domeinen tussen klanten toestaan'; -$lng['serversettings']['panel_allow_domain_change_customer']['description'] = 'Indien actief, kunt u de klant van een domein veranderen.
Let op: Froxlor zal niet het pad aanpassen. Dit kan ervoor zorgen dat het domein onbruikbaar wordt!'; -$lng['domains']['associated_with_domain'] = 'Toegekend'; -$lng['domains']['aliasdomains'] = 'Alternatieve domeinnamen'; -$lng['error']['ipportdoesntexist'] = 'De kozen combinatie poort/IP-adres bestaat niet.'; - -// ADDED IN 1.2.19-svn38 - -$lng['admin']['phpserversettings'] = 'PHP Instellingen'; -$lng['admin']['phpsettings']['binary'] = 'PHP Uitvoerbaar bestand'; -$lng['admin']['phpsettings']['file_extensions'] = 'Bestandsextensies'; -$lng['admin']['phpsettings']['file_extensions_note'] = '(zonder punt, gescheiden door spaties)'; -$lng['admin']['mod_fcgid_maxrequests']['title'] = 'Maximaal aantal PHP verzoeken voor dit domein (leeg geldt als standaardwaarde)'; -$lng['serversettings']['mod_fcgid']['maxrequests']['title'] = 'Maximaal aantal verzoeken per domein'; -$lng['serversettings']['mod_fcgid']['maxrequests']['description'] = 'Toegestane aantal verzoeken per domein'; - -// fix bug #1124 -$lng['error']['admin_domain_emailsystemhostname'] = 'De naam van de server kan niet gebruikt worden als domein voor e-mail.'; - -// ADDED IN 1.4.2.1-2 - -$lng['admin']['ipsandports']['webserverdefaultconfig'] = 'Standaarconfiguratie webserver'; -$lng['admin']['ipsandports']['webserverdomainconfig'] = 'Domeinconfiguratie webserver'; -$lng['admin']['ipsandports']['webserverssldomainconfig'] = 'SSL-configuratie webserver'; -$lng['admin']['ipsandports']['ssl_key_file'] = 'Pad naar SSL keyfile'; -$lng['admin']['ipsandports']['ssl_ca_file'] = 'Pad naar SSL CA certificaat'; -$lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Standaard VHost-instellingen voor iedere domeincontainer'; - -$lng['error']['usernamealreadyexists'] = 'De gebruikersnaam %s is reeds in gebruik.'; - -$lng['error']['errorwhensaving'] = 'Fout tijdens opslaan veld %s'; - -$lng['success']['success'] = 'Informatie'; -$lng['success']['clickheretocontinue'] = 'Klik hier om verder te gaan'; -$lng['success']['settingssaved'] = 'De instellingen zijn opgeslagen.'; - -// ADDED IN FROXLOR 0.9 - -$lng['admin']['spfsettings'] = 'SPF-instellingen domein'; -$lng['spf']['use_spf'] = 'SPF voor domeinen activeren?'; -$lng['spf']['spf_entry'] = 'SPF regel voor alle domeinen'; -$lng['panel']['dirsmissing'] = 'De opgegeven map bestaat niet.'; -$lng['panel']['toomanydirs'] = 'Teveel submappen. Er wordt teruggevallen op handmatige invoer.'; -$lng['panel']['abort'] = 'Afbreken'; -$lng['serversettings']['cron']['debug']['title'] = 'Foutopsporing cronscript'; -$lng['serversettings']['cron']['debug']['description'] = 'Activeer dit om het lockbestand te bewaren nadat de cron-taak is afgehandeld, zodat het gerbuikt kan worden voor het opsporen van fouten.
Let op:Het vastzetten van het lockbestand kan ervoor zorgen dat de volgende cron-taak niet naar behoren functioneert.'; -$lng['panel']['not_activated'] = 'niet actief'; -$lng['panel']['off'] = 'uit'; -$lng['update']['updateinprogress_onlyadmincanlogin'] = 'Een nieuwere versie van Froxlor is geinstalleerd maar is nog niet geconfigureerd.
Alleen de beheerder kan inloggen en de update voltooien.'; -$lng['update']['update'] = 'Froxlor Update'; -$lng['update']['proceed'] = 'Verdergaan'; -$lng['update']['update_information']['part_a'] = 'De bestanden van Froxlor zijn bijgewerkt naar versie %newversion. De geinstalleerde versie is %curversion.'; -$lng['update']['update_information']['part_b'] = '

Klanten kunnen niet inloggen totdat de update voltooid is.
Verdergaan?'; -$lng['update']['noupdatesavail'] = 'U gebruikt reeds de meest recente versie van Froxlor.'; -$lng['admin']['specialsettingsforsubdomains'] = 'Speciale instellingen toepassen op alle subdomeinen (*.example.com)'; -$lng['serversettings']['specialsettingsforsubdomains']['description'] = 'Indien "Ja" zullen deze aangepaste VHost-instellingen worden toegepast op alle subdomeinen.'; -$lng['tasks']['outstanding_tasks'] = 'Uitstaande cron-taken'; -$lng['tasks']['REBUILD_VHOST'] = 'Bezig met opnieuw opbouwen van de configuratie van de webserver'; -$lng['tasks']['CREATE_HOME'] = 'Klant met naam %loginname% wordt toegevoegd'; -$lng['tasks']['REBUILD_DNS'] = 'Opnieuw opbouwen bind-configuratie'; -$lng['tasks']['CREATE_FTP'] = 'Map aanmaken voor nieuwe FTP-gebruiker'; -$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Verwijderen klantbestanden van %loginname%'; -$lng['tasks']['noneoutstanding'] = 'Er zijn op dit moment geen uitstaande taken voor Froxlor'; - -// ADDED IN FROXLOR 0.9.1 - -$lng['admin']['accountdata'] = 'Accountgegevens'; -$lng['admin']['contactdata'] = 'Contactgegevens'; -$lng['admin']['servicedata'] = 'Ondersteuningsgegevens'; - -// ADDED IN FROXLOR 0.9.2 - -$lng['admin']['newerversionavailable'] = 'Er is een nieuwe versie van Froxlor beschikbaar'; - -// ADDED IN FROXLOR 0.9.3 - -$lng['emails']['noemaildomainaddedyet'] = 'U hebt nog geen (email-)domein gekoppeld aan uw account.'; -$lng['error']['hiddenfieldvaluechanged'] = 'De waarde van het verborgen veld "%s" is gewijzigd tijdens het aanpassen van de instellingen.

Dit is normaliter geen groot probleem maar heeft wel verhinderd dat de instellingen niet zijn opgeslagen.'; - -// ADDED IN FROXLOR 0.9.3-svn1 - -$lng['serversettings']['panel_password_min_length']['title'] = 'Minimumlengte wachtwoord'; -$lng['serversettings']['panel_password_min_length']['description'] = 'Hier kunt u een minimumlengte voor wachtwoorden opgeven. \'0\' betekent geen minimumlengte.'; -$lng['error']['notrequiredpasswordlength'] = 'Het opgegeven wachtwoord is te kort. Geef tenminste %s tekens op.'; -$lng['serversettings']['system_store_index_file_subs']['title'] = 'Standaard indexbestand ook plaatsen in nieuwe submappen'; -$lng['serversettings']['system_store_index_file_subs']['description'] = 'Indien actief wordt dit bestand automatisch geplaatst in nieuw aangemaakte submappen (indien deze nog niet bestaat).'; - -// ADDED IN FROXLOR 0.9.3-svn2 - -$lng['serversettings']['adminmail_return']['title'] = 'Reply-To adres'; -$lng['serversettings']['adminmail_return']['description'] = 'Geef een e-mailadres dat gebruikt wordt als antwoord-aan adres voor mails die verzonden worden door het paneel.'; -$lng['serversettings']['adminmail_defname'] = 'Panel e-mail sender name'; - -// ADDED IN FROXLOR 0.9.3-svn3 -$lng['dkim']['dkim_algorithm']['title'] = 'Toegestane hash-algoritmen'; -$lng['dkim']['dkim_algorithm']['description'] = 'Toegestane hash-algoritmen, kies "Alle" voor alle algoritmen of 1 of meerdere van onderstaande'; -$lng['dkim']['dkim_servicetype'] = 'Type services'; -$lng['dkim']['dkim_keylength']['title'] = 'Lengte sleutel'; -$lng['dkim']['dkim_keylength']['description'] = 'Let op: Indien u deze waarde wijzigt, dient u allen geheime en publieke sleutels in "%s" te verwijderen'; -$lng['dkim']['dkim_notes']['title'] = 'Notities voor DKIM'; -$lng['dkim']['dkim_notes']['description'] = 'Notities die van belang kunnen zijn voor mensen, bijvoorbeeld een URL als http://www.dnswatch.info. Geen enkel programma zal deze informatie verwerken. Deze informatie dient schaars te zijn gezien de beperkte ruimte in DNS. Dit is bedoeld voor beheerders, niet voor eindgebruikers.'; - -$lng['admin']['cron']['cronsettings'] = 'Instellingen cron-taken'; -$lng['cron']['cronname'] = 'naam cron-taak'; -$lng['cron']['lastrun'] = 'laatst uitgevoerd'; -$lng['cron']['interval'] = 'interval'; -$lng['cron']['isactive'] = 'actief'; -$lng['cron']['description'] = 'beschrijving'; -$lng['crondesc']['cron_unknown_desc'] = 'geen beschrijving opgegeven'; -$lng['admin']['cron']['add'] = 'Cron-taak toevoegen'; -$lng['crondesc']['cron_tasks'] = 'aanmaken configuratiebestanden'; -$lng['crondesc']['cron_legacy'] = 'oude cron-taak'; -$lng['crondesc']['cron_traffic'] = 'berekenen verkeersgegevens'; -$lng['cronmgmt']['seconds'] = 'seconden'; -$lng['cronmgmt']['minutes'] = 'minuten'; -$lng['cronmgmt']['hours'] = 'uren'; -$lng['cronmgmt']['days'] = 'days'; -$lng['cronmgmt']['weeks'] = 'weken'; -$lng['cronmgmt']['months'] = 'maanden'; -$lng['admin']['cronjob_edit'] = 'Cron-taak aanpassen'; -$lng['cronjob']['cronjobsettings'] = 'Instellingen cron-taak'; -$lng['cronjob']['cronjobinterval'] = 'Interval uitvoeren'; -$lng['panel']['options'] = 'opties'; -$lng['admin']['warning'] = 'WAARSCHUWING - Let op!'; -$lng['cron']['changewarning'] = 'Het aanpassen van de ze waarden kunnen van negatieve invloed zijn op het gedrag van Froxlor en haar geautomatiseerde taken.
Pas deze waarden alleen aan wanneer u *zeer zeker* bent van wat u doet.'; - -$lng['serversettings']['stdsubdomainhost']['title'] = 'Standaarddomein voor klanten'; -$lng['serversettings']['stdsubdomainhost']['description'] = 'Welke hostnaam dient gebruikt te worden voor standaard subdomeinen voor klanten. Indien leeg zal de naam van het systeem gebruikt worden.'; - -// ADDED IN FROXLOR 0.9.4-svn1 -$lng['ftp']['account_edit'] = 'FTP account aanpassen'; -$lng['ftp']['editpassdescription'] = 'Nieuw wachtwoord of leeg voor het oude wachtwoord.'; -$lng['customer']['sendinfomail'] = 'Stuur gegevens naar mij via e-mail'; -$lng['mails']['new_database_by_customer']['subject'] = '[Froxlor] Nieuwe database aangemaakt'; -$lng['mails']['new_database_by_customer']['mailbody'] = "Geachte {CUST_NAME},\n\nu hebt zojuist een nieuwe database aangemaakt. Hier zijn nogmaals de ingevoerde gegevens:\n\nNaam database: {DB_NAME}\nWachtwoord: {DB_PASS}\nBeschrijving: {DB_DESC}\nHostnaam database: {DB_SRV}\nphpMyAdmin: {PMA_URI}\nMet vriendelijke groet, uw beheerder"; -$lng['serversettings']['awstats_path'] = 'Pad naar \'awstats_buildstaticpages.pl\' van AWStats'; -$lng['serversettings']['awstats_conf'] = 'AWStats configuratiepad'; -$lng['error']['overviewsettingoptionisnotavalidfield'] = 'Woops, a field that should be displayed as an option in the settings-overview is not an excepted type. You can blame the developers for this. This should not happen!'; -$lng['admin']['configfiles']['compactoverview'] = 'Compacte weergave'; -$lng['admin']['lastlogin_succ'] = 'Laatste login'; -$lng['panel']['neverloggedin'] = 'Nog niet ingelogd'; - -// ADDED IN FROXLOR 0.9.6-svn1 -$lng['serversettings']['defaultttl'] = 'Standaard TTL voor domeinen in seconden (standaard \'604800\' = 1 week)'; - -// ADDED IN FROXLOR 0.9.6-svn3 -$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Standaard foutdocumenten voor alle klanten activeren'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'Bestand/URL voor foutcode 401'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '
Wordt niet ondersteund in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'Bestand/URL voor foutcode 403'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '
Wordt niet ondersteund in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'Bestand/URL voor foutcode 404'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'Bestand/URL voor foutcode 500'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '
Wordt niet ondersteund in: lighttpd
'; - -// ADDED IN FROXLOR 0.9.6-svn5 -$lng['serversettings']['mod_fcgid']['defaultini'] = 'Standaard PHP-configuratie voor nieuwe domeinen'; - -// ADDED IN FROXLOR 0.9.6-svn6 -$lng['admin']['ftpserver'] = 'FTP Server'; -$lng['admin']['ftpserversettings'] = 'Instellingen FTP-server'; -$lng['serversettings']['ftpserver']['desc'] = 'Indien PureFTPD geselecteerd is, worden .ftpquota bestanden dagelijks aangemaakt en/of bijgewerkt'; - -// CHANGED IN FROXLOR 0.9.6-svn6 -$lng['serversettings']['ftpprefix']['description'] = 'Welk voorvoegsel dienen nieuwe FTP-accounts te krijgen?
Indien u dit wijzigt, dient ook de query voor Quota in het configuratiebestand van de FTP-server aan te passen! '; - -// ADDED IN FROXLOR 0.9.7-svn1 -$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'Nieuwe FTP-gebruiker aangemaakt'; -$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Geachte {CUST_NAME},\n\nu hebt zojuist een nieuwe FTP-gebruiker aangemaakt. Hier is de opgegeven informatie:\n\nGebruikersnaam: {USR_NAME}\nWachtwoord: {USR_PASS}\nPad: {USR_PATH}\n\nMet vriendelijke groet, uw beheerder"; -$lng['domains']['redirectifpathisurl'] = 'Doorverwijzingscode (standaard: leegt)'; -$lng['domains']['redirectifpathisurlinfo'] = 'U dient deze alleen op te geven indien u een URL als pad hebt opgegeven'; -$lng['serversettings']['customredirect_enabled']['title'] = 'Klanten toestaan doorverwijzingen te maken'; -$lng['serversettings']['customredirect_enabled']['description'] = 'Klanten toestaan de HTTP-statuscode aan te passen die voor doorverwijzingen gebruikt worden'; -$lng['serversettings']['customredirect_default']['title'] = 'Standaard doorverwijzing'; -$lng['serversettings']['customredirect_default']['description'] = 'Kies de standaard doorverwijzingscode indien de klant dit zelf niet gedaan heeft'; - -// ADDED IN FROXLOR 0.9.7-svn2 -$lng['error']['pathmaynotcontaincolon'] = 'Het opgegeven pad mag geen dubbele punt (":") bevatten. Geef een correct pad op.'; - -// ADDED IN FROXLOR 0.9.8 -$lng['error']['exception'] = '%s'; - -// ADDED IN FROXLOR 0.9.9-svn1 -$lng['serversettings']['mail_also_with_mxservers'] = 'Maak mail-, imap-, pop3- en smtp-"A record" ook wanneer MX-Servers zijn ingesteld'; - -// ADDED IN FROXLOR 0.9.10-svn1 -$lng['admin']['webserver_user'] = 'Gebruikersnaam webserver'; -$lng['admin']['webserver_group'] = 'Groepnaam webserver'; - -// ADDED IN FROXLOR 0.9.10 -$lng['serversettings']['froxlordirectlyviahostname'] = 'Froxlor is direct toegankelijk via hostnaam'; - -// ADDED IN FROXLOR 0.9.11-svn1 -$lng['serversettings']['panel_password_regex']['title'] = 'Reguliere expressie voor wachtwoorden'; -$lng['serversettings']['panel_password_regex']['description'] = 'Hier kunt u een reguliere expressie opgeven voor de complexiteit van wachtwoorden.
Leeg betekent geen speciale complexiteit'; -$lng['error']['notrequiredpasswordcomplexity'] = 'Er is niet voldaan aan de complexiteit voor het wachtwoord (regex: %s)'; - -// ADDED IN FROXLOR 0.9.11-svn2 -$lng['extras']['execute_perl'] = 'perl/CGI uitvoeren'; -$lng['admin']['perlenabled'] = 'Perl ingeschakeld'; - -// ADDED IN FROXLOR 0.9.11-svn3 -$lng['serversettings']['perl_path']['title'] = 'Pad naar Perl'; -$lng['serversettings']['perl_path']['description'] = 'Alleen relevant voor lighttpd. Standaard is /usr/bin/perl'; - -// ADDED IN FROXLOR 0.9.12-svn1 -$lng['admin']['fcgid_settings'] = 'FCGID'; -$lng['serversettings']['mod_fcgid_ownvhost']['title'] = 'FCGID inschakelen voor de VHost voor Froxlor'; -$lng['serversettings']['mod_fcgid_ownvhost']['description'] = 'Indien ingeschakeld wordt Froxlor ook uitgevoerd onder een lokale gebruiker
Let op:Dit vereist handmatige configuratie, zie FCGID - handbook'; -$lng['admin']['mod_fcgid_user'] = 'Lokale gebruiker voor FCGID (Froxlor vhost)'; -$lng['admin']['mod_fcgid_group'] = 'Lokale groep voor FCGID (Froxlor vhost)'; - -// ADDED IN FROXLOR 0.9.12-svn2 -$lng['admin']['perl_settings'] = 'Perl/CGI'; -$lng['serversettings']['perl']['suexecworkaround']['title'] = 'Om SuExec heenwerken (Geldt alleen voor Apache)'; -$lng['serversettings']['perl']['suexecworkaround']['description'] = 'Schakel dit alleen in indien de documentmappen van klanten niet in het pad van Apache SuExec vallen.
Indien ingeschakeld zal Froxlor een symbolische link maken voor het pad waarvoor Perl actief is + /cgi-bin/.
Merk op dat Perl dan alleen werkt in de submap /cgi-bin/ en niet in de map zelf (zoals het werkt zonder deze oplossing!)'; -$lng['serversettings']['perl']['suexeccgipath']['title'] = 'Pad naar symbolische links naar Perl-mappen van klanten'; -$lng['serversettings']['perl']['suexeccgipath']['description'] = 'U dient dit alleen op te geven indien "Om SuExec heenwerken" actief is.
LET OP: Zorg ervoor dat deze map onder het pad van SuExec valt, anders is deze oplossing waardeloos'; -$lng['panel']['descriptionerrordocument'] = 'Kan een URL, pad naar een bestand of een tekenreeks zijn die is omsloten door " "
Laat leeg voor de standaardwaarde.'; -$lng['error']['stringerrordocumentnotvalidforlighty'] = 'Een tekenreeks als ErrorDocument werkt niet in lighttpd. Geef een pad naar een bestand'; -$lng['error']['urlerrordocumentnotvalidforlighty'] = 'Een tekenreeks als ErrorDocument werkt niet in lighttpd. Geef een pad naar een bestand'; - -// ADDED IN FROXLOR 0.9.12-svn3 -$lng['question']['remove_subbutmain_domains'] = 'Verwijder ook domeinen die als volledige domeinen zijn opgegeven maar een subdomein zijn van dit domein?'; -$lng['domains']['issubof'] = 'Dit domein is een subdomein van een ander domein'; -$lng['domains']['issubofinfo'] = 'U dient het correcte domein op te geven indien u een subdomein als volledig domein wilt (bijvoorbeeld als u "www.domain.tld" wilt gebruiken, dan geeft u hier "domain.tld")'; -$lng['domains']['nosubtomaindomain'] = 'Geen subdomein van volledig domein'; -$lng['admin']['templates']['new_database_by_customer'] = 'Klantnotificatie wanneer een database is aangemaakt'; -$lng['admin']['templates']['new_ftpaccount_by_customer'] = 'Klantnotificatie wanneer een FTP-gebruiker is aangemaakt'; -$lng['admin']['templates']['newdatabase'] = 'Notificatie mails voor nieuwe databases'; -$lng['admin']['templates']['newftpuser'] = 'Notificatie mails voor nieuwe FTP-gebruikers'; -$lng['admin']['templates']['CUST_NAME'] = 'Naam klant'; -$lng['admin']['templates']['DB_NAME'] = 'Naam database'; -$lng['admin']['templates']['DB_PASS'] = 'Wachtwoord database'; -$lng['admin']['templates']['DB_DESC'] = 'Beschrijving database'; -$lng['admin']['templates']['DB_SRV'] = 'Database server'; -$lng['admin']['templates']['PMA_URI'] = 'URL naar phpMyAdmin (indien opgegeven)'; -$lng['admin']['notgiven'] = '[niet opgegeven]'; -$lng['admin']['templates']['USR_NAME'] = 'Gebruikersnaam FTP'; -$lng['admin']['templates']['USR_PASS'] = 'Wachtwoord FTP'; -$lng['admin']['templates']['USR_PATH'] = 'Map FTP (relatief aan docroot van klant)'; - -// ADDED IN FROXLOR 0.9.12-svn4 -$lng['serversettings']['awstats_awstatspath'] = 'Pad naar AWStats \'awstats.pl\''; - -// ADDED IN FROXLOR 0.9.12-svn6 -$lng['extras']['htpasswdauthname'] = 'Reden voor authenticatie (AuthName)'; -$lng['extras']['directoryprotection_edit'] = 'mapbeveiliging aanpassen'; -$lng['admin']['templates']['forgotpwd'] = 'Notificatie mails voor opnieuw instellen wachtwoord'; -$lng['admin']['templates']['password_reset'] = 'Klantnotificatie voor opnieuw instellen wachtwoord'; -$lng['admin']['store_defaultindex'] = 'Standaard indexbestand opslaan in map klant'; - -// ADDED IN FROXLOR 0.9.14-svn1 -$lng['serversettings']['mod_fcgid']['defaultini_ownvhost'] = 'Standaard configuratie voor Froxlor-vHost'; - -// ADDED IN FROXLOR 0.9.14-svn3 -$lng['serversettings']['awstats_icons']['title'] = 'Pad naar iconen AWstats icons'; -$lng['serversettings']['awstats_icons']['description'] = 'bijvoorbeeld /usr/share/awstats/htdocs/icon/'; - -// ADDED IN FROXLOR 0.9.14-svn5 -$lng['admin']['ipsandports']['docroot']['title'] = 'Aangepaste docroot (leeg = verwijzing naar Froxlor)'; -$lng['admin']['ipsandports']['docroot']['description'] = 'U kunt voor deze IP/poortcombinatie een aangepaste document-root opgeven.
LET OP: Pas op wat u hier neerzet!'; - -// ADDED IN FROXLOR 0.9.14-svn6 -$lng['serversettings']['login_domain_login'] = 'Login met domeinen toestaan'; - -// ADDED IN FROXLOR 0.9.14 -$lng['panel']['unlock'] = 'ontgrendelen'; -$lng['question']['customer_reallyunlock'] = 'Weet u zeker dat u klant %s? wilt ontgrendelen'; - -// ADDED IN FROXLOR 0.9.15-svn1 -$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend'; -$lng['serversettings']['nginx_php_backend']['description'] = 'dit is waar het PHP-proces luistert naar verzoeken van nginx, kan een unix socket van ip:poort combinatie zijn'; -$lng['serversettings']['phpreload_command']['title'] = 'Commando voor het herladen van PHP'; -$lng['serversettings']['phpreload_command']['description'] = 'wordt gebruikt om de PHP backend opnieuw te laden, indien actief
Standaard: leeg'; - -// ADDED IN FROXLOR 0.9.16 -$lng['error']['intvaluetoolow'] = 'Het opgegeven nummer is te laag (veld %s)'; -$lng['error']['intvaluetoohigh'] = 'Het opgegeven nummer is te hoog (veld %s)'; -$lng['admin']['phpfpm_settings'] = 'PHP-FPM'; -$lng['serversettings']['phpfpm'] = 'php-fpm inschakelen'; -$lng['serversettings']['phpfpm_settings']['configdir'] = 'Configuratiemap van php-fpm'; -$lng['serversettings']['phpfpm_settings']['reload'] = 'Commando voor het herstarten van php-fpm'; -$lng['serversettings']['phpfpm_settings']['pm'] = 'Process manager control (pm)'; -$lng['serversettings']['phpfpm_settings']['max_children']['title'] = 'Het aantal subprocessen'; -$lng['serversettings']['phpfpm_settings']['max_children']['description'] = 'Het aantal subprocessen dat gestart wordt indien PM is ingesteld op \'statisch\' en het maximum aantal subprocessen wanneer PM is ingesteld op \'dynamisch\'
Gelijk aan PHP_FCGI_CHILDREN'; -$lng['serversettings']['phpfpm_settings']['start_servers']['title'] = 'Het aantal subprocessen bij het starten'; -$lng['serversettings']['phpfpm_settings']['start_servers']['description'] = 'Noot: Wordt alleen gebruikt indien PM is ingesteld op \'dynamisch\''; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['title'] = 'Het gewenste minimum aantal vrije subprocessen'; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['description'] = 'Noot: Wordt alleen gebruikt indien PM is ingesteld op \'dynamisch\'
Noot: Verplicht wanneer PM ingesteld is op \'dynamisch\''; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['title'] = 'THet gewenste minimum aantal vrije subprocessen'; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['description'] = 'Noot: Wordt alleen gebruikt indien PM is ingesteld op \'dynamisch\'
Noot: Verplicht wanneer PM ingesteld is op \'dynamisch\''; -$lng['serversettings']['phpfpm_settings']['max_requests']['title'] = 'Verzoeken voor subproces voordat het opnieuw gestart wordt'; -$lng['serversettings']['phpfpm_settings']['max_requests']['description'] = 'Voor het eindeloos verwerken kunt u deze waarde instellen op \'0\'. Gelijk aan PHP_FCGI_MAX_REQUESTS.'; -$lng['error']['phpfpmstillenabled'] = 'PHP-FPM is op dit moment actief. Schakel dit eerst uit voordat u FCGID inschakelt'; -$lng['error']['fcgidstillenabled'] = 'FCGID is op dit moment actief. Schakel dit eerst uit voordat u PHP-FPM inschakelt'; diff --git a/lng/en.lng.php b/lng/en.lng.php new file mode 100644 index 00000000..fce25502 --- /dev/null +++ b/lng/en.lng.php @@ -0,0 +1,2451 @@ + + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + 'languages' => [ + 'cz' => 'Czech', + 'de' => 'German', + 'en' => 'English', + 'fr' => 'French', + 'it' => 'Italia', + 'nl' => 'Dutch', + 'pt' => 'Portuguese', + 'se' => 'Swedish', + ], + '2fa' => [ + '2fa' => '2FA options', + '2fa_enabled' => 'Activate Two-factor authentication (2FA)', + '2fa_removed' => '2FA removed successfully', + '2fa_added' => '2FA activated successfully
View 2FA details', + '2fa_add' => 'Activate 2FA', + '2fa_delete' => 'Deactivate 2FA', + '2fa_verify' => 'Verify code', + '2fa_overview_desc' => 'Here you can activate a two-factor authentication for your account.

You can either use an authenticator-app (time-based one-time password / TOTP) or let froxlor send you an email to your account-address after each successful login with a one-time password.', + '2fa_email_desc' => 'Your account is set up to use one-time passwords via e-mail. To deactivate, click on "Deactivate 2FA"', + '2fa_ga_desc' => 'Your account is set up to use time-based one-time passwords via authenticator-app. Please scan the QR code below with your desired authenticator app to generate the codes. To deactivate, click on "Deactivate 2FA"', + ], + 'admin' => [ + 'overview' => 'Overview', + 'ressourcedetails' => 'Used resources', + 'systemdetails' => 'System details', + 'froxlordetails' => 'Froxlor details', + 'installedversion' => 'Installed version', + 'latestversion' => 'Latest version', + 'lookfornewversion' => [ + 'clickhere' => 'Search via webservice', + 'error' => 'Error while reading', + ], + 'resources' => 'Resources', + 'customer' => 'Customer', + 'customers' => 'Customers', + 'customer_add' => 'Create customer', + 'customer_edit' => 'Edit customer', + 'domains' => 'Domains', + 'domain_add' => 'Create domain', + 'domain_edit' => 'Edit domain', + 'subdomainforemail' => 'Subdomains as email-domains', + 'admin' => 'Admin', + 'admins' => 'Admins', + 'admin_add' => 'Create admin', + 'admin_edit' => 'Edit admin', + 'customers_see_all' => 'Can see all customers?', + 'domains_see_all' => 'Can see all domains?', + 'change_serversettings' => 'Can change server settings?', + 'server' => 'System', + 'serversettings' => 'Settings', + 'rebuildconf' => 'Rebuild config files', + 'stdsubdomain' => 'Standard subdomain', + 'stdsubdomain_add' => 'Create standard subdomain', + 'phpenabled' => 'PHP enabled', + 'deactivated' => 'Deactivated', + 'deactivated_user' => 'Deactivate user', + 'sendpassword' => 'Send password', + 'ownvhostsettings' => 'Own vHost-settings', + 'configfiles' => [ + 'serverconfiguration' => 'Configuration', + 'overview' => 'Overview', + 'wizard' => 'Wizard', + 'distribution' => 'Distribution', + 'service' => 'Service', + 'daemon' => 'Daemon', + 'http' => 'Webserver (HTTP)', + 'dns' => 'Nameserver (DNS)', + 'mail' => 'Mailserver (IMAP/POP3)', + 'smtp' => 'Mailserver (SMTP)', + 'ftp' => 'FTP-server', + 'etc' => 'Others (System)', + 'choosedistribution' => '-- Choose a distribution --', + 'chooseservice' => '-- Choose a service --', + 'choosedaemon' => '-- Choose a daemon --', + 'statistics' => 'Statistics', + 'compactoverview' => 'Compact-overview', + 'legend' => '

You are about to configure a service/daemon

', + 'commands' => 'Commands: These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.', + 'files' => 'Config files: The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.
Please note: The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"', + 'importexport' => 'Import/Export', + 'finishnote' => 'Parameter file generated successfully. Now run the following command as root:', + 'description' => 'Configure the system services', + 'skipconfig' => 'Don\'t (re)configure', + 'recommendednote' => 'Recommended/required services based on current system settings', + 'selectrecommended' => 'Select recommended', + ], + 'templates' => [ + 'templates' => 'Email-templates', + 'template_add' => 'Add template', + 'template_fileadd' => 'Add file template', + 'template_edit' => 'Edit template', + 'action' => 'Action', + 'email' => 'Email & file templates', + 'subject' => 'Subject', + 'mailbody' => 'Mail body', + 'createcustomer' => 'Welcome mail for new customers', + 'pop_success' => 'Welcome mail for new email accounts', + 'template_replace_vars' => 'Variables to be replaced in the template:', + 'SALUTATION' => 'Replaced with a correct salutation (name or company)', + 'FIRSTNAME' => 'Replaced with the customer\'s first name.', + 'NAME' => 'Replaced with the customers name.', + 'COMPANY' => 'Replaces with the customer\'s company name', + 'USERNAME' => 'Replaced with the customer\'s account username.', + 'PASSWORD' => 'Replaced with the customer\'s account password.', + 'EMAIL' => 'Replaced with the address of the POP3/IMAP account.', + 'CUSTOMER_NO' => 'Replaces with the customer number', + 'TRAFFIC' => 'Replaced with the traffic in MB, which was assigned to the customer.', + 'TRAFFICUSED' => 'Replaced with the traffic in MB, which was exhausted by the customer.', + 'pop_success_alternative' => 'Welcome mail for new email accounts sent to alternative address', + 'EMAIL_PASSWORD' => 'Replaced with the POP3/IMAP account password.', + 'index_html' => 'index file for newly created customer directories', + 'SERVERNAME' => 'Replaced with the servername.', + 'CUSTOMER' => 'Replaced with the loginname of the customer.', + 'ADMIN' => 'Replaced with the loginname of the admin.', + 'CUSTOMER_EMAIL' => 'Replaced with the e-mail address of the customer.', + 'ADMIN_EMAIL' => 'Replaced with the e-mail address of the admin.', + 'filetemplates' => 'File templates', + 'filecontent' => 'File content', + 'new_database_by_customer' => 'Customer-notification when a database has been created', + 'new_ftpaccount_by_customer' => 'Customer-notification when a ftp-user has been created', + 'newdatabase' => 'Notification-mails for new databases', + 'newftpuser' => 'Notification-mails for new ftp-user', + 'CUST_NAME' => 'Customer name', + 'DB_NAME' => 'Database name', + 'DB_PASS' => 'Database password', + 'DB_DESC' => 'Database description', + 'DB_SRV' => 'Database server', + 'PMA_URI' => 'URL to phpMyAdmin (if given)', + 'USR_NAME' => 'FTP username', + 'USR_PASS' => 'FTP password', + 'USR_PATH' => 'FTP homedir (relative to customer-docroot)', + 'forgotpwd' => 'Notification-mails for password-reset', + 'password_reset' => 'Customer-notification for passwort-reset', + 'trafficmaxpercent' => 'Notification mail for customers when given maximum of percent of traffic is exhausted', + 'MAX_PERCENT' => 'Replaced with the diskusage/traffic limit for sending reports in percent.', + 'USAGE_PERCENT' => 'Replaced with the diskusage/traffic, which was exhausted by the customer in percent.', + 'diskmaxpercent' => 'Notification mail for customers when given maximum of percent of diskspace is exhausted', + 'DISKAVAILABLE' => 'Replaced with the diskusage in MB, which was assigned to the customer.', + 'DISKUSED' => 'Replaced with the diskusage in MB, which was exhausted by the customer.', + 'LINK' => 'Replaced with the customers password reset link.', + 'SERVER_HOSTNAME' => 'Replaces the system-hostname (URL to froxlor)', + 'SERVER_IP' => 'Replaces the default server ip-address', + 'SERVER_PORT' => 'Replaces the default server port', + 'DOMAINNAME' => 'Replaces the customers standard-subdomain (can be empty if none is generated)', + ], + 'webserver' => 'Webserver', + 'bindzonewarning' => 'empty for defaults
ATTENTION: If you use a zonefile you will have to manage all required records for all sub-zones manually as well.', + 'ipsandports' => [ + 'ipsandports' => 'IPs and Ports', + 'add' => 'Add IP/Port', + 'edit' => 'Edit IP/Port', + 'ipandport' => 'IP/Port', + 'ip' => 'IP', + 'ipnote' => '
Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.
Only use private ip addresses if you are sure.
', + 'port' => 'Port', + 'create_listen_statement' => 'Create Listen statement', + 'create_namevirtualhost_statement' => 'Create NameVirtualHost statement', + 'create_vhostcontainer' => 'Create vHost-Container', + 'create_vhostcontainer_servername_statement' => 'Create ServerName statement in vHost-Container', + 'enable_ssl' => 'Is this an SSL Port?', + 'ssl_cert_file' => 'Path to the SSL Certificate', + 'webserverdefaultconfig' => 'Webserver default config', + 'webserverdomainconfig' => 'Webserver domain config', + 'webserverssldomainconfig' => 'Webserver SSL config', + 'ssl_key_file' => 'Path to the SSL Keyfile', + 'ssl_ca_file' => 'Path to the SSL CA certificate', + 'default_vhostconf_domain' => 'Default vHost-settings for every domain container', + 'ssl_cert_chainfile' => [ + 'title' => 'Path to the SSL CertificateChainFile', + 'description' => 'Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.', + ], + 'docroot' => [ + 'title' => 'Custom docroot (empty = point to Froxlor)', + 'description' => 'You can define a custom document-root (the destination for a request) for this ip/port combination here.
ATTENTION: Please be careful with what you enter here!', + ], + 'ssl_paste_description' => 'Paste your complete certificate content in the textbox', + 'ssl_cert_file_content' => 'Content of the ssl certificate', + 'ssl_key_file_content' => 'Content of the ssl (private-) key file', + 'ssl_ca_file_content' => 'Content of the ssl CA file (optional)', + 'ssl_ca_file_content_desc' => '

Client authentication, set this only if you know what it is.', + 'ssl_cert_chainfile_content' => 'Content of the certificate chain file (optional)', + 'ssl_cert_chainfile_content_desc' => '

Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.', + 'ssl_default_vhostconf_domain' => 'Default SSL vHost-settings for every domain container', + ], + 'memorylimitdisabled' => 'Disabled', + 'valuemandatory' => 'This value is mandatory', + 'valuemandatorycompany' => 'Either "name" and "firstname" or "company" must be filled', + 'serversoftware' => 'Serversoftware', + 'phpversion' => 'PHP-Version', + 'mysqlserverversion' => 'MySQL server version', + 'webserverinterface' => 'Webserver interface', + 'accountsettings' => 'Account settings', + 'panelsettings' => 'Panel settings', + 'systemsettings' => 'System settings', + 'webserversettings' => 'Webserver settings', + 'mailserversettings' => 'Mailserver settings', + 'nameserversettings' => 'Nameserver settings', + 'updatecounters' => 'Recalculate resource usage', + 'subcanemaildomain' => [ + 'never' => 'Never', + 'choosableno' => 'Choosable, default no', + 'choosableyes' => 'Choosable, default yes', + 'always' => 'Always', + ], + 'wipecleartextmailpwd' => 'Clear plaintext passwords', + 'webalizersettings' => 'Webalizer settings', + 'webalizer' => [ + 'normal' => 'Normal', + 'quiet' => 'Quiet', + 'veryquiet' => 'No output', + ], + 'domain_nocustomeraddingavailable' => 'It\'s not possible to add a domain currently. You first need to add at least one customer.', + 'loggersettings' => 'Log settings', + 'logger' => [ + 'normal' => 'normal', + 'paranoid' => 'paranoid', + ], + 'loggersystem' => 'System log', + 'emaildomain' => 'Emaildomain', + 'email_only' => 'Only email?', + 'wwwserveralias' => 'Add a "www." ServerAlias', + 'subject' => 'Subject', + 'recipient' => 'Recipient', + 'message' => 'Write a Message', + 'text' => 'Message', + 'sslsettings' => 'SSL settings', + 'specialsettings_replacements' => 'You can use the following variables:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (if applicable)
', + 'dkimsettings' => 'DomainKey settings', + 'caneditphpsettings' => 'Can change php-related domain settings?', + 'allips' => 'All IP\'s', + 'awstatssettings' => 'AWstats settings', + 'domain_dns_settings' => 'Domain dns settings', + 'activated' => 'Activated', + 'statisticsettings' => 'Statistic settings', + 'or' => 'or', + 'sysload' => 'System load', + 'noloadavailable' => 'not available', + 'nouptimeavailable' => 'not available', + 'nosubject' => '(No Subject)', + 'security_settings' => 'Security Options', + 'know_what_youre_doing' => 'Change only, if you know what you\'re doing!', + 'show_version_login' => [ + 'title' => 'Show Froxlor version on login', + 'description' => 'Show the Froxlor version in the footer on the login page', + ], + 'show_version_footer' => [ + 'title' => 'Show Froxlor version in footer', + 'description' => 'Show the Froxlor version in the footer on the rest of the pages', + ], + 'froxlor_graphic' => [ + 'title' => 'Header graphic for Froxlor', + 'description' => 'What graphic should be shown in the header', + ], + 'phpsettings' => [ + 'title' => 'PHP Configuration', + 'description' => 'Short description', + 'actions' => 'Actions', + 'activedomains' => 'In use for domain(s)', + 'notused' => 'Configuration not in use', + 'editsettings' => 'Change PHP settings', + 'addsettings' => 'Create new PHP settings', + 'viewsettings' => 'View PHP settings', + 'phpinisettings' => 'php.ini settings', + 'addnew' => 'Create new PHP configuration', + 'binary' => 'PHP Binary', + 'fpmdesc' => 'PHP-FPM config', + 'file_extensions' => 'File extensions', + 'file_extensions_note' => '(without dot, separated by spaces)', + 'enable_slowlog' => 'Enable slowlog (per domain)', + 'request_terminate_timeout' => 'Request terminate-timeout', + 'request_slowlog_timeout' => 'Request slowlog-timeout', + 'activephpconfigs' => 'In use for php-config(s)', + 'pass_authorizationheader' => 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts', + ], + 'misc' => 'Miscellaneous', + 'fpmsettings' => [ + 'addnew' => 'Create new PHP version', + ], + 'phpconfig' => [ + 'template_replace_vars' => 'Variables that will be replaced in the configs', + 'pear_dir' => 'Will be replaced with the global setting for the pear directory.', + 'open_basedir_c' => 'Will insert a ; (semicolon) to comment-out/disable open_basedir when set', + 'open_basedir' => 'Will be replaced with the open_basedir setting of the domain.', + 'tmp_dir' => 'Will be replaced with the temporary directory of the domain.', + 'open_basedir_global' => 'Will be replaced with the global value of the path which will be attached to the open_basedir (see webserver settings).', + 'customer_email' => 'Will be replaced with the e-mail address of the customer who owns this domain.', + 'admin_email' => 'Will be replaced with e-mail address of the admin who owns this domain.', + 'domain' => 'Will be replaced with the domain.', + 'customer' => 'Will be replaced with the loginname of the customer who owns this domain.', + 'admin' => 'Will be replaced with the loginname of the admin who owns this domain.', + 'docroot' => 'Will be replaced with the domain\'s document-root.', + 'homedir' => 'Will be replaced with the customer\'s home-directory.', + ], + 'expert_settings' => 'Expert settings!', + 'mod_fcgid_starter' => [ + 'title' => 'PHP Processes for this domain (empty for default value)', + ], + 'phpserversettings' => 'PHP Settings', + 'mod_fcgid_maxrequests' => [ + 'title' => 'Maximum php requests for this domain (empty for default value)', + ], + 'spfsettings' => 'Domain SPF settings', + 'specialsettingsforsubdomains' => 'Apply specialsettings to all subdomains (*.example.com)', + 'accountdata' => 'Account Data', + 'contactdata' => 'Contact Data', + 'servicedata' => 'Service Data', + 'newerversionavailable' => 'There is a newer version of Froxlor available', + 'cron' => [ + 'cronsettings' => 'Cronjob settings', + 'add' => 'Add cronjob', + ], + 'cronjob_edit' => 'Edit cronjob', + 'warning' => 'WARNING - Please note!', + 'lastlogin_succ' => 'Last login', + 'ftpserver' => 'FTP Server', + 'ftpserversettings' => 'FTP Server settings', + 'webserver_user' => 'Webserver user-name', + 'webserver_group' => 'Webserver group-name', + 'perlenabled' => 'Perl enabled', + 'fcgid_settings' => 'FCGID', + 'mod_fcgid_user' => 'Local user to use for FCGID (Froxlor vHost)', + 'mod_fcgid_group' => 'Local group to use for FCGID (Froxlor vHost)', + 'perl_settings' => 'Perl/CGI', + 'notgiven' => '[not given]', + 'store_defaultindex' => 'Store default index-file to customers docroot', + 'phpfpm_settings' => 'PHP-FPM', + 'traffic' => 'Traffic', + 'domaintraffic' => 'Domains', + 'customertraffic' => 'Customers', + 'assignedmax' => 'Assigned / Max', + 'usedmax' => 'Used / Max', + 'used' => 'Used', + 'speciallogwarning' => '
WARNING: By changing this setting you will lose all your old statistics for this domain.
', + 'speciallogfile' => [ + 'title' => 'Separate logfile', + 'description' => 'Enable this to get a separate access-log file for this domain', + ], + 'domain_editable' => [ + 'title' => 'Allow editing of domain', + 'desc' => 'If set to yes, the customer is allowed to change several domain-settings.
If set to no, nothing can be changed by the customer.', + ], + 'writeaccesslog' => [ + 'title' => 'Write an access log', + 'description' => 'Enable this to get an access-log file for this domain', + ], + 'writeerrorlog' => [ + 'title' => 'Write an error log', + 'description' => 'Enable this to get an error-log file for this domain', + ], + 'phpfpm.ininote' => 'Not all values you may want to define can be used in the php-fpm pool configuration', + 'phpinfo' => 'PHPinfo()', + 'selectserveralias' => 'ServerAlias value for the domain', + 'selectserveralias_desc' => 'Choose whether froxlor should create a wildcard-entry (*.domain.tld), a WWW-alias (www.domain.tld) or no alias at all', + 'show_news_feed' => [ + 'title' => 'Show news-feed on admin-dashboard', + 'description' => 'Enable this to show the official Froxlor newsfeed (https://inside.froxlor.org/news/) on your dashboard and never miss important information or release-announcements.', + ], + 'cronsettings' => 'Cronjob settings', + 'integritycheck' => 'Database validation', + 'integrityid' => '#', + 'integrityname' => 'Name', + 'integrityresult' => 'Result', + 'integrityfix' => 'Fix problems automatically', + 'customer_show_news_feed' => 'Show newsfeed on customer-dashboard', + 'customer_news_feed_url' => [ + 'title' => 'Use custom RSS-feed', + 'description' => 'Specify a custom RSS-feed that will be shown to your customers on their dashboard.
Leave this empty to use the official froxlor newsfeed (https://inside.froxlor.org/news/).', + ], + 'movetoadmin' => 'Move customer', + 'movecustomertoadmin' => 'Move customer to the selected admin/reseller
Leave this empty for no change.
If the desired admin does not show up in the list, his customer-limit has been reached.', + 'note' => 'Note', + 'mod_fcgid_umask' => [ + 'title' => 'Umask (default: 022)', + ], + 'apcuinfo' => 'APCu info', + 'opcacheinfo' => 'OPcache Info', + 'letsencrypt' => [ + 'title' => 'Use Let\'s Encrypt', + 'description' => 'Get a free certificate from Let\'s Encrypt. The certificate will be created and renewed automatically.
ATTENTION: If wildcards are enabled, this option will automatically be disabled.', + ], + 'autoupdate' => 'Auto-Update', + 'server_php' => 'PHP', + 'dnsenabled' => 'Enable DNS editor', + 'froxlorvhost' => 'Froxlor VirtualHost settings', + 'hostname' => 'Hostname', + 'memory' => 'Memory usage', + 'webserversettings_ssl' => 'Webserver SSL settings', + 'domain_hsts_maxage' => [ + 'title' => 'HTTP Strict Transport Security (HSTS)', + 'description' => 'Specify the max-age value for the Strict-Transport-Security header
The value 0 will disable HSTS for the domain. Most user set a value of 31536000 (one year).', + ], + 'domain_hsts_incsub' => [ + 'title' => 'Include HSTS for any subdomain', + 'description' => 'The optional "includeSubDomains" directive, if present, signals the UA that the HSTS Policy applies to this HSTS Host as well as any subdomains of the host\'s domain name.', + ], + 'domain_hsts_preload' => [ + 'title' => 'Include domain in HSTS preload list', + 'description' => 'If you would like this domain to be included in the HSTS preload list maintained by Chrome (and used by Firefox and Safari), then use activate this.
Sending the preload directive from your site can have PERMANENT CONSEQUENCES and prevent users from accessing your site and any of its subdomains.
Please read the details at hstspreload.appspot.com/#removal before sending the header with "preload".', + ], + 'domain_ocsp_stapling' => [ + 'title' => 'OCSP stapling', + 'description' => 'See Wikipedia for a detailed explanation of OCSP stapling', + 'nginx_version_warning' => '
WARNING: Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!', + ], + 'domain_http2' => [ + 'title' => 'HTTP2 support', + 'description' => 'See Wikipedia for a detailed explanation of HTTP2', + ], + 'testmail' => 'SMTP test', + 'phpsettingsforsubdomains' => 'Apply php-config to all subdomains:', + 'plans' => [ + 'name' => 'Plan name', + 'description' => 'Description', + 'last_update' => 'Last updated', + 'plans' => 'Hosting plans', + 'plan_details' => 'Plan details', + 'add' => 'Add new plan', + 'edit' => 'Edit plan', + 'use_plan' => 'Apply plan', + ], + 'notryfiles' => [ + 'title' => 'No autogenerated try_files', + 'description' => 'Say yes here if you want to specify a custom try_files directive in specialsettings (needed for some wordpress plugins for example).', + ], + 'logviewenabled' => 'Enable access to access/error-logs', + 'novhostcontainer' => '

None of the IPs and ports has the "Create vHost-Container" option enabled, many settings here will not be available', + 'ownsslvhostsettings' => 'Own SSL vHost-settings', + 'domain_override_tls' => 'Override system TLS settings', + 'domain_sslenabled' => 'Enable usage of SSL', + 'domain_honorcipherorder' => 'Honor the (server) cipher order, default no', + 'domain_sessiontickets' => 'Enable TLS sessiontickets (RFC 5077), default yes', + 'domain_sessionticketsenabled' => [ + 'title' => 'Enable usage of TLS sessiontickets globally', + 'description' => 'Default yes
Requires apache-2.4.11+ or nginx-1.5.9+', + ], + 'domaindefaultalias' => 'Default ServerAlias value for new domains', + 'smtpsettings' => 'SMTP settings', + 'smtptestaddr' => 'Send test-mail to', + 'smtptestnote' => 'Note that the values below reflect your current settings and can only be adjusted there (see link in top right corner)', + ], + 'apcuinfo' => [ + 'clearcache' => 'Clear APCu cache', + 'generaltitle' => 'General Cache Information', + 'version' => 'APCu Version', + 'phpversion' => 'PHP Version', + 'host' => 'APCu Host', + 'sharedmem' => 'Shared Memory', + 'sharedmemval' => '%d Segment(s) with %s (%s memory)', + 'start' => 'Start Time', + 'uptime' => 'Uptime', + 'upload' => 'File Upload Support', + 'cachetitle' => 'Cache Information', + 'cvar' => 'Cached Variables', + 'hit' => 'Hits', + 'miss' => 'Misses', + 'reqrate' => 'Request Rate (hits, misses)', + 'creqsec' => 'cache requests/second', + 'hitrate' => 'Hit Rate', + 'missrate' => 'Miss Rate', + 'insrate' => 'Insert Rate', + 'cachefull' => 'Cache full count', + 'runtime' => 'Runtime Settings', + 'memnote' => 'Memory Usage', + 'total' => 'Total', + 'free' => 'Free', + 'used' => 'Used', + 'hitmiss' => 'Hits & Misses', + 'detailmem' => 'Detailed Memory Usage and Fragmentation', + 'fragment' => 'Fragmentation', + 'nofragment' => 'No fragmentation', + 'fragments' => 'Fragments', + ], + 'apikeys' => [ + 'no_api_keys' => 'No API keys found', + 'key_add' => 'Add new key', + 'apikey_removed' => 'The api key with the id #%s has been removed successfully', + 'apikey_added' => 'A new api key has been generated successfully', + 'clicktoview' => 'Click to view', + 'allowed_from' => 'Allowed from', + 'allowed_from_help' => 'Comma separated list of ip addresses / networks.
Default is empty (allow from all).', + 'valid_until' => 'Valid until', + 'valid_until_help' => 'Date until valid, format YYYY-MM-DD', + ], + 'changepassword' => [ + 'old_password' => 'Old password', + 'new_password' => 'New password', + 'new_password_confirm' => 'Confirm password', + 'new_password_ifnotempty' => 'New password (empty = no change)', + 'also_change_ftp' => ' also change password of the main FTP account', + 'also_change_stats' => ' also change password for the statistics page', + ], + 'country' => [ + 'AF' => 'Afghanistan', + 'AX' => 'Aland Islands', + 'AL' => 'Albania', + 'DZ' => 'Algeria', + 'AS' => 'American Samoa', + 'AD' => 'Andorra', + 'AO' => 'Angola', + 'AI' => 'Anguilla', + 'AQ' => 'Antarctica', + 'AG' => 'Antigua and Barbuda', + 'AR' => 'Argentina', + 'AM' => 'Armenia', + 'AW' => 'Aruba', + 'AU' => 'Australia', + 'AT' => 'Austria', + 'AZ' => 'Azerbaijan', + 'BS' => 'Bahamas', + 'BH' => 'Bahrain', + 'BD' => 'Bangladesh', + 'BB' => 'Barbados', + 'BY' => 'Belarus', + 'BE' => 'Belgium', + 'BZ' => 'Belize', + 'BJ' => 'Benin', + 'BM' => 'Bermuda', + 'BT' => 'Bhutan', + 'BO' => 'Bolivia, Plurinational State of', + 'BQ' => 'Bonaire, Saint Eustatius and Saba', + 'BA' => 'Bosnia and Herzegovina', + 'BW' => 'Botswana', + 'BV' => 'Bouvet Island', + 'BR' => 'Brazil', + 'IO' => 'British Indian Ocean Territory', + 'BN' => 'Brunei Darussalam', + 'BG' => 'Bulgaria', + 'BF' => 'Burkina Faso', + 'BI' => 'Burundi', + 'KH' => 'Cambodia', + 'CM' => 'Cameroon', + 'CA' => 'Canada', + 'CV' => 'Cape Verde', + 'KY' => 'Cayman Islands', + 'CF' => 'Central African Republic', + 'TD' => 'Chad', + 'CL' => 'Chile', + 'CN' => 'China', + 'CX' => 'Christmas Island', + 'CC' => 'Cocos (Keeling) Islands', + 'CO' => 'Colombia', + 'KM' => 'Comoros', + 'CG' => 'Congo', + 'CD' => 'Congo, The Democratic Republic of the', + 'CK' => 'Cook Islands', + 'CR' => 'Costa Rica', + 'CI' => 'Cote D\'ivoire', + 'HR' => 'Croatia', + 'CU' => 'Cuba', + 'CW' => 'Curacao', + 'CY' => 'Cyprus', + 'CZ' => 'Czech Republic', + 'DK' => 'Denmark', + 'DJ' => 'Djibouti', + 'DM' => 'Dominica', + 'DO' => 'Dominican Republic', + 'EC' => 'Ecuador', + 'EG' => 'Egypt', + 'SV' => 'El Salvador', + 'GQ' => 'Equatorial Guinea', + 'ER' => 'Eritrea', + 'EE' => 'Estonia', + 'ET' => 'Ethiopia', + 'FK' => 'Falkland Islands (Malvinas)', + 'FO' => 'Faroe Islands', + 'FJ' => 'Fiji', + 'FI' => 'Finland', + 'FR' => 'France', + 'GF' => 'French Guiana', + 'PF' => 'French Polynesia', + 'TF' => 'French Southern Territories', + 'GA' => 'Gabon', + 'GM' => 'Gambia', + 'GE' => 'Georgia', + 'DE' => 'Germany', + 'GH' => 'Ghana', + 'GI' => 'Gibraltar', + 'GR' => 'Greece', + 'GL' => 'Greenland', + 'GD' => 'Grenada', + 'GP' => 'Guadeloupe', + 'GU' => 'Guam', + 'GT' => 'Guatemala', + 'GG' => 'Guernsey', + 'GN' => 'Guinea', + 'GW' => 'Guinea-Bissau', + 'GY' => 'Guyana', + 'HT' => 'Haiti', + 'HM' => 'Heard Island and McDonald Islands', + 'VA' => 'Holy See (Vatican City State)', + 'HN' => 'Honduras', + 'HK' => 'Hong Kong', + 'HU' => 'Hungary', + 'IS' => 'Iceland', + 'IN' => 'India', + 'ID' => 'Indonesia', + 'IR' => 'Iran, Islamic Republic of', + 'IQ' => 'Iraq', + 'IE' => 'Ireland', + 'IM' => 'Isle of Man', + 'IL' => 'Israel', + 'IT' => 'Italy', + 'JM' => 'Jamaica', + 'JP' => 'Japan', + 'JE' => 'Jersey', + 'JO' => 'Jordan', + 'KZ' => 'Kazakhstan', + 'KE' => 'Kenya', + 'KI' => 'Kiribati', + 'KP' => 'Korea, Democratic People\'s Republic of', + 'KR' => 'Korea, Republic of', + 'KW' => 'Kuwait', + 'KG' => 'Kyrgyzstan', + 'LA' => 'Lao People\'s Democratic Republic', + 'LV' => 'Latvia', + 'LB' => 'Lebanon', + 'LS' => 'Lesotho', + 'LR' => 'Liberia', + 'LY' => 'Libyan Arab Jamahiriya', + 'LI' => 'Liechtenstein', + 'LT' => 'Lithuania', + 'LU' => 'Luxembourg', + 'MO' => 'Macao', + 'MK' => 'Macedonia, The Former Yugoslav Republic of', + 'MG' => 'Madagascar', + 'MW' => 'Malawi', + 'MY' => 'Malaysia', + 'MV' => 'Maldives', + 'ML' => 'Mali', + 'MT' => 'Malta', + 'MH' => 'Marshall Islands', + 'MQ' => 'Martinique', + 'MR' => 'Mauritania', + 'MU' => 'Mauritius', + 'YT' => 'Mayotte', + 'MX' => 'Mexico', + 'FM' => 'Micronesia, Federated States of', + 'MD' => 'Moldova, Republic of', + 'MC' => 'Monaco', + 'MN' => 'Mongolia', + 'ME' => 'Montenegro', + 'MS' => 'Montserrat', + 'MA' => 'Morocco', + 'MZ' => 'Mozambique', + 'MM' => 'Myanmar', + 'NA' => 'Namibia', + 'NR' => 'Nauru', + 'NP' => 'Nepal', + 'NL' => 'Netherlands', + 'NC' => 'New Caledonia', + 'NZ' => 'New Zealand', + 'NI' => 'Nicaragua', + 'NE' => 'Niger', + 'NG' => 'Nigeria', + 'NU' => 'Niue', + 'NF' => 'Norfolk Island', + 'MP' => 'Northern Mariana Islands', + 'NO' => 'Norway', + 'OM' => 'Oman', + 'PK' => 'Pakistan', + 'PW' => 'Palau', + 'PS' => 'Palestinian Territory, Occupied', + 'PA' => 'Panama', + 'PG' => 'Papua New Guinea', + 'PY' => 'Paraguay', + 'PE' => 'Peru', + 'PH' => 'Philippines', + 'PN' => 'Pitcairn', + 'PL' => 'Poland', + 'PT' => 'Portugal', + 'PR' => 'Puerto Rico', + 'QA' => 'Qatar', + 'RE' => 'Reunion', + 'RO' => 'Romania', + 'RU' => 'Russian Federation', + 'RW' => 'Rwanda', + 'BL' => 'Saint Barthelemy', + 'SH' => 'Saint Helena, Ascension and Tristan Da Cunha', + 'KN' => 'Saint Kitts and Nevis', + 'LC' => 'Saint Lucia', + 'MF' => 'Saint Martin (French Part)', + 'PM' => 'Saint Pierre and Miquelon', + 'VC' => 'Saint Vincent and the Grenadines', + 'WS' => 'Samoa', + 'SM' => 'San Marino', + 'ST' => 'Sao Tome and Principe', + 'SA' => 'Saudi Arabia', + 'SN' => 'Senegal', + 'RS' => 'Serbia', + 'SC' => 'Seychelles', + 'SL' => 'Sierra Leone', + 'SG' => 'Singapore', + 'SX' => 'Sint Maarten (Dutch Part)', + 'SK' => 'Slovakia', + 'SI' => 'Slovenia', + 'SB' => 'Solomon Islands', + 'SO' => 'Somalia', + 'ZA' => 'South Africa', + 'GS' => 'South Georgia and the South Sandwich Islands', + 'ES' => 'Spain', + 'LK' => 'Sri Lanka', + 'SD' => 'Sudan', + 'SR' => 'Suriname', + 'SJ' => 'Svalbard and Jan Mayen', + 'SZ' => 'Swaziland', + 'SE' => 'Sweden', + 'CH' => 'Switzerland', + 'SY' => 'Syrian Arab Republic', + 'TW' => 'Taiwan, Province of China', + 'TJ' => 'Tajikistan', + 'TZ' => 'Tanzania, United Republic of', + 'TH' => 'Thailand', + 'TL' => 'Timor-Leste', + 'TG' => 'Togo', + 'TK' => 'Tokelau', + 'TO' => 'Tonga', + 'TT' => 'Trinidad and Tobago', + 'TN' => 'Tunisia', + 'TR' => 'Turkey', + 'TM' => 'Turkmenistan', + 'TC' => 'Turks and Caicos Islands', + 'TV' => 'Tuvalu', + 'UG' => 'Uganda', + 'UA' => 'Ukraine', + 'AE' => 'United Arab Emirates', + 'GB' => 'United Kingdom', + 'US' => 'United States', + 'UM' => 'United States Minor Outlying Islands', + 'UY' => 'Uruguay', + 'UZ' => 'Uzbekistan', + 'VU' => 'Vanuatu', + 'VE' => 'Venezuela, Bolivarian Republic of', + 'VN' => 'Viet Nam', + 'VG' => 'Virgin Islands, British', + 'VI' => 'Virgin Islands, U.S.', + 'WF' => 'Wallis and Futuna', + 'EH' => 'Western Sahara', + 'YE' => 'Yemen', + 'ZM' => 'Zambia', + 'ZW' => 'Zimbabwe', + ], + 'cron' => [ + 'cronname' => 'cronjob-name', + 'lastrun' => 'last run', + 'interval' => 'interval', + 'isactive' => 'enabled', + 'description' => 'description', + 'changewarning' => 'Changing these values can have a negative cause to the behavior of Froxlor and its automated tasks.
Please only change values here, if you are sure you know what you are doing.', + ], + 'crondesc' => [ + 'cron_unknown_desc' => 'no description given', + 'cron_tasks' => 'generating of configfiles', + 'cron_legacy' => 'legacy (old) cronjob', + 'cron_traffic' => 'traffic calculation', + 'cron_usage_report' => 'Web- and traffic-reports', + 'cron_mailboxsize' => 'Calculating of mailbox-sizes', + 'cron_letsencrypt' => 'updating Let\'s Encrypt certificates', + 'cron_backup' => 'Process backup jobs', + ], + 'cronjob' => [ + 'cronjobsettings' => 'Cronjob settings', + 'cronjobintervalv' => 'Runtime interval value', + 'cronjobinterval' => 'Runtime interval', + ], + 'cronjobs' => [ + 'notyetrun' => 'Not yet run', + ], + 'cronmgmt' => [ + 'minutes' => 'minutes', + 'hours' => 'hours', + 'days' => 'days', + 'weeks' => 'weeks', + 'months' => 'months', + ], + 'customer' => [ + 'documentroot' => 'Home directory', + 'name' => 'Name', + 'firstname' => 'First name', + 'company' => 'Company', + 'street' => 'Street', + 'zipcode' => 'Zipcode', + 'city' => 'City', + 'phone' => 'Phone', + 'fax' => 'Fax', + 'email' => 'Email', + 'customernumber' => 'Customer ID', + 'diskspace' => 'Webspace', + 'traffic' => 'Traffic', + 'mysqls' => 'MySQL-databases', + 'emails' => 'Email-addresses', + 'accounts' => 'Email-accounts', + 'forwarders' => 'Email-forwarders', + 'ftps' => 'FTP-accounts', + 'subdomains' => 'Subdomains', + 'domains' => 'Domains', + 'mib' => 'MiB', + 'gib' => 'GiB', + 'title' => 'Title', + 'country' => 'Country', + 'email_quota' => 'E-mail quota', + 'email_imap' => 'E-mail IMAP', + 'email_pop3' => 'E-mail POP3', + 'mail_quota' => 'Mailquota', + 'sendinfomail' => 'Send data via email to me', + 'generated_pwd' => 'Password suggestion', + 'usedmax' => 'Used / Max', + 'services' => 'Services', + 'letsencrypt' => [ + 'title' => 'Use Let\'s Encrypt', + 'description' => 'Get a free certificate from Let\'s Encrypt. The certificate will be created and renewed automatically.', + ], + 'selectserveralias_addinfo' => 'This option can be set when editing the domain. Its initial value is inherited from the parent-domain.', + 'total_diskspace' => 'Total diskspace', + ], + 'diskquota' => 'Quota', + 'dkim' => [ + 'dkim_prefix' => [ + 'title' => 'Prefix', + 'description' => 'Please specify the path to the DKIM RSA-files as well as to the configuration files for the Milter-plugin', + ], + 'dkim_domains' => [ + 'title' => 'Domains filename', + 'description' => 'Filename of the DKIM Domains parameter specified in the dkim-milter configuration', + ], + 'dkim_dkimkeys' => [ + 'title' => 'KeyList filename', + 'description' => 'Filename of the DKIM KeyList parameter specified in the dkim-milter configuration', + ], + 'dkimrestart_command' => [ + 'title' => 'Milter restart command', + 'description' => 'Please specify the restart command for the DKIM milter service', + ], + 'privkeysuffix' => [ + 'title' => 'Private keys suffix', + 'description' => 'You can specify an (optional) filename extension/suffix for the generate dkim private keys. Some services like dkim-filter requires this to be empty', + ], + 'use_dkim' => [ + 'title' => 'Activate DKIM support?', + 'description' => 'Would you like to use the Domain Keys (DKIM) system?
Note: DKIM is only supported using dkim-filter, not opendkim (yet)', + ], + 'dkim_algorithm' => [ + 'title' => 'Allowed Hash Algorithms', + 'description' => 'Define allowed hash algorithms, chose "All" for all algorithms or one or more from the other available algorithms', + ], + 'dkim_servicetype' => 'Service Types', + 'dkim_keylength' => [ + 'title' => 'Key-length', + 'description' => 'Attention: If you change this values, you need to delete all the private/public keys in "%s"', + ], + 'dkim_notes' => [ + 'title' => 'DKIM Notes', + 'description' => 'Notes that might be of interest to a human, e.g. a URL like http://www.dnswatch.info. No interpretation is made by any program. This tag should be used sparingly due to space limitations in DNS. This is intended for use by administrators, not end users.', + ], + ], + 'dns' => [ + 'destinationip' => 'Domain IP(s)', + 'standardip' => 'Server standard IP', + 'a_record' => 'A-Record (IPv6 optional)', + 'cname_record' => 'CNAME-Record', + 'mxrecords' => 'Define MX records', + 'standardmx' => 'Server standard MX record', + 'mxconfig' => 'Custom MX records', + 'priority10' => 'Priority 10', + 'priority20' => 'Priority 20', + 'txtrecords' => 'Define TXT records', + 'txtexample' => 'Example (SPF-entry):
v=spf1 ip4:xxx.xxx.xx.0/23 -all', + 'howitworks' => 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.', + ], + 'dnseditor' => [ + 'edit' => 'edit DNS', + 'records' => 'records', + ], + 'domain' => [ + 'openbasedirpath' => 'OpenBasedir-path', + 'docroot' => 'Path from field above', + 'homedir' => 'Home directory', + ], + 'domains' => [ + 'description' => 'Here you can create (sub-)domains and change their paths.
The system will need some time to apply the new settings after every change.', + 'domainsettings' => 'Domain settings', + 'domainname' => 'Domain name', + 'subdomain_add' => 'Create subdomain', + 'subdomain_edit' => 'Edit (sub)domain', + 'wildcarddomain' => 'Create as wildcarddomain?', + 'aliasdomain' => 'Alias for domain', + 'noaliasdomain' => 'No alias domain', + 'hasaliasdomains' => 'Has alias domain(s)', + 'statstics' => 'Usage Statistics', + 'isassigneddomain' => 'Is assigned domain', + 'add_date' => 'Added to Froxlor', + 'registration_date' => 'Added to registry', + 'topleveldomain' => 'Top-Level-Domain', + 'associated_with_domain' => 'Associated', + 'aliasdomains' => 'Alias domains', + 'redirectifpathisurl' => 'Redirect code (default: empty)', + 'redirectifpathisurlinfo' => 'You only need to select one of these if you entered an URL as path
NOTE:Changes are only applied if the given path is an URL.', + 'issubof' => 'This domain is a subdomain of another domain', + 'issubofinfo' => 'You have to set this to the correct domain if you want to add a subdomain as full-domain (e.g. you want to add "www.domain.tld", you have to select "domain.tld" here)', + 'nosubtomaindomain' => 'No subdomain of a full domain', + 'ipandport_multi' => [ + 'title' => 'IP address(es)', + 'description' => 'Specify one or more IP address for the domain.

NOTE: IP addresses cannot be changed when the domain is configured as alias-domain of another domain.
', + ], + 'ipandport_ssl_multi' => [ + 'title' => 'SSL IP address(es)', + ], + 'ssl_redirect' => [ + 'title' => 'SSL redirect', + 'description' => 'This option creates redirects for non-ssl vhosts so that all requests are redirected to the SSL-vhost.

e.g. a request to http://domain.tld/ will redirect you to https://domain.tld/', + ], + 'serveraliasoption_wildcard' => 'Wildcard (*.domain.tld)', + 'serveraliasoption_www' => 'WWW (www.domain.tld)', + 'serveraliasoption_none' => 'No alias', + 'domain_import' => 'Import Domains', + 'import_separator' => 'Separator', + 'import_offset' => 'Offset', + 'import_file' => 'CSV-File', + 'import_description' => 'Detailed information about the structure of the import-file and how to import successfully, please visit https://docs.froxlor.org/adminguide/domainimport.html', + 'ssl_redirect_temporarilydisabled' => '
The SSL redirect is temporarily deactivated while a new Let\'s Encrypt certificate is generated. It will be activated again after the certificate was generated.', + 'termination_date' => 'Date of termination', + 'termination_date_overview' => 'terminated as of ', + 'ssl_certificates' => 'SSL certificates', + 'ssl_certificate_removed' => 'The certificate with the id #%s has been removed successfully', + 'ssl_certificate_error' => 'Error reading certificate for domain: %s', + 'no_ssl_certificates' => 'There are no domains with SSL certificate', + 'isaliasdomainof' => 'Is aliasdomain for %s', + ], + 'emails' => [ + 'description' => 'Here you can create and change your email addresses.
An account is like your letterbox in front of your house. If someone sends you an email, it will be dropped into the account.

To download your emails use the following settings in your mailprogram: (The data in italics has to be changed to the equivalents you typed in!)
Hostname: domainname
Username: account name / e-mail address
password: the password you\'ve chosen', + 'emailaddress' => 'Email-address', + 'emails_add' => 'Create email-address', + 'emails_edit' => 'Edit email-address', + 'catchall' => 'Catchall', + 'iscatchall' => 'Define as catchall-address?', + 'account' => 'Account', + 'account_add' => 'Create account', + 'account_delete' => 'Delete account', + 'from' => 'Source', + 'to' => 'Destination', + 'forwarders' => 'Forwarders', + 'forwarder_add' => 'Create forwarder', + 'alternative_emailaddress' => 'Alternative e-mail-address', + 'quota' => 'Quota', + 'noquota' => 'No quota', + 'updatequota' => 'Update Quota', + 'quota_edit' => 'Change E-Mail Quota', + 'noemaildomainaddedyet' => 'You do not have a (email-)domain in your account yet.', + 'back_to_overview' => 'Back to overview', + ], + 'error' => [ + 'error' => 'Error', + 'directorymustexist' => 'The directory %s must exist. Please create it with your FTP client.', + 'filemustexist' => 'The file %s must exist.', + 'allresourcesused' => 'You have already used all of your resources.', + 'domains_cantdeletemaindomain' => 'You cannot delete a domain which is used as an email-domain.', + 'domains_canteditdomain' => 'You cannot edit this domain. It has been disabled by the admin.', + 'domains_cantdeletedomainwithemail' => 'You cannot delete a domain which is used as an email-domain. Delete all email addresses first.', + 'firstdeleteallsubdomains' => 'You have to delete all subdomains first before you can create a wildcard domain.', + 'youhavealreadyacatchallforthisdomain' => 'You have already defined a catchall for this domain.', + 'ftp_cantdeletemainaccount' => 'You cannot delete your main FTP account', + 'login' => 'The username or password you typed in is wrong. Please try it again!', + 'login_blocked' => 'This account has been suspended because of too many login errors.
Please try again in %s seconds.', + 'notallreqfieldsorerrors' => 'You have not filled in all or filled in some fields incorrectly.', + 'oldpasswordnotcorrect' => 'The old password is not correct.', + 'youcantallocatemorethanyouhave' => 'You cannot allocate more resources than you own for yourself.', + 'mustbeurl' => 'You have not typed a valid or complete url (e.g. http://somedomain.com/error404.htm)', + 'invalidpath' => 'You have not chosen a valid URL (maybe problems with the dirlisting?)', + 'stringisempty' => 'Missing Input in Field', + 'stringiswrong' => 'Wrong Input in Field', + 'newpasswordconfirmerror' => 'New password and confirmation does not match', + 'mydomain' => '\'Domain\'', + 'mydocumentroot' => '\'Documentroot\'', + 'loginnameexists' => 'Loginname %s already exists', + 'emailiswrong' => 'Email-address %s contains invalid characters or is incomplete', + 'alternativeemailiswrong' => 'The given alternative email address %s to send the credentials to seems to be invalid', + 'loginnameiswrong' => 'Loginname "%s" contains illegal characters.', + 'loginnameiswrong2' => 'Loginname contains too many characters. Only %s characters are allowed.', + 'userpathcombinationdupe' => 'Combination of username and path already exists', + 'patherror' => 'General Error! Path cannot be empty', + 'errordocpathdupe' => 'Option for path %s already exists', + 'adduserfirst' => 'Please create a customer first', + 'domainalreadyexists' => 'The domain %s is already assigned to a customer', + 'nolanguageselect' => 'No language selected.', + 'nosubjectcreate' => 'You must define a topic for this mail template.', + 'nomailbodycreate' => 'You must define a mail-text for this mail template.', + 'templatenotfound' => 'Template was not found.', + 'alltemplatesdefined' => 'You can\'t define more templates, all languages are supported already.', + 'wwwnotallowed' => 'www is not allowed for subdomains.', + 'subdomainiswrong' => 'The subdomain %s contains invalid characters.', + 'domaincantbeempty' => 'The domain-name can not be empty.', + 'domainexistalready' => 'The domain %s already exists.', + 'domainisaliasorothercustomer' => 'The selected alias domain is either itself an alias domain, has a different ip/port combination or belongs to another customer.', + 'emailexistalready' => 'The email-address %s already exists.', + 'maindomainnonexist' => 'The main-domain %s does not exist.', + 'destinationnonexist' => 'Please create your forwarder in the field \'Destination\'.', + 'destinationalreadyexistasmail' => 'The forwarder to %s already exists as active email-address.', + 'destinationalreadyexist' => 'You have already defined a forwarder to "%s"', + 'destinationiswrong' => 'The forwarder %s contains invalid character(s) or is incomplete.', + 'backupfoldercannotbedocroot' => 'The folder for backups cannot be your homedir, please chose a folder within your homedir, e.g. /backups', + 'templatelanguagecombodefined' => 'The selected language/template combination has already been defined.', + 'ipstillhasdomains' => 'The IP/Port combination you want to delete still has domains assigned to it, please reassign those to other IP/Port combinations before deleting this IP/Port combination.', + 'cantdeletedefaultip' => 'You cannot delete the default IP/Port combination, please make another IP/Port combination default for before deleting this IP/Port combination.', + 'cantdeletesystemip' => 'You cannot delete the last system IP, either create a new IP/Port combination for the system IP or change the system IP.', + 'myipaddress' => '\'IP\'', + 'myport' => '\'Port\'', + 'myipdefault' => 'You need to select an IP/Port combination that should become default.', + 'myipnotdouble' => 'This IP/Port combination already exists.', + 'admin_domain_emailsystemhostname' => 'The server-hostname cannot be used as customer-domain.', + 'cantchangesystemip' => 'You cannot change the last system IP, either create another new IP/Port combination for the system IP or change the system IP.', + 'sessiontimeoutiswrong' => 'Only numerical "session timeout" is allowed.', + 'maxloginattemptsiswrong' => 'Only numerical "max login attempts" are allowed.', + 'deactivatetimiswrong' => 'Only numerical "deactivation time" is allowed.', + 'accountprefixiswrong' => 'The "customerprefix" is wrong.', + 'mysqlprefixiswrong' => 'The "SQL prefix" is wrong.', + 'ftpprefixiswrong' => 'The "FTP prefix" is wrong.', + 'ipiswrong' => 'The "IP-address" is wrong. Only a valid IP-address is allowed.', + 'vmailuidiswrong' => 'The "mails-uid" is wrong. Only a numerical UID is allowed.', + 'vmailgidiswrong' => 'The "mails-gid" is wrong. Only a numerical GID is allowed.', + 'adminmailiswrong' => 'The "sender-address" is wrong. Only a valid email-address is allowed.', + 'pagingiswrong' => 'The "entries per page"-value is wrong. Only numerical characters are allowed.', + 'phpmyadminiswrong' => 'The phpMyAdmin-link is not a valid link.', + 'webmailiswrong' => 'The webmail-link is not a valid link.', + 'webftpiswrong' => 'The WebFTP-link is not a valid link.', + 'stringformaterror' => 'The value for the field "%s" is not in the expected format.', + 'loginnameissystemaccount' => 'You cannot create accounts which are similar to system accounts (as for example begin with "%s"). Please enter another account name.', + 'youcantdeleteyourself' => 'You cannot delete yourself for security reasons.', + 'youcanteditallfieldsofyourself' => 'Note: You cannot edit all fields of your own account for security reasons.', + 'documentrootexists' => 'The directory "%s" already exists for this customer. Please remove this before adding the customer again.', + 'formtokencompromised' => 'The request seems to be compromised. For security reasons you were logged out.', + 'norepymailiswrong' => 'The "Noreply-address" is wrong. Only a valid email-address is allowed.', + 'logerror' => 'Log-Error: %s', + 'nomessagetosend' => 'You did not enter a message.', + 'norecipientsgiven' => 'You did not specify any recipient', + 'errorsendingmail' => 'The message to "%s" failed', + 'cannotreaddir' => 'Unable to read directory "%s"', + 'invalidip' => 'Invalid IP address: %s', + 'invalidmysqlhost' => 'Invalid MySQL host address: %s', + 'cannotuseawstatsandwebalizeratonetime' => 'You cannot enable Webalizer and AWstats at the same time, please chose one of them', + 'cannotwritetologfile' => 'Cannot open logfile %s for writing', + 'vmailquotawrong' => 'The quotasize must be positive number.', + 'allocatetoomuchquota' => 'You tried to allocate %s MB Quota, but you do not have enough left.', + 'missingfields' => 'Not all required fields were filled out.', + 'accountnotexisting' => 'The given email account doesn\'t exist.', + 'nopermissionsorinvalidid' => 'You don\'t have enough permissions to change these settings or an invalid id was given.', + 'phpsettingidwrong' => 'A PHP Configuration with this id doesn\'t exist', + 'descriptioninvalid' => 'The description is too short, too long or contains illegal characters.', + 'info' => 'Info', + 'filecontentnotset' => 'The file cannot be empty!', + 'index_file_extension' => 'The file extension for the index file must be between 1 and 6 characters long. The extension can only contain characters like a-z, A-Z and 0-9', + 'customerdoesntexist' => 'The customer you have chosen doesn\'t exist.', + 'admindoesntexist' => 'The admin you have chosen doesn\'t exist.', + 'ipportdoesntexist' => 'The ip/port combination you have chosen doesn\'t exist.', + 'usernamealreadyexists' => 'The username %s already exists.', + 'plausibilitychecknotunderstood' => 'Answer of plausibility check not understood.', + 'errorwhensaving' => 'An error occurred when saving the field %s', + 'hiddenfieldvaluechanged' => 'The value for the hidden field "%s" changed while editing the settings.

This is usually not a big problem but the settings could not be saved because of this.', + 'notrequiredpasswordlength' => 'The given password is too short. Please enter at least %s characters.', + 'overviewsettingoptionisnotavalidfield' => 'Whoops, a field that should be displayed as an option in the settings-overview is not an excepted type. You can blame the developers for this. This should not happen!', + 'pathmaynotcontaincolon' => 'The path you have entered should not contain a colon (":"). Please enter a correct path value.', + 'exception' => '%s', + 'notrequiredpasswordcomplexity' => 'The specified password-complexity was not satisfied.
Please contact your administrator if you have any questions about the complexity-specification', + 'stringerrordocumentnotvalidforlighty' => 'A string as ErrorDocument does not work in lighttpd, please specify a path to a file', + 'urlerrordocumentnotvalidforlighty' => 'An URL as ErrorDocument does not work in lighttpd, please specify a path to a file', + 'intvaluetoolow' => 'The given number is too low (field %s)', + 'intvaluetoohigh' => 'The given number is too high (field %s)', + 'phpfpmstillenabled' => 'PHP-FPM is currently active. Please deactivate it before activating FCGID', + 'fcgidstillenabled' => 'FCGID is currently active. Please deactivate it before activating PHP-FPM', + 'domains_cantdeletedomainwithaliases' => 'You cannot delete a domain which is used for alias-domains. You have to delete the aliases first.', + 'user_banned' => 'Your account has been locked. Please contact your administrator for further information.', + 'session_timeout' => 'Value too low', + 'session_timeout_desc' => 'You should not set the session timeout lower than 1 minute.', + 'invalidhostname' => 'Hostname needs to be a valid domain. It can\'t be empty nor can it consist only of whitespaces', + 'operationnotpermitted' => 'Operation not permitted!', + 'featureisdisabled' => 'Feature %s is disabled. Please contact your service provider.', + 'usercurrentlydeactivated' => 'The user %s is currently deactivated', + 'setlessthanalreadyused' => 'You cannot set less resources of \'%s\' than this user already used
', + 'stringmustntbeempty' => 'The value for the field %s must not be empty', + 'sslcertificateismissingprivatekey' => 'You need to specify a private key for your certificate', + 'sslcertificatewrongdomain' => 'The given certificate does not belong to this domain', + 'sslcertificateinvalidcert' => 'The given certificate-content does not seem to be a valid certificate', + 'sslcertificateinvalidcertkeypair' => 'The given private-key does not belong to the given certificate', + 'sslcertificateinvalidca' => 'The given CA certificate data does not seem to be a valid certificate', + 'sslcertificateinvalidchain' => 'The given certificate chain data does not seem to be a valid certificate', + 'givendirnotallowed' => 'The given directory in field %s is not allowed.', + 'sslredirectonlypossiblewithsslipport' => 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.', + 'fcgidstillenableddeadlock' => 'FCGID is currently active.
Please deactivate it before switching to another webserver than Apache2 or lighttpd', + 'send_report_title' => 'Send error report', + 'send_report_desc' => 'Thank you for reporting this error and helping us to improve Froxlor.
This is the email which will be sent to the Froxlor developer team:', + 'send_report' => 'Send report', + 'send_report_error' => 'Error when sending report:
%s', + 'notallowedtouseaccounts' => 'Your account does not allow using IMAP/POP3. You cannot add email accounts.', + 'cannotdeletehostnamephpconfig' => 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.', + 'cannotdeletedefaultphpconfig' => 'This PHP-configuration is set as default and cannot be deleted.', + 'passwordshouldnotbeusername' => 'The password should not be the same as the username.', + 'no_phpinfo' => 'Sorry, unable to read phpinfo()', + 'moveofcustomerfailed' => 'Moving the customer to the selected admin/reseller failed. Keep in mind that all other changes to the customer were applied successfully at this stage.

Error-message: %s', + 'domain_import_error' => 'Following error occurred while importing domains: %s', + 'fcgidandphpfpmnogoodtogether' => 'FCGID and PHP-FPM cannot be activated at the same time', + 'no_apcuinfo' => 'No cache info available. APCu does not appear to be running.', + 'no_opcacheinfo' => 'No cache info available. OPCache does not appear to be running.', + 'nowildcardwithletsencrypt' => 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely', + 'customized_version' => 'It looks like your Froxlor installation has been modified, no support sorry.', + 'autoupdate_0' => 'Unknown error', + 'autoupdate_1' => 'PHP setting allow_url_fopen is disabled. Autoupdate needs this setting to be enabled in php.ini', + 'autoupdate_2' => 'PHP zip extension not found, please ensure it is installed and activated', + 'autoupdate_4' => 'The froxlor archive could not be stored to the disk :(', + 'autoupdate_5' => 'version.froxlor.org returned inacceptable values :(', + 'autoupdate_6' => 'Whoops, there was no (valid) version given to download :(', + 'autoupdate_7' => 'The downloaded archive could not be found :(', + 'autoupdate_8' => 'The archive could not be extracted :(', + 'autoupdate_9' => 'The downloaded file did not pass the integrity check. Please try to update again.', + 'autoupdate_10' => 'Minimum supported version of PHP is 7.4.0', + 'autoupdate_11' => 'Webupdate is disabled', + 'mailaccistobedeleted' => 'Another account with the same name (%s) is currently being deleted and can therefore not be added at this moment.', + 'customerhasongoingbackupjob' => 'There is already a backup job waiting to be processed, please be patient.', + 'backupfunctionnotenabled' => 'The backup function is not enabled', + 'dns_domain_nodns' => 'DNS is not enabled for this domain', + 'dns_content_empty' => 'No content given', + 'dns_content_invalid' => 'DNS content invalid', + 'dns_arec_noipv4' => 'No valid IP address for A-record given', + 'dns_aaaarec_noipv6' => 'No valid IP address for AAAA-record given', + 'dns_mx_prioempty' => 'Invalid MX priority given', + 'dns_mx_needdom' => 'The MX content value must be a valid domain-name', + 'dns_mx_noalias' => 'The MX-content value cannot be an CNAME entry.', + 'dns_cname_invaliddom' => 'Invalid domain-name for CNAME record', + 'dns_cname_nomorerr' => 'There already exists a resource-record with the same record-name. It can not be used as CNAME.', + 'dns_other_nomorerr' => 'There already exists a CNAME record with the same record-name. It can not be used for another type.', + 'dns_ns_invaliddom' => 'Invalid domain-name for NS record', + 'dns_srv_prioempty' => 'Invalid SRV priority given', + 'dns_srv_invalidcontent' => 'Invalid SRV content, must contain of fields weight, port and target, e.g.: 5 5060 sipserver.example.com.', + 'dns_srv_needdom' => 'The SRV target value must be a valid domain-name', + 'dns_srv_noalias' => 'The SRV-target value cannot be an CNAME entry.', + 'dns_duplicate_entry' => 'Record already exists', + 'dns_notfoundorallowed' => 'Domain not found or no permission', + 'domain_nopunycode' => 'You must not specify punycode (IDNA). The domain will automatically be converted', + 'dns_record_toolong' => 'Records/labels can only be up to 63 characters', + 'noipportgiven' => 'No IP/port given', + 'jsonextensionnotfound' => 'This feature requires the php json-extension.', + 'cannotdeletesuperadmin' => 'The first admin cannot be deleted.', + 'no_wwwcnamae_ifwwwalias' => 'Cannot set CNAME record for "www" as domain is set to generate a www-alias. Please change settings to either "No alias" or "Wildcard alias"', + 'local_group_exists' => 'The given group already exists on the system.', + 'local_group_invalid' => 'The given group name is invalid', + 'invaliddnsforletsencrypt' => 'The domains DNS does not include any of the chosen IP addresses. Let\'s Encrypt certificate generation not possible.', + 'notallowedphpconfigused' => 'Trying to use php-config which is not assigned to customer', + 'pathmustberelative' => 'The user does not have the permission to specify directories outside the customers home-directory. Please specify a relative path (no leading /).', + ], + 'extras' => [ + 'description' => 'Here you can add some extras, for example directory protection.
The system will need some time to apply the new settings after every change.', + 'directoryprotection_add' => 'Add directory protection', + 'view_directory' => 'Display directory content', + 'pathoptions_add' => 'Add path options', + 'directory_browsing' => 'Directory content browsing', + 'pathoptions_edit' => 'Edit path options', + 'error404path' => '404', + 'error403path' => '403', + 'error500path' => '500', + 'error401path' => '401', + 'errordocument404path' => 'ErrorDocument 404', + 'errordocument403path' => 'ErrorDocument 403', + 'errordocument500path' => 'ErrorDocument 500', + 'errordocument401path' => 'ErrorDocument 401', + 'execute_perl' => 'Execute perl/CGI', + 'htpasswdauthname' => 'Authentication reason (AuthName)', + 'directoryprotection_edit' => 'edit directory protection', + 'backup' => 'Create backup', + 'backup_web' => 'Backup web-data', + 'backup_mail' => 'Backup mail-data', + 'backup_dbs' => 'Backup databases', + 'path_protection_label' => 'Important', + 'path_protection_info' => 'We strongly recommend protecting the given path, see "Extras" -> "Directory protection"', + ], + 'ftp' => [ + 'description' => 'Here you can create and change your FTP-accounts.
The changes are made instantly and the accounts can be used immediately.', + 'account_add' => 'Create account', + 'account_edit' => 'Edit ftp account', + 'editpassdescription' => 'Set new password or leave blank for no change.', + ], + 'gender' => [ + 'title' => 'Title', + 'male' => 'Mr.', + 'female' => 'Mrs.', + 'undef' => '', + ], + 'imprint' => 'Legal notes', + 'index' => [ + 'customerdetails' => 'Customer details', + 'accountdetails' => 'Account details', + ], + 'integrity_check' => [ + 'databaseCharset' => 'Character set of database (should be UTF-8)', + 'domainIpTable' => 'IP <‐> domain references', + 'subdomainSslRedirect' => 'False SSL-redirect flag for non-ssl domains', + 'froxlorLocalGroupMemberForFcgidPhpFpm' => 'froxlor-user in the customer groups (for FCGID/php-fpm)', + 'webserverGroupMemberForFcgidPhpFpm' => 'Webserver-user in the customer groups (for FCGID/php-fpm)', + 'subdomainLetsencrypt' => 'Main domains with no SSL-Port assigned don\'t have any subdomains with active SSL redirect', + ], + 'logger' => [ + 'date' => 'Date', + 'type' => 'Type', + 'action' => 'Action', + 'user' => 'User', + 'truncate' => 'Empty log', + 'reseller' => 'Reseller', + 'admin' => 'Administrator', + 'cron' => 'Cronjob', + 'login' => 'Login', + 'intern' => 'Internal', + 'unknown' => 'Unknown', + ], + 'login' => [ + 'username' => 'Username', + 'password' => 'Password', + 'language' => 'Language', + 'login' => 'Login', + 'logout' => 'Logout', + 'profile_lng' => 'Profile language', + 'welcomemsg' => 'Please log in to access your account.', + 'forgotpwd' => 'Forgot your password?', + 'presend' => 'Reset password', + 'email' => 'E-mail address', + 'remind' => 'Reset my password', + 'usernotfound' => 'User not found!', + 'backtologin' => 'Back to login', + 'combination_not_found' => 'Combination of user and email address not found.', + '2fa' => 'Two-factor authentication (2FA)', + '2facode' => 'Please enter 2FA code', + ], + 'mails' => [ + 'pop_success' => [ + 'mailbody' => 'Hello,\\n\\nyour mail account {EMAIL}\\nwas set up successfully.\\n\\nThis is an automatically created\\ne-mail, please do not answer!\\n\\nYours sincerely, your administrator', + 'subject' => 'Mail account set up successfully', + ], + 'createcustomer' => [ + 'mailbody' => 'Hello {FIRSTNAME} {NAME},\\n\\nhere is your account information:\\n\\nUsername: {USERNAME}\\nPassword: {PASSWORD}\\n\\nThank you,\\nyour administrator', + 'subject' => 'Account information', + ], + 'pop_success_alternative' => [ + 'mailbody' => 'Hello,\\n\\nyour Mail account {EMAIL}\\nwas set up successfully.\\nYour password is {PASSWORD}.\\n\\nThis is an automatically created\\ne-mail, please do not answer!\\n\\nYours sincerely, your administrator', + 'subject' => 'Mail account set up successfully', + ], + 'password_reset' => [ + 'subject' => 'Password reset', + 'mailbody' => 'Hello {SALUTATION},\\n\\nhere is your link for setting a new password. This link is valid for the next 24 hours.\\n\\n{LINK}\\n\\nThank you,\\nyour administrator', + ], + 'new_database_by_customer' => [ + 'subject' => '[Froxlor] New database created', + 'mailbody' => 'Hello {CUST_NAME}, + +you have just added a new database. Here is the entered information: + +Databasename: {DB_NAME} +Password: {DB_PASS} +Description: {DB_DESC} +DB-Hostname: {DB_SRV} +phpMyAdmin: {PMA_URI} +Yours sincerely, your administrator', + ], + 'new_ftpaccount_by_customer' => [ + 'subject' => 'New ftp-user created', + 'mailbody' => 'Hello {CUST_NAME}, + +you have just added a new ftp-user. Here is the entered information: + +Username: {USR_NAME} +Password: {USR_PASS} +Path: {USR_PATH} + +Yours sincerely, your administrator', + ], + 'trafficmaxpercent' => [ + 'mailbody' => 'Dear {NAME},\\n\\nyou used {TRAFFICUSED} MB of your available {TRAFFIC} MB of traffic.\\nThis is more than {MAX_PERCENT}%.\\n\\nYours sincerely, your administrator', + 'subject' => 'Reaching your traffic limit', + ], + 'diskmaxpercent' => [ + 'mailbody' => 'Dear {NAME},\\n\\nyou used {DISKUSED} MB of your available {DISKAVAILABLE} MB of diskspace.\\nThis is more than {MAX_PERCENT}%.\\n\\nYours sincerely, your administrator', + 'subject' => 'Reaching your diskspace limit', + ], + '2fa' => [ + 'mailbody' => 'Hello,\\n\\nyour 2FA login-code is: {CODE}.\\n\\nThis is an automatically created\\ne-mail, please do not answer!\\n\\nYours sincerely, your administrator', + 'subject' => 'Froxlor - 2FA Code', + ], + ], + 'menu' => [ + 'message' => 'Messages', + ], + 'menue' => [ + 'main' => [ + 'main' => 'Main', + 'changepassword' => 'Change password', + 'changelanguage' => 'Change language', + 'username' => 'Logged in as: ', + 'changetheme' => 'Change theme', + 'apihelp' => 'API help', + 'apikeys' => 'API keys', + ], + 'email' => [ + 'email' => 'Email', + 'emails' => 'Addresses', + 'webmail' => 'Webmail', + ], + 'mysql' => [ + 'mysql' => 'MySQL', + 'databases' => 'Databases', + 'phpmyadmin' => 'phpMyAdmin', + ], + 'domains' => [ + 'domains' => 'Domains', + 'settings' => 'Settings', + ], + 'ftp' => [ + 'ftp' => 'FTP', + 'accounts' => 'Accounts', + 'webftp' => 'WebFTP', + ], + 'extras' => [ + 'extras' => 'Extras', + 'directoryprotection' => 'Directory protection', + 'pathoptions' => 'Path options', + 'backup' => 'Backup', + ], + 'traffic' => [ + 'traffic' => 'Traffic', + 'current' => 'Current Month', + 'table' => 'Traffic', + ], + 'phpsettings' => [ + 'maintitle' => 'PHP Configurations', + 'fpmdaemons' => 'PHP-FPM versions', + ], + ], + 'message' => [ + 'norecipients' => 'No e-mail has been sent because there are no recipients in the database', + ], + 'mysql' => [ + 'databasename' => 'User/Database name', + 'databasedescription' => 'Database description', + 'database_create' => 'Create database', + 'description' => 'Here you can create and change your MySQL-databases.
The changes are made instantly and the database can be used immediately.
At the menu on the left side you find the tool phpMyAdmin with which you can easily administer your database.

To use your databases in your own php-scripts use the following settings: (The data in italics have to be changed into the equivalents you typed in!)
Hostname:
Username: databasename
Password: the password you\'ve chosen
Database: databasename', + 'mysql_server' => 'MySQL-Server', + 'database_edit' => 'Edit database', + 'size' => 'Size', + ], + 'opcacheinfo' => [ + 'generaltitle' => 'General Information', + 'resetcache' => 'Reset OPcache', + 'version' => 'OPCache version', + 'phpversion' => 'PHP version', + 'runtimeconf' => 'Runtime Configuration', + 'start' => 'Start time', + 'lastreset' => 'Last restart', + 'oomrestarts' => 'OOM restart count', + 'hashrestarts' => 'Hash restart count', + 'manualrestarts' => 'Manual restart count', + 'hitsc' => 'Hits count', + 'missc' => 'Miss count', + 'blmissc' => 'Blacklist miss count', + 'status' => 'Status', + 'never' => 'never', + 'enabled' => 'OPcache Enabled', + 'cachefull' => 'Cache full', + 'restartpending' => 'Pending restart', + 'restartinprogress' => 'Restart in progress', + 'cachedscripts' => 'Cached scripts count', + 'memusage' => 'Memory usage', + 'totalmem' => 'Total memory', + 'usedmem' => 'Used memory', + 'freemem' => 'Free memory', + 'wastedmem' => 'Wasted memory', + 'maxkey' => 'Maximum keys', + 'usedkey' => 'Used keys', + 'wastedkey' => 'Wasted keys', + 'strinterning' => 'String interning', + 'strcount' => 'String count', + 'keystat' => 'Cached keys statistic', + 'used' => 'Used', + 'free' => 'Free', + 'blacklist' => 'Blacklist', + 'novalue' => 'no value', + 'true' => 'true', + 'false' => 'false', + 'funcsavail' => 'Available functions', + ], + 'panel' => [ + 'edit' => 'Edit', + 'delete' => 'Delete', + 'create' => 'Create', + 'save' => 'Save', + 'yes' => 'Yes', + 'no' => 'No', + 'emptyfornochanges' => 'empty for no changes', + 'emptyfordefault' => 'empty for defaults', + 'path' => 'Path', + 'toggle' => 'Toggle', + 'next' => 'Next', + 'dirsmissing' => 'Can not find or read the directory!', + 'unlimited' => '∞', + 'urloverridespath' => 'URL (overrides path)', + 'pathorurl' => 'Path or URL', + 'ascending' => 'ascending', + 'descending' => 'descending', + 'search' => 'Search', + 'used' => 'used', + 'translator' => 'Translator', + 'reset' => 'Discard changes', + 'pathDescription' => 'If the directory doesn\'t exist, it will be created automatically.', + 'pathDescriptionEx' => '

If you want a redirect to another domain than this entry has to start with http:// or https://.', + 'pathDescriptionSubdomain' => 'If the directory doesn\'t exist, it will be created automatically.

If you want a redirect to another domain than this entry has to start with http:// or https://.

If the URL ends with / it is considered a folder, if not, it is treated as file.', + 'back' => 'Back', + 'reseller' => 'reseller', + 'admin' => 'admin', + 'customer' => 'customer/s', + 'send' => 'send', + 'nosslipsavailable' => 'There are currently no ssl ip/port combinations for this server', + 'backtooverview' => 'Back to overview', + 'dateformat' => 'YYYY-MM-DD', + 'dateformat_function' => 'Y-m-d', + 'timeformat_function' => 'H:i:s', + 'default' => 'Default', + 'never' => 'Never', + 'active' => 'Active', + 'please_choose' => 'Please choose', + 'allow_modifications' => 'Allow modifications', + 'megabyte' => 'MegaByte', + 'not_supported' => 'Not supported in: ', + 'view' => 'view', + 'toomanydirs' => 'Too many subdirectories. Falling back to manual path-select.', + 'abort' => 'Abort', + 'not_activated' => 'not activated', + 'off' => 'off', + 'options' => 'Options', + 'neverloggedin' => 'No login yet', + 'descriptionerrordocument' => 'Can be an URL, path to a file or just a string wrapped around " "
Leave empty to use server default value.', + 'unlock' => 'Unlock', + 'theme' => 'Theme', + 'variable' => 'Variable', + 'description' => 'Description', + 'cancel' => 'Cancel', + 'ssleditor' => 'SSL settings for this domain', + 'dashboard' => 'Dashboard', + 'assigned' => 'Assigned', + 'available' => 'Available', + 'news' => 'News', + 'newsfeed_disabled' => 'The newsfeed is disabled. Click the edit icon to go to the settings.', + 'ftpdesc' => 'FTP description', + 'letsencrypt' => 'Using Let\'s encrypt', + 'set' => 'Apply', + 'shell' => 'Shell', + 'backuppath' => [ + 'title' => 'Destination path for the backup', + 'description' => 'This is the path where the backups will be stored. If backup of web-data is selected, all files from the homedir are stored excluding the backup-folder specified here.', + ], + 'none_value' => 'None', + 'viewlogs' => 'View logfiles', + 'not_configured' => 'System not configured yet. Click here to go to configurations.', + 'ihave_configured' => 'I have configured the services', + 'system_is_configured' => 'System is already set as configured', + 'settings_before_configuration' => 'Please be sure you adjusted the settings prior to configuring the services here', + 'image_field_delete' => 'Delete the existing current image', + 'usage_statistics' => 'Resource usage', + 'security_question' => 'Security question', + 'listing_empty' => 'No entries found', + 'unspecified' => 'unspecified', + 'settingsmode' => 'Mode', + 'settingsmodebasic' => 'Basic', + 'settingsmodeadvanced' => 'Advanced', + 'settingsmodetoggle' => 'Click to toggle mode', + 'modalclose' => 'Close', + 'managetablecolumnsmodal' => [ + 'title' => 'Manage table columns', + 'description' => 'Here you can customize the visible columns', + ], + ], + 'phpfpm' => [ + 'vhost_httpuser' => 'Local user to use for PHP-FPM (Froxlor vHost)', + 'vhost_httpgroup' => 'Local group to use for PHP-FPM (Froxlor vHost)', + 'ownvhost' => [ + 'title' => 'Enable PHP-FPM for the Froxlor vHost', + 'description' => 'If enabled, Froxlor will also be running under a local user', + ], + 'use_mod_proxy' => [ + 'title' => 'Use mod_proxy / mod_proxy_fcgi', + 'description' => 'Must be enabled when using Debian 9.x (Stretch) or newer. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9', + ], + 'ini_flags' => 'Enter possible php_flags for php.ini. One entry per line', + 'ini_values' => 'Enter possible php_values for php.ini. One entry per line', + 'ini_admin_flags' => 'Enter possible php_admin_flags for php.ini. One entry per line', + 'ini_admin_values' => 'Enter possible php_admin_values for php.ini. One entry per line', + ], + 'privacy' => 'Privacy policy', + 'pwdreminder' => [ + 'success' => 'Password reset successfully requested. Please follow the instructions in the email you received.', + 'notallowed' => 'Password reset is disabled', + 'changed' => 'Your password has been updated successfully. You can now login with your new password.', + 'wrongcode' => 'Sorry, your activation-code does not exist or has already expired.', + 'choosenew' => 'Set new password', + ], + 'question' => [ + 'question' => 'Security question', + 'admin_customer_reallydelete' => 'Do you really want to delete the customer %s? This cannot be undone!', + 'admin_domain_reallydelete' => 'Do you really want to delete the domain %s?', + 'admin_domain_reallydisablesecuritysetting' => 'Do you really want to disable this security setting OpenBasedir?', + 'admin_admin_reallydelete' => 'Do you really want to delete the admin %s? Every customer and domain will be reassigned to your account.', + 'admin_template_reallydelete' => 'Do you really want to delete the template \'%s\'?', + 'domains_reallydelete' => 'Do you really want to delete the domain %s?', + 'email_reallydelete' => 'Do you really want to delete the email-address %s?', + 'email_reallydelete_account' => 'Do you really want to delete the email-account of %s?', + 'email_reallydelete_forwarder' => 'Do you really want to delete the forwarder %s?', + 'extras_reallydelete' => 'Do you really want to delete the directory protection for %s?', + 'extras_reallydelete_pathoptions' => 'Do you really want to delete the path options for %s?', + 'ftp_reallydelete' => 'Do you really want to delete the FTP-account %s?', + 'mysql_reallydelete' => 'Do you really want to delete the database %s? This cannot be undone!', + 'admin_configs_reallyrebuild' => 'Do you really want to rebuild all config files?', + 'admin_customer_alsoremovefiles' => 'Remove user files too?', + 'admin_customer_alsoremovemail' => 'Completely remove email data from filesystem?', + 'admin_customer_alsoremoveftphomedir' => 'Also remove FTP-user homedir?', + 'admin_ip_reallydelete' => 'Do you really want to delete the IP address %s?', + 'admin_domain_reallydocrootoutofcustomerroot' => 'Are you sure, you want the document root for this domain, not being within the customer root of the customer?', + 'admin_counters_reallyupdate' => 'Do you really want to recalculate resource usage?', + 'admin_cleartextmailpws_reallywipe' => 'Do you really want to wipe all unencrypted mail account passwords from the table mail_users? This cannot be reverted! The setting to store email passwords unencrypted will also be set to OFF', + 'logger_reallytruncate' => 'Do you really want to truncate the table "%s"?', + 'admin_quotas_reallywipe' => 'Do you really want to wipe all quotas on table mail_users? This cannot be reverted!', + 'admin_quotas_reallyenforce' => 'Do you really want to enforce the default quota to all Users? This cannot be reverted!', + 'phpsetting_reallydelete' => 'Do you really want to delete these settings? All domains which use these settings currently will be changed to the default config.', + 'fpmsetting_reallydelete' => 'Do you really want to delete these php-fpm settings? All php configurations which use these settings currently will be changed to the default config.', + 'remove_subbutmain_domains' => 'Also remove domains which are added as full domains but which are subdomains of this domain?', + 'customer_reallyunlock' => 'Do you really want to unlock customer %s?', + 'admin_integritycheck_reallyfix' => 'Do you really want to try fixing all database integrity problems automatically?', + 'plan_reallydelete' => 'Do you really want to delete the hosting plan %s?', + 'apikey_reallydelete' => 'Do you really want to delete this api-key?', + ], + 'redirect_desc' => [ + 'rc_default' => 'default', + 'rc_movedperm' => 'moved permanently', + 'rc_found' => 'found', + 'rc_seeother' => 'see other', + 'rc_tempred' => 'temporary redirect', + ], + 'serversettings' => [ + 'session_timeout' => [ + 'title' => 'Session Timeout', + 'description' => 'How long does a user have to be inactive before a session gets invalid (seconds)?', + ], + 'accountprefix' => [ + 'title' => 'Customer prefix', + 'description' => 'Which prefix should customer accounts have?', + ], + 'mysqlprefix' => [ + 'title' => 'SQL Prefix', + 'description' => 'Which prefix should MySQL accounts have?
Use "RANDOM" as value to get a 3-digit random prefix
Use "DBNAME" as the value, a database name field is used together with the customer name as a prefix.', + ], + 'ftpprefix' => [ + 'title' => 'FTP Prefix', + 'description' => 'Which prefix should ftp accounts have?
If you change this you also have to change the Quota SQL Query in your FTP Server config file in case you use it! ', + ], + 'documentroot_prefix' => [ + 'title' => 'Home directory', + 'description' => 'Where should all home directories be stored?', + ], + 'logfiles_directory' => [ + 'title' => 'Logfiles directory', + 'description' => 'Where should all log files be stored?', + ], + 'logfiles_script' => [ + 'title' => 'Custom script to pipe log-files to', + 'description' => 'You can specify a script here and use the placeholders {LOGFILE}, {DOMAIN} and {CUSTOMER} if needed. In case you want to use it you will need to activate the Pipe webserver logfiles option too. No prefixed pipe-character is needed.', + ], + 'logfiles_format' => [ + 'title' => 'Access-log format', + 'description' => 'Enter a custom log-format here according to your webservers specifications, leave empty for default. Depending on your format the string must be quoted.
If used with nginx, it will look like log_format frx_custom {CONFIGURED_VALUE}.
If used with Apache, it will look like LogFormat {CONFIGURED_VALUE} frx_custom.
Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!', + ], + 'logfiles_type' => [ + 'title' => 'Access-log type', + 'description' => 'Choose between combined or vhost_combined here.', + ], + 'logfiles_piped' => [ + 'title' => 'Pipe webserver logfiles to specified script (see above)', + 'description' => 'When using a custom script for the logfiles you need to activate this in order for it to be executed', + ], + 'ipaddress' => [ + 'title' => 'IP-address', + 'description' => 'What\'s the main IP-address of this server?', + ], + 'hostname' => [ + 'title' => 'Hostname', + 'description' => 'What\'s the Hostname of this server?', + ], + 'apachereload_command' => [ + 'title' => 'Webserver reload command', + 'description' => 'What\'s the webserver command to reload configfiles?', + ], + 'bindenable' => [ + 'title' => 'Enable Nameserver', + 'description' => 'Here the Nameserver can be enabled and disabled globally.', + ], + 'bindconf_directory' => [ + 'title' => 'Dns server config directory', + 'description' => 'Where should dns-server config files be saved?', + ], + 'bindreload_command' => [ + 'title' => 'DNS server reload command', + 'description' => 'What\'s the command to reload the dns server daemon?', + ], + 'vmail_uid' => [ + 'title' => 'Mails-UID', + 'description' => 'Which UserID should mails have?', + ], + 'vmail_gid' => [ + 'title' => 'Mails-GID', + 'description' => 'Which GroupID should mails have?', + ], + 'vmail_homedir' => [ + 'title' => 'Mails-homedir', + 'description' => 'Where should all mails be stored?', + ], + 'adminmail' => [ + 'title' => 'Sender', + 'description' => 'What\'s the sender address for emails sent from the Panel?', + ], + 'phpmyadmin_url' => [ + 'title' => 'phpMyAdmin URL', + 'description' => 'What\'s the URL to phpMyAdmin? (has to start with http(s)://)', + ], + 'webmail_url' => [ + 'title' => 'Webmail URL', + 'description' => 'What\'s the URL to webmail? (has to start with http(s)://)', + ], + 'webftp_url' => [ + 'title' => 'WebFTP URL', + 'description' => 'What\'s the URL to WebFTP? (has to start with http(s)://)', + ], + 'language' => [ + 'description' => 'What\'s your standard server language?', + ], + 'maxloginattempts' => [ + 'title' => 'Max Login Attempts', + 'description' => 'Maximum login attempts after which the account gets disabled.', + ], + 'deactivatetime' => [ + 'title' => 'Deactivation Time', + 'description' => 'Time (sec.) an account gets disabled after too many login tries.', + ], + 'pathedit' => [ + 'title' => 'Type of path input', + 'description' => 'Should a path be selected by a dropdown menu or by an input field?', + ], + 'nameservers' => [ + 'title' => 'Nameservers', + 'description' => 'A comma separated list containing the hostnames of all nameservers. The first one will be the primary one.', + ], + 'mxservers' => [ + 'title' => 'MX servers', + 'description' => 'A comma separated list containing a pair of a number and a hostname separated by whitespace (e.g. \'10 mx.example.com\') containing the mx servers.', + ], + 'paging' => [ + 'title' => 'Entries per page', + 'description' => 'How many entries shall be shown on one page? (0 = disable paging)', + ], + 'defaultip' => [ + 'title' => 'Default IP/Port', + 'description' => 'Select all IP-addresses you want to use as default for new domains', + ], + 'defaultsslip' => [ + 'title' => 'Default SSL IP/Port', + 'description' => 'Select all ssl-enabled IP-addresses you want to use as default for new domains', + ], + 'phpappendopenbasedir' => [ + 'title' => 'Paths to append to OpenBasedir', + 'description' => 'These paths (separated by colons) will be added to the OpenBasedir-statement in every vHost-container.', + ], + 'natsorting' => [ + 'title' => 'Use natural human sorting in list view', + 'description' => 'Sorts lists as web1 -> web2 -> web11 instead of web1 -> web11 -> web2.', + ], + 'deactivateddocroot' => [ + 'title' => 'Docroot for deactivated users', + 'description' => 'When a user is deactivated this path is used as his docroot. Leave empty for not creating a vHost at all.', + ], + 'mailpwcleartext' => [ + 'title' => 'Also save passwords of mail accounts unencrypted in database', + 'description' => 'If this is set to yes, all passwords will also be saved unencrypted (clear text, plain readable for everyone with database access) in the mail_users-table. Only activate this if you intend to use SASL!', + ], + 'ftpdomain' => [ + 'title' => 'FTP accounts @domain', + 'description' => 'Customers can create FTP accounts user@customerdomain?', + ], + 'mod_fcgid' => [ + 'title' => 'Enable FCGID', + 'description' => 'Use this to run PHP with the corresponding user account.

This needs a special webserver configuration for Apache, see FCGID - handbook', + 'configdir' => [ + 'title' => 'Configuration directory', + 'description' => 'Where should all fcgid-configuration files be stored? If you don\'t use a self compiled suexec binary, which is the normal situation, this path must be under /var/www/

NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.
', + ], + 'tmpdir' => [ + 'title' => 'Temp directory', + 'description' => 'Where should the temp directories be stored', + ], + 'starter' => [ + 'title' => 'Processes per domain', + 'description' => 'How many processes should be started/allowed per domain? The value 0 is recommended cause PHP will then manage the amount of processes itself very efficiently.', + ], + 'wrapper' => [ + 'title' => 'Wrapper in Vhosts', + 'description' => 'How should the wrapper be included in the Vhosts', + ], + 'peardir' => [ + 'title' => 'Global PEAR directories', + 'description' => 'Which global PEAR directories should be replaced in every php.ini config? Different directories must be separated by a colon.', + ], + 'maxrequests' => [ + 'title' => 'Maximum Requests per domain', + 'description' => 'How many requests should be allowed per domain?', + ], + 'defaultini' => 'Default PHP configuration for new domains', + 'defaultini_ownvhost' => 'Default PHP configuration for Froxlor-vHost', + 'idle_timeout' => [ + 'title' => 'Idle Timeout', + 'description' => 'Timeout setting for Mod FastCGI.', + ], + ], + 'sendalternativemail' => [ + 'title' => 'Use alternative email-address', + 'description' => 'Send the password-email to a different address during email-account-creation', + ], + 'apacheconf_vhost' => [ + 'title' => 'Webserver vHost configuration file/dirname', + 'description' => 'Where should the vHost configuration be stored? You could either specify a file (all vHosts in one file) or directory (each vHost in his own file) here.', + ], + 'apacheconf_diroptions' => [ + 'title' => 'Webserver diroptions configuration file/dirname', + 'description' => 'Where should the diroptions configuration be stored? You could either specify a file (all diroptions in one file) or directory (each diroption in his own file) here.', + ], + 'apacheconf_htpasswddir' => [ + 'title' => 'Webserver htpasswd dirname', + 'description' => 'Where should the htpasswd files for directory protection be stored?', + ], + 'mysql_access_host' => [ + 'title' => 'MySQL-Access-Hosts', + 'description' => 'A comma separated list of hosts from which users should be allowed to connect to the MySQL-Server. To allow a subnet the netmask or cidr syntax is valid.', + ], + 'webalizer_quiet' => [ + 'title' => 'Webalizer output', + 'description' => 'Verbosity of the webalizer-program', + ], + 'logger' => [ + 'enable' => 'Logging enabled/disabled', + 'severity' => 'Logging level', + 'types' => [ + 'title' => 'Log-type(s)', + 'description' => 'Specify logtypes. To select multiple types, hold down CTRL while selecting.
Available logtypes are: syslog, file, mysql', + ], + 'logfile' => 'Logfile path including filename', + 'logcron' => 'Log cronjobs', + 'logcronoption' => [ + 'never' => 'Never', + 'once' => 'Once', + 'always' => 'Always', + ], + ], + 'ssl' => [ + 'use_ssl' => [ + 'title' => 'Enable SSL usage', + 'description' => 'Check this if you want to use SSL for your webserver', + ], + 'ssl_cert_file' => [ + 'title' => 'Path to the SSL certificate', + 'description' => 'Specify the path including the filename of the .crt or .pem file (main certificate)', + ], + 'openssl_cnf' => 'Defaults for creating the Cert file', + 'ssl_key_file' => [ + 'title' => 'Path to the SSL Keyfile', + 'description' => 'Specify the path including the filename for the private-key file (.key mostly)', + ], + 'ssl_ca_file' => [ + 'title' => 'Path to the SSL CA certificate (optional)', + 'description' => 'Client authentication, set this only if you know what it is.', + ], + 'ssl_cipher_list' => [ + 'title' => 'Configure the allowed SSL ciphers', + 'description' => 'This is a list of ciphers that you want (or don\'t want) to use when talking SSL. For a list of ciphers and how to include/exclude them, see sections "CIPHER LIST FORMAT" and "CIPHER STRINGS" on the man-page for ciphers.

Default value is:
ECDH+AESGCM:ECDH+AES256:!aNULL:!MD5:!DSS:!DH:!AES128
', + ], + 'apache24_ocsp_cache_path' => [ + 'title' => 'Apache 2.4: path to the OCSP stapling cache', + 'description' => 'Configures the cache used to store OCSP responses which get included in TLS handshakes.', + ], + 'ssl_protocols' => [ + 'title' => 'Configure the TLS protocol version', + 'description' => 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. Notice: Some older browsers may not support the newest protocol versions.

Default value is:
TLSv1.2
', + ], + 'tlsv13_cipher_list' => [ + 'title' => 'Configure explicit TLSv1.3 ciphers if used', + 'description' => 'This is a list of ciphers that you want (or don\'t want) to use when talking TLSv1.3. For a list of ciphers and how to include/exclude them, see the docs for TLSv1.3.

Default value is empty', + ], + ], + 'default_vhostconf' => [ + 'title' => 'Default vHost-settings', + 'description' => 'The content of this field will be included into this ip/port vHost container directly. You can use the following variables:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (if applicable)
Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!', + ], + 'apache_globaldiropt' => [ + 'title' => 'Directory options for customer-prefix', + 'description' => 'The content of this field will be included into the 05_froxlor_dirfix_nofcgid.conf apache config. If empty, the default value is used:

apache >=2.4
Require all granted
AllowOverride All

apache <=2.2
Order allow,deny
allow from all', + ], + 'default_vhostconf_domain' => [ + 'description' => 'The content of this field will be included into the domain vHost container directly. You can use the following variables:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (if applicable)
Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!', + ], + 'decimal_places' => 'Number of decimal places in traffic/webspace output', + 'webalizer_enabled' => 'Enable webalizer statistics', + 'awstats_enabled' => 'Enable AWstats statistics', + 'selfdns' => [ + 'title' => 'Customer domain dns settings', + ], + 'selfdnscustomer' => [ + 'title' => 'Allow customers to edit domain dns settings', + ], + 'unix_names' => [ + 'title' => 'Use UNIX compatible usernames', + 'description' => 'Allows you to use - and _ in usernames if No', + ], + 'allow_password_reset' => [ + 'title' => 'Allow password reset by customers', + 'description' => 'Customers can reset their password and an activation link will be sent to their e-mail address', + ], + 'allow_password_reset_admin' => [ + 'title' => 'Allow password reset by admins', + 'description' => 'Admins/reseller can reset their password and an activation link will be sent to their e-mail address', + ], + 'mail_quota' => [ + 'title' => 'Mailbox-quota', + 'description' => 'The default quota for a new created mailboxes (MegaByte).', + ], + 'mail_quota_enabled' => [ + 'title' => 'Use mailbox-quota for customers', + 'description' => 'Activate to use quotas on mailboxes. Default is No since this requires a special setup.', + 'removelink' => 'Click here to wipe all quotas for mail accounts.', + 'enforcelink' => 'Click here to enforce default quota to all User mail accounts.', + ], + 'index_file_extension' => [ + 'description' => 'Which file extension should be used for the index file in newly created customer directories? This file extension will be used, if you or one of your admins has created its own index file template.', + 'title' => 'File extension for index file in newly created customer directories', + ], + 'session_allow_multiple_login' => [ + 'title' => 'Allow multiple login', + 'description' => 'If activated a user could login multiple times.', + ], + 'panel_allow_domain_change_admin' => [ + 'title' => 'Allow moving domains between admins', + 'description' => 'If activated you can change the admin of a domain at domainsettings.
Attention: If a customer isn\'t assigned to the same admin as the domain, the admin can see every other domain of that customer!', + ], + 'panel_allow_domain_change_customer' => [ + 'title' => 'Allow moving domains between customers', + 'description' => 'If activated you can change the customer of a domain at domainsettings.
Attention: Froxlor changes the documentroot to the new customer\'s default homedir (+ domain-folder if activated)', + ], + 'cron' => [ + 'debug' => [ + 'title' => 'Cronscript debugging', + 'description' => 'Activate to keep the lockfile after a cron-run for debugging.
Attention:Keeping the lockfile can cause the next scheduled cron not to run properly.', + ], + ], + 'specialsettingsforsubdomains' => [ + 'description' => 'If yes these custom vHost-settings will be added to all subdomains; if no subdomain-specialsettings are being removed.', + ], + 'panel_password_min_length' => [ + 'title' => 'Minimum password length', + 'description' => 'Here you can set a minimum length for passwords. \'0\' means: no minimum length required.', + ], + 'system_store_index_file_subs' => [ + 'title' => 'Store default index file also to new subfolders', + 'description' => 'If enabled, the default index-file is being stored to every subdomain-path newly created (not if the folder already exists!)', + ], + 'adminmail_return' => [ + 'title' => 'Reply-To address', + 'description' => 'Define an e-mail address as reply-to-address for mails sent by the panel.', + ], + 'adminmail_defname' => 'Panel e-mail sender name', + 'stdsubdomainhost' => [ + 'title' => 'Customer standard subdomain', + 'description' => 'What hostname should be used to create standard subdomains for customer. If empty, the system-hostname is used.', + ], + 'awstats_path' => 'Path to AWStats \'awstats_buildstaticpages.pl\'', + 'awstats_conf' => 'AWStats configuration path', + 'defaultttl' => 'Domain TTL for bind in seconds (default \'604800\' = 1 week)', + 'defaultwebsrverrhandler_enabled' => 'Enable default errordocuments for all customers', + 'defaultwebsrverrhandler_err401' => [ + 'title' => 'File/URL for error 401', + 'description' => '
Not supported in: lighttpd
', + ], + 'defaultwebsrverrhandler_err403' => [ + 'title' => 'File/URL for error 403', + 'description' => '
Not supported in: lighttpd
', + ], + 'defaultwebsrverrhandler_err404' => 'File/URL for error 404', + 'defaultwebsrverrhandler_err500' => [ + 'title' => 'File/URL for error 500', + 'description' => '
Not supported in: lighttpd
', + ], + 'ftpserver' => [ + 'desc' => 'If pureftpd is selected the .ftpquota files for user quotas are created and updated daily', + ], + 'customredirect_enabled' => [ + 'title' => 'Allow customer redirects', + 'description' => 'Allow customers to choose the http-status code for redirects which will be used', + ], + 'customredirect_default' => [ + 'title' => 'Default redirect', + 'description' => 'Set the default redirect-code which should be used if the customer does not set it himself', + ], + 'mail_also_with_mxservers' => 'Create mail-, imap-, pop3- and smtp-"A record" also with MX-Servers set', + 'froxlordirectlyviahostname' => 'Access Froxlor directly via the hostname', + 'panel_password_regex' => [ + 'title' => 'Regular expression for passwords', + 'description' => 'Here you can set a regular expression for passwords-complexity.
Empty = no specific requirement', + ], + 'perl_path' => [ + 'title' => 'Path to perl', + 'description' => 'Default is /usr/bin/perl', + ], + 'mod_fcgid_ownvhost' => [ + 'title' => 'Enable FCGID for the Froxlor vHost', + 'description' => 'If enabled, Froxlor will also be running under a local user', + ], + 'perl' => [ + 'suexecworkaround' => [ + 'title' => 'Enable SuExec workaround', + 'description' => 'Enable only if customer docroots are not within the apache suexec path.
If enabled, Froxlor will generate a symlink from the customers perl-enabled directory + /cgi-bin/ to the given path.
Note that perl will then only work in the folders subdirectory /cgi-bin/ and not in the folder itself (as it does without this fix!)', + ], + 'suexeccgipath' => [ + 'title' => 'Path for customer perl-enabled directory symlinks', + 'description' => 'You only need to set this if the SuExec-workaround is enabled.
ATTENTION: Be sure this path is within the suexec path or else this workaround is useless', + ], + ], + 'awstats_awstatspath' => 'Path to AWStats \'awstats.pl\'', + 'awstats_icons' => [ + 'title' => 'Path to AWstats icons folder', + 'description' => 'e.g. /usr/share/awstats/htdocs/icon/', + ], + 'login_domain_login' => 'Allow login with domains', + 'perl_server' => [ + 'title' => 'Perl server socket location', + 'description' => 'A simple guide can be found at: nginx.com', + ], + 'nginx_php_backend' => [ + 'title' => 'Nginx PHP backend', + 'description' => 'this is where the PHP process is listening for requests from nginx, can be a unix socket of ip:port combination
*NOT used with php-fpm', + ], + 'phpreload_command' => [ + 'title' => 'PHP reload command', + 'description' => 'this is used to reload the PHP backend if any is used
Default: blank
*NOT used with php-fpm', + ], + 'phpfpm' => [ + 'title' => 'Enable php-fpm', + 'description' => 'This needs a special webserver configuration see PHP-FPM handbook', + ], + 'phpfpm_settings' => [ + 'configdir' => 'Configuration directory of php-fpm', + 'aliasconfigdir' => 'Configuration Alias-directory of php-fpm', + 'reload' => 'php-fpm restart command', + 'pm' => 'Process manager control (pm)', + 'max_children' => [ + 'title' => 'The number of child processes', + 'description' => 'The number of child processes to be created when pm is set to \'static\' and the maximum number of child processes to be created when pm is set to \'dynamic/ondemand\'
Equivalent to the PHP_FCGI_CHILDREN', + ], + 'start_servers' => [ + 'title' => 'The number of child processes created on startup', + 'description' => 'Note: Used only when pm is set to \'dynamic\'', + ], + 'min_spare_servers' => [ + 'title' => 'The desired minimum number of idle server processes', + 'description' => 'Note: Used only when pm is set to \'dynamic\'
Note: Mandatory when pm is set to \'dynamic\'', + ], + 'max_spare_servers' => [ + 'title' => 'The desired maximum number of idle server processes', + 'description' => 'Note: Used only when pm is set to \'dynamic\'
Note: Mandatory when pm is set to \'dynamic\'', + ], + 'max_requests' => [ + 'title' => 'Requests per child before respawning', + 'description' => 'For endless request processing specify \'0\'. Equivalent to PHP_FCGI_MAX_REQUESTS.', + ], + 'idle_timeout' => [ + 'title' => 'Idle Timeout', + 'description' => 'Timeout setting for PHP FPM FastCGI.', + ], + 'ipcdir' => [ + 'title' => 'FastCGI IPC directory', + 'description' => 'The directory where the php-fpm sockets will be stored by the webserver.
This directory has to be readable for the webserver', + ], + 'limit_extensions' => [ + 'title' => 'Allowed extensions', + 'description' => 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php', + ], + 'envpath' => 'Paths to add to the PATH environment. Leave empty for no PATH environment variable', + 'override_fpmconfig' => 'Override FPM-daemon settings (pm, max_children, etc.)', + 'override_fpmconfig_addinfo' => '
Only used if "Override FPM-daemon settings" is set to "Yes"', + 'restart_note' => 'Attention: The config won\'t be checked for any errors. If it contains errors, PHP-FPM might not start again!', + 'custom_config' => [ + 'title' => 'Custom configuration', + 'description' => 'Add custom configuration to each PHP-FPM version instance, for example pm.status_path = /status for monitoring. Variables below can be used here. Attention: The config won\'t be checked for any errors. If it contains errors, PHP-FPM might not start again!', + ], + 'allow_all_customers' => [ + 'title' => 'Assign this configuration to all currently existing customers', + 'description' => 'Set this to "true" if you want to assign this configuration to all currently existing customers so it can be used by them. This setting is not permanent but can be run multiple times.', + ], + ], + 'report' => [ + 'report' => 'Enable sending of reports about web- and traffic-usage', + 'webmax' => [ + 'title' => 'Warning-level in percent for webspace', + 'description' => 'Valid values are 0 up to 150. Setting this value to 0 disables this report.', + ], + 'trafficmax' => [ + 'title' => 'Warning-level in percent for traffic', + 'description' => 'Valid values are 0 up to 150. Setting this value to 0 disables this report.', + ], + ], + 'dropdown' => 'Dropdown', + 'manual' => 'Manual', + 'default_theme' => 'Default theme', + 'validate_domain' => 'Validate domain names', + 'diskquota_enabled' => 'Quota activated?', + 'diskquota_repquota_path' => [ + 'description' => 'Path to repquota', + ], + 'diskquota_quotatool_path' => [ + 'description' => 'Path to quotatool', + ], + 'diskquota_customer_partition' => [ + 'description' => 'Partition, on which the customer files are stored', + ], + 'vmail_maildirname' => [ + 'title' => 'Maildir name', + 'description' => 'Maildir directory into user\'s account. Normally \'Maildir\', in some implementations \'.maildir\', and directly into user\'s directory if left blank.', + ], + 'catchall_enabled' => [ + 'title' => 'Use Catchall', + 'description' => 'Do you want to provide your customers the catchall-feature?', + ], + 'apache_24' => [ + 'title' => 'Use modifications for Apache 2.4', + 'description' => 'ATTENTION: use only if you actually have apache version 2.4 or higher installed
otherwise your webserver will not be able to start', + ], + 'nginx_fastcgiparams' => [ + 'title' => 'Path to fastcgi_params file', + 'description' => 'Specify the path to nginx\'s fastcgi_params file including filename', + ], + 'documentroot_use_default_value' => [ + 'title' => 'Use domain name as default value for DocumentRoot path', + 'description' => 'If enabled and DocumentRoot path is empty, default value will be the (sub)domain name.

Examples:
/var/customers/customer_name/example.com/
/var/customers/customer_name/subdomain.example.com/', + ], + 'panel_phpconfigs_hidestdsubdomain' => [ + 'title' => 'Hide standard-subdomains in PHP-configuration overview', + 'description' => 'If activated the standard-subdomains for customers will not be displayed in the php-configurations overview

Note: This is only visible if you have enabled FCGID or PHP-FPM', + ], + 'passwordcryptfunc' => [ + 'title' => 'Choose which password-crypt method is to be used', + ], + 'systemdefault' => 'System default', + 'panel_allow_theme_change_admin' => 'Allow admins to change the theme', + 'panel_allow_theme_change_customer' => 'Allow customers to change the theme', + 'axfrservers' => [ + 'title' => 'AXFR servers', + 'description' => 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.', + ], + 'powerdns_mode' => [ + 'title' => 'PowerDNS Operation Mode', + 'description' => 'Select the PoweDNS mode: Native for no replication (Default) / Master if DNS replication is needed.', + ], + 'customerssl_directory' => [ + 'title' => 'Webserver customer-ssl certificates-directory', + 'description' => 'Where should customer-specified ssl-certificates be created?

NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.
', + ], + 'allow_error_report_admin' => [ + 'title' => 'Allow administrators/resellers to report database-errors to Froxlor', + 'description' => 'Please note: Never send any personal (customer-)data to us!', + ], + 'allow_error_report_customer' => [ + 'title' => 'Allow customers to report database-errors to Froxlor', + 'description' => 'Please note: Never send any personal (customer-)data to us!', + ], + 'mailtraffic_enabled' => [ + 'title' => 'Analyse mail traffic', + 'description' => 'Enable analysing of mailserver logs to calculate the traffic', + ], + 'mdaserver' => [ + 'title' => 'MDA type', + 'description' => 'Type of the Mail Delivery Server', + ], + 'mdalog' => [ + 'title' => 'MDA log', + 'description' => 'Logfile of the Mail Delivery Server', + ], + 'mtaserver' => [ + 'title' => 'MTA type', + 'description' => 'Type of the Mail Transfer Agent', + ], + 'mtalog' => [ + 'title' => 'MTA log', + 'description' => 'Logfile of the Mail Transfer Agent', + ], + 'system_cronconfig' => [ + 'title' => 'Cron configuration file', + 'description' => 'Path to the cron-service configuration-file. This file will be updated regularly and automatically by froxlor.
Note: Please be sure to use the same filename as for the main froxlor cronjob (default: /etc/cron.d/froxlor)!

If you are using FreeBSD, please specify /etc/crontab here!', + ], + 'system_crondreload' => [ + 'title' => 'Cron-daemon reload command', + 'description' => 'Specify the command to execute in order to reload your systems cron-daemon', + ], + 'system_croncmdline' => [ + 'title' => 'Cron execution command (php-binary)', + 'description' => 'Command to execute our cronjobs. Change this only if you know what you are doing (default: "/usr/bin/nice -n 5 /usr/bin/php -q")!', + ], + 'system_cron_allowautoupdate' => [ + 'title' => 'Allow automatic database updates', + 'description' => '
ATTENTION:
This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.

Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option
', + ], + 'dns_createhostnameentry' => 'Create bind-zone/config for system hostname', + 'panel_password_alpha_lower' => [ + 'title' => 'Lowercase character', + 'description' => 'Password must contain at least one lowercase letter (a-z).', + ], + 'panel_password_alpha_upper' => [ + 'title' => 'Uppercase character', + 'description' => 'Password must contain at least one uppercase letter (A-Z).', + ], + 'panel_password_numeric' => [ + 'title' => 'Numbers', + 'description' => 'Password must contain at least one number (0-9).', + ], + 'panel_password_special_char_required' => [ + 'title' => 'Special character', + 'description' => 'Password must contain at least one of the characters defined below.', + ], + 'panel_password_special_char' => [ + 'title' => 'Special characters list', + 'description' => 'One of these characters is required if the above option is set.', + ], + 'apache_itksupport' => [ + 'title' => 'Use modifications for Apache ITK-MPM', + 'description' => 'ATTENTION: use only if you actually have apache itk-mpm enabled
otherwise your webserver will not be able to start', + ], + 'letsencryptca' => [ + 'title' => 'ACME environment', + 'description' => 'Environment to be used for Let\'s Encrypt / ZeroSSL certificates.', + ], + 'letsencryptcountrycode' => [ + 'title' => 'Let\'s Encrypt country code', + 'description' => '2 letter country code used to generate Let\'s Encrypt certificates.', + ], + 'letsencryptstate' => [ + 'title' => 'Let\'s Encrypt state', + 'description' => 'State used to generate Let\'s Encrypt certificates.', + ], + 'letsencryptchallengepath' => [ + 'title' => 'Path for Let\'s Encrypt challenges', + 'description' => 'Directory where the Let\'s Encrypt challenges should be offered from via a global alias.', + ], + 'letsencryptkeysize' => [ + 'title' => 'Key size for new Let\'s Encrypt certificates', + 'description' => 'Size of the key in Bits for new Let\'s Encrypt certificates.', + ], + 'letsencryptreuseold' => [ + 'title' => 'Re-use Let\'s Encrypt key', + 'description' => 'If activated, the same key will be used for every renew, otherwise a new key will be generated every time.', + ], + 'leenabled' => [ + 'title' => 'Enable Let\'s Encrypt', + 'description' => 'If activated, customers are able to let froxlor automatically generate and renew Let\'s Encrypt ssl-certificates for domains with a ssl IP/port.

Please remember that you need to go through the webserver-configuration when enabled because this feature needs a special configuration.', + ], + 'caa_entry' => [ + 'title' => 'Generate CAA DNS records', + 'description' => 'Automatically generates CAA records for SSL-enabled domains that are using Let\'s Encrypt', + ], + 'caa_entry_custom' => [ + 'title' => 'Additional CAA DNS records', + 'description' => 'DNS Certification Authority Authorization (CAA) is an Internet security policy mechanism which allows domain name holders to indicate to certificate authorities
whether they are authorized to issue digital certificates for a particular domain name. It does this by means of a new "CAA" Domain Name System (DNS) resource record.

The content of this field will be included into the DNS zone directly (each line results in a CAA record).
If Let\'s Encrypt is enabled for this domain, this entry will always be added automatically and does not need to be added manually:
0 issue "letsencrypt.org" (If domain is a wildcard domain, issuewild will be used instead).
To enable Incident Reporting, you can add an iodef record. An example for sending such report to me@example.com would be:
0 iodef "mailto:me@example.com"

Attention: The code won\'t be checked for any errors. If it contains errors, your CAA records might not work!', + ], + 'backupenabled' => [ + 'title' => 'Enable backup for customers', + 'description' => 'If activated, the customer will be able to schedule backup jobs (cron-backup) which generates an archive within his docroot (subdirectory chosable by customer)', + ], + 'dnseditorenable' => [ + 'title' => 'Enable DNS editor', + 'description' => 'Allows admins and customer to manage domain dns entries', + ], + 'dns_server' => [ + 'title' => 'DNS server daemon', + 'description' => 'Remember that daemons have to be configured using froxlors configuration templates', + ], + 'panel_customer_hide_options' => [ + 'title' => 'Hide menu items and traffic charts in customer panel', + 'description' => 'Select items to hide in customer panel. To select multiple options, hold down CTRL while selecting.', + ], + 'allow_allow_customer_shell' => [ + 'title' => 'Allow customers to enable shell access for ftp-users', + 'description' => 'Please note: Shell access allows the user to execute various binaries on your system. Use with extrem caution. Please only activate this if you REALLY know what you are doing!!!', + ], + 'available_shells' => [ + 'title' => 'List of available shells', + 'description' => 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.

Note that the default shell /bin/false will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case', + ], + 'le_froxlor_enabled' => [ + 'title' => 'Enable Let\'s Encrypt for the froxlor vhost', + 'description' => 'If activated, the froxlor vhost will automatically be secured using a Let\'s Encrypt certificate.', + ], + 'le_froxlor_redirect' => [ + 'title' => 'Enable SSL-redirect for the froxlor vhost', + 'description' => 'If activated, all http requests to your froxlor will be redirected to the corresponding SSL site.', + ], + 'option_unavailable_websrv' => '
Available only for: %s', + 'option_unavailable' => '
Option not available due to other settings.', + 'letsencryptacmeconf' => [ + 'title' => 'Path to the acme.conf snippet', + 'description' => 'File name of the config snippet which allows the web server to serve the acme challenge.', + ], + 'mail_use_smtp' => 'Set mailer to use SMTP', + 'mail_smtp_host' => 'Specify SMTP server', + 'mail_smtp_usetls' => 'Enable TLS encryption', + 'mail_smtp_auth' => 'Enable SMTP authentication', + 'mail_smtp_port' => 'TCP port to connect to', + 'mail_smtp_user' => 'SMTP username', + 'mail_smtp_passwd' => 'SMTP password', + 'http2_support' => [ + 'title' => 'HTTP2 Support', + 'description' => 'enable HTTP2 support for ssl.
ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)', + ], + 'nssextrausers' => [ + 'title' => 'Use libnss-extrausers instead of libnss-mysql', + 'description' => 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).
For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)', + ], + 'le_domain_dnscheck' => [ + 'title' => 'Validate DNS of domains when using Let\'s Encrypt', + 'description' => 'If activated, froxlor will validate whether the domain which requests a Let\'s Encrypt certificate resolves to at least one of the system ip addresses.', + ], + 'phpsettingsforsubdomains' => [ + 'description' => 'If yes the chosen php-config will be updated to all subdomains', + ], + 'leapiversion' => [ + 'title' => 'Choose Let\'s Encrypt ACME implementation', + 'description' => 'Currently only ACME v2 implementation for Let\'s Encrypt is supported.', + ], + 'enable_api' => [ + 'title' => 'Enable external API usage', + 'description' => 'In order to use the froxlor API you need to activate this option. For more detailed information see https://docs.froxlor.org/', + ], + 'dhparams_file' => [ + 'title' => 'DHParams file (Diffie–Hellman key exchange)', + 'description' => 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.
Example: /etc/ssl/webserver/dhparams.pem

If the file does not exist, it will be created automatically with the following command: openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.', + ], + 'errorlog_level' => [ + 'title' => 'Error log-level', + 'description' => 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.', + ], + 'letsencryptecc' => [ + 'title' => 'Issue ECC / ECDSA certificate', + 'description' => 'If set to a valid key-size the certificate issued will use ECC / ECDSA', + ], + 'froxloraliases' => [ + 'title' => 'Domain aliases for froxlor vhost', + 'description' => 'Comma separated list of domains to add as server alias to the froxlor vhost', + ], + 'default_sslvhostconf' => [ + 'title' => 'Default SSL vHost-settings', + ], + 'includedefault_sslvhostconf' => 'Include non-SSL vHost-settings in SSL-vHost', + 'apply_specialsettings_default' => [ + 'title' => 'Default value for "Apply specialsettings to all subdomains (*.example.com)\' setting when editing a domain', + ], + 'apply_phpconfigs_default' => [ + 'title' => 'Default value for "Apply php-config to all subdomains:\' setting when editing a domain', + ], + 'awstats' => [ + 'logformat' => [ + 'title' => 'LogFormat setting', + 'description' => 'If you use customized logformat for your webserver, you need change the awstats LogFormat too.
Default is 1. For more information check documentation here.', + ], + ], + 'hide_incompatible_settings' => 'Hide incompatible settings', + 'soaemail' => 'Mail address to use in SOA records (defaults to sender address from panel settings if empty)', + 'imprint_url' => [ + 'title' => 'URL to legal notes / imprint', + 'description' => 'Specify an URL to your legal notes / imprint site. The link will be visible on the login screen and on the footer when logged in.', + ], + 'terms_url' => [ + 'title' => 'URL to terms of use', + 'description' => 'Specify an URL to your terms of use site. The link will be visible on the login screen and on the footer when logged in.', + ], + 'privacy_url' => [ + 'title' => 'URL to privacy policy', + 'description' => 'Specify an URL to your privacy policy site / imprint site. The link will be visible on the login screen and on the footer when logged in.', + ], + 'logo_image_header' => [ + 'title' => 'Logo Image (Header)', + 'description' => 'Upload your own logo image to be shown in the header after login (recommended height 30px)', + ], + 'logo_image_login' => [ + 'title' => 'Logo Image (Login)', + 'description' => 'Upload your own logo image to be shown during login', + ], + 'logo_overridetheme' => [ + 'title' => 'Overwrites logo defined in theme by "Logo Image" (Header and Login, see below)', + 'description' => 'This needs to be set to "true" if you intend to use your uploaded logo; alternatively you can still use the theme-based "logo_custom.png" and "logo_custom_login.png" possibility.', + ], + 'logo_overridecustom' => [ + 'title' => 'Overwrite custom logo (logo_custom.png and logo_custom_login.png) defined in theme by "Logo Image" (Header and Login, see below)', + 'description' => 'Set this to "true" if you want to ignore theme-specific custom logos for header and login and use "Logo Image"', + ], + 'createstdsubdom_default' => [ + 'title' => 'Preselected value for "Create standard subdomain" when creating a customer', + ], + 'froxlorusergroup' => [ + 'title' => 'Custom system group for all customer users', + 'description' => 'Usage of libnss-extrausers (system-settings) is required for this to take effect. An empty value skips creation or removes existing group.', + ], + 'acmeshpath' => [ + 'title' => 'Path to acme.sh', + 'description' => 'Set this to where acme.sh is installed to, including the acme.sh script
Default is /root/.acme.sh/acme.sh', + ], + ], + 'spf' => [ + 'use_spf' => 'Activate SPF for domains?', + 'spf_entry' => 'SPF entry for all domains', + ], + 'ssl_certificates' => [ + 'certificate_for' => 'Certificate for', + 'valid_from' => 'Valid from', + 'valid_until' => 'Valid until', + 'issuer' => 'Issuer', + ], + 'success' => [ + 'messages_success' => 'Successfully sent message to %s recipients', + 'success' => 'Information', + 'clickheretocontinue' => 'Click here to continue', + 'settingssaved' => 'The settings have been successfully saved.', + 'rebuildingconfigs' => 'Successfully inserted tasks for rebuild configfiles', + 'domain_import_successfully' => 'Successfully imported %s domains.', + 'backupscheduled' => 'Your backup job has been scheduled. Please wait for it to be processed', + 'backupaborted' => 'Your scheduled backup has been cancelled', + 'dns_record_added' => 'Record added successfully', + 'dns_record_deleted' => 'Record deleted successfully', + 'testmailsent' => 'Test mail sent successfully', + 'settingsimported' => 'Settings imported successfully', + ], + 'tasks' => [ + 'outstanding_tasks' => 'Outstanding cron-tasks', + 'REBUILD_VHOST' => 'Rebuilding webserver-configuration', + 'CREATE_HOME' => 'Adding new customer %loginname%', + 'REBUILD_DNS' => 'Rebuilding bind-configuration', + 'CREATE_FTP' => 'Creating directory for new ftp-user', + 'DELETE_CUSTOMER_FILES' => 'Deleting customer-files %loginname%', + 'noneoutstanding' => 'There are currently no outstanding tasks for Froxlor', + 'CREATE_QUOTA' => 'Set quota on filesystem', + 'DELETE_EMAIL_DATA' => 'Delete customer e-mail data.', + 'DELETE_FTP_DATA' => 'Delete customer ftp-account data.', + 'REBUILD_CRON' => 'Rebuilding the cron.d-file', + 'CREATE_CUSTOMER_BACKUP' => 'Backup job for customer %loginname%', + 'DELETE_DOMAIN_PDNS' => 'Delete domain %domain% from PowerDNS database', + 'DELETE_DOMAIN_SSL' => 'Delete ssl files of domain %domain%', + ], + 'terms' => 'Terms of use', + 'traffic' => [ + 'month' => 'Month', + 'day' => 'Day', + 'months' => [ + 1 => 'January', + 2 => 'February', + 3 => 'March', + 4 => 'April', + 5 => 'May', + 6 => 'June', + 7 => 'July', + 8 => 'August', + 9 => 'September', + 10 => 'October', + 11 => 'November', + 12 => 'December', + 'jan' => 'Jan', + 'feb' => 'Feb', + 'mar' => 'Mar', + 'apr' => 'Apr', + 'may' => 'May', + 'jun' => 'Jun', + 'jul' => 'Jul', + 'aug' => 'Aug', + 'sep' => 'Sep', + 'oct' => 'Oct', + 'nov' => 'Nov', + 'dec' => 'Dec', + 'total' => 'Total', + ], + 'mb' => 'Traffic', + 'distribution' => 'FTP | HTTP | Mail', + 'sumhttp' => 'Total HTTP-Traffic', + 'sumftp' => 'Total FTP-Traffic', + 'summail' => 'Total Mail-Traffic', + 'customer' => 'Customer', + 'domain' => 'Domain', + 'trafficoverview' => 'Traffic summary by', + 'details' => 'Details', + 'http' => 'HTTP', + 'ftp' => 'FTP', + 'mail' => 'Mail', + ], + 'translator' => '', + 'update' => [ + 'updateinprogress_onlyadmincanlogin' => 'A newer version of Froxlor has been installed but not yet set up.
Only the administrator can log in and finish the update.', + 'update' => 'Froxlor update', + 'proceed' => 'Proceed', + 'update_information' => [ + 'part_a' => 'The Froxlor files have been updated to version %newversion. The installed version is %curversion.', + 'part_b' => '

Customers will not be able to log in until the update has been finished.
Proceed?', + ], + 'noupdatesavail' => 'You already have the latest Froxlor version.', + 'description' => 'Running database updates for your froxlor installation', + ], + 'usersettings' => [ + 'custom_notes' => [ + 'title' => 'Custom notes', + 'description' => 'Feel free to put any notes you want/need in here. They will show up in the admin/customer overview for the corresponding user.', + 'show' => 'Show your notes on the dashboard of the user', + ], + 'api_allowed' => [ + 'title' => 'Allow API access', + 'description' => 'When enabled in the settings, this user can create API keys and access the froxlor API', + 'notice' => 'API access is not allowed for your account.', + ], + ], +]; diff --git a/lng/english.lng.php b/lng/english.lng.php deleted file mode 100644 index ae5254ca..00000000 --- a/lng/english.lng.php +++ /dev/null @@ -1,2172 +0,0 @@ - - * @author Froxlor Team - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Global - */ -$lng['translator'] = ''; -$lng['panel']['edit'] = 'Edit'; -$lng['panel']['delete'] = 'Delete'; -$lng['panel']['create'] = 'Create'; -$lng['panel']['save'] = 'Save'; -$lng['panel']['yes'] = 'Yes'; -$lng['panel']['no'] = 'No'; -$lng['panel']['emptyfornochanges'] = 'empty for no changes'; -$lng['panel']['emptyfordefault'] = 'empty for defaults'; -$lng['panel']['path'] = 'Path'; -$lng['panel']['toggle'] = 'Toggle'; -$lng['panel']['next'] = 'Next'; -$lng['panel']['dirsmissing'] = 'Can not find or read the directory!'; - -/** - * Login - */ - -$lng['login']['username'] = 'Username'; -$lng['login']['password'] = 'Password'; -$lng['login']['language'] = 'Language'; -$lng['login']['login'] = 'Login'; -$lng['login']['logout'] = 'Logout'; -$lng['login']['profile_lng'] = 'Profile language'; -$lng['login']['welcomemsg'] = 'Please log in to access your account.'; - -/** - * Customer - */ - -$lng['customer']['documentroot'] = 'Home directory'; -$lng['customer']['name'] = 'Name'; -$lng['customer']['firstname'] = 'First name'; -$lng['customer']['company'] = 'Company'; -$lng['customer']['street'] = 'Street'; -$lng['customer']['zipcode'] = 'Zipcode'; -$lng['customer']['city'] = 'City'; -$lng['customer']['phone'] = 'Phone'; -$lng['customer']['fax'] = 'Fax'; -$lng['customer']['email'] = 'Email'; -$lng['customer']['customernumber'] = 'Customer ID'; -$lng['customer']['diskspace'] = 'Webspace'; -$lng['customer']['traffic'] = 'Traffic'; -$lng['customer']['mysqls'] = 'MySQL-databases'; -$lng['customer']['emails'] = 'Email-addresses'; -$lng['customer']['accounts'] = 'Email-accounts'; -$lng['customer']['forwarders'] = 'Email-forwarders'; -$lng['customer']['ftps'] = 'FTP-accounts'; -$lng['customer']['subdomains'] = 'Subdomains'; -$lng['customer']['domains'] = 'Domains'; -$lng['panel']['unlimited'] = '∞'; -$lng['customer']['mib'] = 'MiB'; -$lng['customer']['gib'] = 'GiB'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Main'; -$lng['menue']['main']['changepassword'] = 'Change password'; -$lng['menue']['main']['changelanguage'] = 'Change language'; -$lng['menue']['email']['email'] = 'Email'; -$lng['menue']['email']['emails'] = 'Addresses'; -$lng['menue']['email']['webmail'] = 'Webmail'; -$lng['menue']['mysql']['mysql'] = 'MySQL'; -$lng['menue']['mysql']['databases'] = 'Databases'; -$lng['menue']['mysql']['phpmyadmin'] = 'phpMyAdmin'; -$lng['menue']['domains']['domains'] = 'Domains'; -$lng['menue']['domains']['settings'] = 'Settings'; -$lng['menue']['ftp']['ftp'] = 'FTP'; -$lng['menue']['ftp']['accounts'] = 'Accounts'; -$lng['menue']['ftp']['webftp'] = 'WebFTP'; -$lng['menue']['extras']['extras'] = 'Extras'; -$lng['menue']['extras']['directoryprotection'] = 'Directory protection'; -$lng['menue']['extras']['pathoptions'] = 'Path options'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Customer details'; -$lng['index']['accountdetails'] = 'Account details'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Old password'; -$lng['changepassword']['new_password'] = 'New password'; -$lng['changepassword']['new_password_confirm'] = 'Confirm password'; -$lng['changepassword']['new_password_ifnotempty'] = 'New password (empty = no change)'; -$lng['changepassword']['also_change_ftp'] = ' also change password of the main FTP account'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Here you can create (sub-)domains and change their paths.
The system will need some time to apply the new settings after every change.'; -$lng['domains']['domainsettings'] = 'Domain settings'; -$lng['domains']['domainname'] = 'Domain name'; -$lng['domains']['subdomain_add'] = 'Create subdomain'; -$lng['domains']['subdomain_edit'] = 'Edit (sub)domain'; -$lng['domains']['wildcarddomain'] = 'Create as wildcarddomain?'; -$lng['domains']['aliasdomain'] = 'Alias for domain'; -$lng['domains']['noaliasdomain'] = 'No alias domain'; - -/** - * E-mails - */ - -$lng['emails']['description'] = 'Here you can create and change your email addresses.
An account is like your letterbox in front of your house. If someone sends you an email, it will be dropped into the account.

To download your emails use the following settings in your mailprogram: (The data in italics has to be changed to the equivalents you typed in!)
Hostname: domainname
Username: account name / e-mail address
password: the password you\'ve chosen'; -$lng['emails']['emailaddress'] = 'Email-address'; -$lng['emails']['emails_add'] = 'Create email-address'; -$lng['emails']['emails_edit'] = 'Edit email-address'; -$lng['emails']['catchall'] = 'Catchall'; -$lng['emails']['iscatchall'] = 'Define as catchall-address?'; -$lng['emails']['account'] = 'Account'; -$lng['emails']['account_add'] = 'Create account'; -$lng['emails']['account_delete'] = 'Delete account'; -$lng['emails']['from'] = 'Source'; -$lng['emails']['to'] = 'Destination'; -$lng['emails']['forwarders'] = 'Forwarders'; -$lng['emails']['forwarder_add'] = 'Create forwarder'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Here you can create and change your FTP-accounts.
The changes are made instantly and the accounts can be used immediately.'; -$lng['ftp']['account_add'] = 'Create account'; - -/** - * MySQL - */ - -$lng['mysql']['databasename'] = 'User/Database name'; -$lng['mysql']['databasedescription'] = 'Database description'; -$lng['mysql']['database_create'] = 'Create database'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Here you can add some extras, for example directory protection.
The system will need some time to apply the new settings after every change.'; -$lng['extras']['directoryprotection_add'] = 'Add directory protection'; -$lng['extras']['view_directory'] = 'Display directory content'; -$lng['extras']['pathoptions_add'] = 'Add path options'; -$lng['extras']['directory_browsing'] = 'Directory content browsing'; -$lng['extras']['pathoptions_edit'] = 'Edit path options'; -$lng['extras']['error404path'] = '404'; -$lng['extras']['error403path'] = '403'; -$lng['extras']['error500path'] = '500'; -$lng['extras']['error401path'] = '401'; -$lng['extras']['errordocument404path'] = 'ErrorDocument 404'; -$lng['extras']['errordocument403path'] = 'ErrorDocument 403'; -$lng['extras']['errordocument500path'] = 'ErrorDocument 500'; -$lng['extras']['errordocument401path'] = 'ErrorDocument 401'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Error'; -$lng['error']['directorymustexist'] = 'The directory %s must exist. Please create it with your FTP client.'; -$lng['error']['filemustexist'] = 'The file %s must exist.'; -$lng['error']['allresourcesused'] = 'You have already used all of your resources.'; -$lng['error']['domains_cantdeletemaindomain'] = 'You cannot delete a domain which is used as an email-domain.'; -$lng['error']['domains_canteditdomain'] = 'You cannot edit this domain. It has been disabled by the admin.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'You cannot delete a domain which is used as an email-domain. Delete all email addresses first.'; -$lng['error']['firstdeleteallsubdomains'] = 'You have to delete all subdomains first before you can create a wildcard domain.'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'You have already defined a catchall for this domain.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'You cannot delete your main FTP account'; -$lng['error']['login'] = 'The username or password you typed in is wrong. Please try it again!'; -$lng['error']['login_blocked'] = 'This account has been suspended because of too many login errors.
Please try again in %s seconds.'; -$lng['error']['notallreqfieldsorerrors'] = 'You have not filled in all or filled in some fields incorrectly.'; -$lng['error']['oldpasswordnotcorrect'] = 'The old password is not correct.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'You cannot allocate more resources than you own for yourself.'; -$lng['error']['mustbeurl'] = 'You have not typed a valid or complete url (e.g. http://somedomain.com/error404.htm)'; -$lng['error']['invalidpath'] = 'You have not chosen a valid URL (maybe problems with the dirlisting?)'; -$lng['error']['stringisempty'] = 'Missing Input in Field'; -$lng['error']['stringiswrong'] = 'Wrong Input in Field'; -$lng['error']['newpasswordconfirmerror'] = 'New password and confirmation does not match'; -$lng['error']['mydomain'] = '\'Domain\''; -$lng['error']['mydocumentroot'] = '\'Documentroot\''; -$lng['error']['loginnameexists'] = 'Loginname %s already exists'; -$lng['error']['emailiswrong'] = 'Email-address %s contains invalid characters or is incomplete'; -$lng['error']['alternativeemailiswrong'] = 'The given alternative email address %s to send the credentials to seems to be invalid'; -$lng['error']['loginnameiswrong'] = 'Loginname "%s" contains illegal characters.'; -$lng['error']['loginnameiswrong2'] = 'Loginname contains too many characters. Only %s characters are allowed.'; -$lng['error']['userpathcombinationdupe'] = 'Combination of username and path already exists'; -$lng['error']['patherror'] = 'General Error! Path cannot be empty'; -$lng['error']['errordocpathdupe'] = 'Option for path %s already exists'; -$lng['error']['adduserfirst'] = 'Please create a customer first'; -$lng['error']['domainalreadyexists'] = 'The domain %s is already assigned to a customer'; -$lng['error']['nolanguageselect'] = 'No language selected.'; -$lng['error']['nosubjectcreate'] = 'You must define a topic for this mail template.'; -$lng['error']['nomailbodycreate'] = 'You must define a mail-text for this mail template.'; -$lng['error']['templatenotfound'] = 'Template was not found.'; -$lng['error']['alltemplatesdefined'] = 'You can\'t define more templates, all languages are supported already.'; -$lng['error']['wwwnotallowed'] = 'www is not allowed for subdomains.'; -$lng['error']['subdomainiswrong'] = 'The subdomain %s contains invalid characters.'; -$lng['error']['domaincantbeempty'] = 'The domain-name can not be empty.'; -$lng['error']['domainexistalready'] = 'The domain %s already exists.'; -$lng['error']['domainisaliasorothercustomer'] = 'The selected alias domain is either itself an alias domain, has a different ip/port combination or belongs to another customer.'; -$lng['error']['emailexistalready'] = 'The email-address %s already exists.'; -$lng['error']['maindomainnonexist'] = 'The main-domain %s does not exist.'; -$lng['error']['destinationnonexist'] = 'Please create your forwarder in the field \'Destination\'.'; -$lng['error']['destinationalreadyexistasmail'] = 'The forwarder to %s already exists as active email-address.'; -$lng['error']['destinationalreadyexist'] = 'You have already defined a forwarder to "%s"'; -$lng['error']['destinationiswrong'] = 'The forwarder %s contains invalid character(s) or is incomplete.'; -$lng['error']['backupfoldercannotbedocroot'] = 'The folder for backups cannot be your homedir, please chose a folder within your homedir, e.g. /backups'; -$lng['error']['templatelanguagecombodefined'] = 'The selected language/template combination has already been defined.'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Security question'; -$lng['question']['admin_customer_reallydelete'] = 'Do you really want to delete the customer %s? This cannot be undone!'; -$lng['question']['admin_domain_reallydelete'] = 'Do you really want to delete the domain %s?'; -$lng['question']['admin_domain_reallydisablesecuritysetting'] = 'Do you really want to disable this security setting OpenBasedir?'; -$lng['question']['admin_admin_reallydelete'] = 'Do you really want to delete the admin %s? Every customer and domain will be reassigned to your account.'; -$lng['question']['admin_template_reallydelete'] = 'Do you really want to delete the template \'%s\'?'; -$lng['question']['domains_reallydelete'] = 'Do you really want to delete the domain %s?'; -$lng['question']['email_reallydelete'] = 'Do you really want to delete the email-address %s?'; -$lng['question']['email_reallydelete_account'] = 'Do you really want to delete the email-account of %s?'; -$lng['question']['email_reallydelete_forwarder'] = 'Do you really want to delete the forwarder %s?'; -$lng['question']['extras_reallydelete'] = 'Do you really want to delete the directory protection for %s?'; -$lng['question']['extras_reallydelete_pathoptions'] = 'Do you really want to delete the path options for %s?'; -$lng['question']['ftp_reallydelete'] = 'Do you really want to delete the FTP-account %s?'; -$lng['question']['mysql_reallydelete'] = 'Do you really want to delete the database %s? This cannot be undone!'; -$lng['question']['admin_configs_reallyrebuild'] = 'Do you really want to rebuild all config files?'; -$lng['question']['admin_customer_alsoremovefiles'] = 'Remove user files too?'; -$lng['question']['admin_customer_alsoremovemail'] = 'Completely remove email data from filesystem?'; -$lng['question']['admin_customer_alsoremoveftphomedir'] = 'Also remove FTP-user homedir?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['mailbody'] = 'Hello,\n\nyour mail account {EMAIL}\nwas set up successfully.\n\nThis is an automatically created\ne-mail, please do not answer!\n\nYours sincerely, your administrator'; -$lng['mails']['pop_success']['subject'] = 'Mail account set up successfully'; -$lng['mails']['createcustomer']['mailbody'] = 'Hello {FIRSTNAME} {NAME},\n\nhere is your account information:\n\nUsername: {USERNAME}\nPassword: {PASSWORD}\n\nThank you,\nyour administrator'; -$lng['mails']['createcustomer']['subject'] = 'Account information'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Overview'; -$lng['admin']['ressourcedetails'] = 'Used resources'; -$lng['admin']['systemdetails'] = 'System details'; -$lng['admin']['froxlordetails'] = 'Froxlor details'; -$lng['admin']['installedversion'] = 'Installed version'; -$lng['admin']['latestversion'] = 'Latest version'; -$lng['admin']['lookfornewversion']['clickhere'] = 'Search via webservice'; -$lng['admin']['lookfornewversion']['error'] = 'Error while reading'; -$lng['admin']['resources'] = 'Resources'; -$lng['admin']['customer'] = 'Customer'; -$lng['admin']['customers'] = 'Customers'; -$lng['admin']['customer_add'] = 'Create customer'; -$lng['admin']['customer_edit'] = 'Edit customer'; -$lng['admin']['domains'] = 'Domains'; -$lng['admin']['domain_add'] = 'Create domain'; -$lng['admin']['domain_edit'] = 'Edit domain'; -$lng['admin']['subdomainforemail'] = 'Subdomains as email-domains'; -$lng['admin']['admin'] = 'Admin'; -$lng['admin']['admins'] = 'Admins'; -$lng['admin']['admin_add'] = 'Create admin'; -$lng['admin']['admin_edit'] = 'Edit admin'; -$lng['admin']['customers_see_all'] = 'Can see all customers?'; -$lng['admin']['domains_see_all'] = 'Can see all domains?'; -$lng['admin']['change_serversettings'] = 'Can change server settings?'; -$lng['admin']['server'] = 'System'; -$lng['admin']['serversettings'] = 'Settings'; -$lng['admin']['rebuildconf'] = 'Rebuild config files'; -$lng['admin']['stdsubdomain'] = 'Standard subdomain'; -$lng['admin']['stdsubdomain_add'] = 'Create standard subdomain'; -$lng['admin']['phpenabled'] = 'PHP enabled'; -$lng['admin']['deactivated'] = 'Deactivated'; -$lng['admin']['deactivated_user'] = 'Deactivate user'; -$lng['admin']['sendpassword'] = 'Send password'; -$lng['admin']['ownvhostsettings'] = 'Own vHost-settings'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Configuration'; -$lng['admin']['templates']['templates'] = 'Email-templates'; -$lng['admin']['templates']['template_add'] = 'Add template'; -$lng['admin']['templates']['template_fileadd'] = 'Add file template'; -$lng['admin']['templates']['template_edit'] = 'Edit template'; -$lng['admin']['templates']['action'] = 'Action'; -$lng['admin']['templates']['email'] = 'Email & file templates'; -$lng['admin']['templates']['subject'] = 'Subject'; -$lng['admin']['templates']['mailbody'] = 'Mail body'; -$lng['admin']['templates']['createcustomer'] = 'Welcome mail for new customers'; -$lng['admin']['templates']['pop_success'] = 'Welcome mail for new email accounts'; -$lng['admin']['templates']['template_replace_vars'] = 'Variables to be replaced in the template:'; -$lng['admin']['templates']['SALUTATION'] = 'Replaced with a correct salutation (name or company)'; -$lng['admin']['templates']['FIRSTNAME'] = 'Replaced with the customer\'s first name.'; -$lng['admin']['templates']['NAME'] = 'Replaced with the customers name.'; -$lng['admin']['templates']['COMPANY'] = 'Replaces with the customer\'s company name'; -$lng['admin']['templates']['USERNAME'] = 'Replaced with the customer\'s account username.'; -$lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account password.'; -$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.'; -$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number'; -$lng['admin']['webserver'] = 'Webserver'; -$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '
ATTENTION: If you use a zonefile you will have to manage all required records for all sub-zones manually as well.'; - -/** - * Serversettings - */ - -$lng['serversettings']['session_timeout']['title'] = 'Session Timeout'; -$lng['serversettings']['session_timeout']['description'] = 'How long does a user have to be inactive before a session gets invalid (seconds)?'; -$lng['serversettings']['accountprefix']['title'] = 'Customer prefix'; -$lng['serversettings']['accountprefix']['description'] = 'Which prefix should customer accounts have?'; -$lng['serversettings']['mysqlprefix']['title'] = 'SQL Prefix'; -$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?
Use "RANDOM" as value to get a 3-digit random prefix
Use "DBNAME" as the value, a database name field is used together with the customer name as a prefix.'; -$lng['serversettings']['ftpprefix']['title'] = 'FTP Prefix'; -$lng['serversettings']['ftpprefix']['description'] = 'Which prefix should ftp accounts have?
If you change this you also have to change the Quota SQL Query in your FTP Server config file in case you use it! '; -$lng['serversettings']['documentroot_prefix']['title'] = 'Home directory'; -$lng['serversettings']['documentroot_prefix']['description'] = 'Where should all home directories be stored?'; -$lng['serversettings']['logfiles_directory']['title'] = 'Logfiles directory'; -$lng['serversettings']['logfiles_directory']['description'] = 'Where should all log files be stored?'; -$lng['serversettings']['logfiles_script']['title'] = 'Custom script to pipe log-files to'; -$lng['serversettings']['logfiles_script']['description'] = 'You can specify a script here and use the placeholders {LOGFILE}, {DOMAIN} and {CUSTOMER} if needed. In case you want to use it you will need to activate the Pipe webserver logfiles option too. No prefixed pipe-character is needed.'; -$lng['serversettings']['logfiles_format']['title'] = 'Access-log format'; -$lng['serversettings']['logfiles_format']['description'] = 'Enter a custom log-format here according to your webservers specifications, leave empty for default. Depending on your format the string must be quoted.
If used with nginx, it will look like log_format frx_custom {CONFIGURED_VALUE}.
If used with Apache, it will look like LogFormat {CONFIGURED_VALUE} frx_custom.
Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!'; -$lng['serversettings']['logfiles_type']['title'] = 'Access-log type'; -$lng['serversettings']['logfiles_type']['description'] = 'Choose between combined or vhost_combined here.'; -$lng['serversettings']['logfiles_piped']['title'] = 'Pipe webserver logfiles to specified script (see above)'; -$lng['serversettings']['logfiles_piped']['description'] = 'When using a custom script for the logfiles you need to activate this in order for it to be executed'; -$lng['serversettings']['ipaddress']['title'] = 'IP-address'; -$lng['serversettings']['ipaddress']['description'] = 'What\'s the main IP-address of this server?'; -$lng['serversettings']['hostname']['title'] = 'Hostname'; -$lng['serversettings']['hostname']['description'] = 'What\'s the Hostname of this server?'; -$lng['serversettings']['apachereload_command']['title'] = 'Webserver reload command'; -$lng['serversettings']['apachereload_command']['description'] = 'What\'s the webserver command to reload configfiles?'; -$lng['serversettings']['bindenable']['title'] = 'Enable Nameserver'; -$lng['serversettings']['bindenable']['description'] = 'Here the Nameserver can be enabled and disabled globally.'; -$lng['serversettings']['bindconf_directory']['title'] = 'Dns server config directory'; -$lng['serversettings']['bindconf_directory']['description'] = 'Where should dns-server config files be saved?'; -$lng['serversettings']['bindreload_command']['title'] = 'DNS server reload command'; -$lng['serversettings']['bindreload_command']['description'] = 'What\'s the command to reload the dns server daemon?'; -$lng['serversettings']['vmail_uid']['title'] = 'Mails-UID'; -$lng['serversettings']['vmail_uid']['description'] = 'Which UserID should mails have?'; -$lng['serversettings']['vmail_gid']['title'] = 'Mails-GID'; -$lng['serversettings']['vmail_gid']['description'] = 'Which GroupID should mails have?'; -$lng['serversettings']['vmail_homedir']['title'] = 'Mails-homedir'; -$lng['serversettings']['vmail_homedir']['description'] = 'Where should all mails be stored?'; -$lng['serversettings']['adminmail']['title'] = 'Sender'; -$lng['serversettings']['adminmail']['description'] = 'What\'s the sender address for emails sent from the Panel?'; -$lng['serversettings']['phpmyadmin_url']['title'] = 'phpMyAdmin URL'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'What\'s the URL to phpMyAdmin? (has to start with http(s)://)'; -$lng['serversettings']['webmail_url']['title'] = 'Webmail URL'; -$lng['serversettings']['webmail_url']['description'] = 'What\'s the URL to webmail? (has to start with http(s)://)'; -$lng['serversettings']['webftp_url']['title'] = 'WebFTP URL'; -$lng['serversettings']['webftp_url']['description'] = 'What\'s the URL to WebFTP? (has to start with http(s)://)'; -$lng['serversettings']['language']['description'] = 'What\'s your standard server language?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Max Login Attempts'; -$lng['serversettings']['maxloginattempts']['description'] = 'Maximum login attempts after which the account gets disabled.'; -$lng['serversettings']['deactivatetime']['title'] = 'Deactivation Time'; -$lng['serversettings']['deactivatetime']['description'] = 'Time (sec.) an account gets disabled after too many login tries.'; -$lng['serversettings']['pathedit']['title'] = 'Type of path input'; -$lng['serversettings']['pathedit']['description'] = 'Should a path be selected by a dropdown menu or by an input field?'; -$lng['serversettings']['nameservers']['title'] = 'Nameservers'; -$lng['serversettings']['nameservers']['description'] = 'A comma separated list containing the hostnames of all nameservers. The first one will be the primary one.'; -$lng['serversettings']['mxservers']['title'] = 'MX servers'; -$lng['serversettings']['mxservers']['description'] = 'A comma separated list containing a pair of a number and a hostname separated by whitespace (e.g. \'10 mx.example.com\') containing the mx servers.'; - -/** - * CHANGED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['mysql']['description'] = 'Here you can create and change your MySQL-databases.
The changes are made instantly and the database can be used immediately.
At the menu on the left side you find the tool phpMyAdmin with which you can easily administer your database.

To use your databases in your own php-scripts use the following settings: (The data in italics have to be changed into the equivalents you typed in!)
Hostname:
Username: databasename
Password: the password you\'ve chosen
Database: databasename'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['serversettings']['paging']['title'] = 'Entries per page'; -$lng['serversettings']['paging']['description'] = 'How many entries shall be shown on one page? (0 = disable paging)'; -$lng['error']['ipstillhasdomains'] = 'The IP/Port combination you want to delete still has domains assigned to it, please reassign those to other IP/Port combinations before deleting this IP/Port combination.'; -$lng['error']['cantdeletedefaultip'] = 'You cannot delete the default IP/Port combination, please make another IP/Port combination default for before deleting this IP/Port combination.'; -$lng['error']['cantdeletesystemip'] = 'You cannot delete the last system IP, either create a new IP/Port combination for the system IP or change the system IP.'; -$lng['error']['myipaddress'] = '\'IP\''; -$lng['error']['myport'] = '\'Port\''; -$lng['error']['myipdefault'] = 'You need to select an IP/Port combination that should become default.'; -$lng['error']['myipnotdouble'] = 'This IP/Port combination already exists.'; -$lng['error']['admin_domain_emailsystemhostname'] = 'The server-hostname cannot be used as customer-domain.'; -$lng['question']['admin_ip_reallydelete'] = 'Do you really want to delete the IP address %s?'; -$lng['admin']['ipsandports']['ipsandports'] = 'IPs and Ports'; -$lng['admin']['ipsandports']['add'] = 'Add IP/Port'; -$lng['admin']['ipsandports']['edit'] = 'Edit IP/Port'; -$lng['admin']['ipsandports']['ipandport'] = 'IP/Port'; -$lng['admin']['ipsandports']['ip'] = 'IP'; -$lng['admin']['ipsandports']['ipnote'] = '
Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.
Only use private ip addresses if you are sure.
'; -$lng['admin']['ipsandports']['port'] = 'Port'; - -// ADDED IN 1.2.13-rc3 - -$lng['error']['cantchangesystemip'] = 'You cannot change the last system IP, either create another new IP/Port combination for the system IP or change the system IP.'; -$lng['question']['admin_domain_reallydocrootoutofcustomerroot'] = 'Are you sure, you want the document root for this domain, not being within the customer root of the customer?'; - -// ADDED IN 1.2.14-rc1 - -$lng['admin']['memorylimitdisabled'] = 'Disabled'; -$lng['domain']['openbasedirpath'] = 'OpenBasedir-path'; -$lng['domain']['docroot'] = 'Path from field above'; -$lng['domain']['homedir'] = 'Home directory'; -$lng['admin']['valuemandatory'] = 'This value is mandatory'; -$lng['admin']['valuemandatorycompany'] = 'Either "name" and "firstname" or "company" must be filled'; -$lng['menue']['main']['username'] = 'Logged in as: '; -$lng['panel']['urloverridespath'] = 'URL (overrides path)'; -$lng['panel']['pathorurl'] = 'Path or URL'; -$lng['error']['sessiontimeoutiswrong'] = 'Only numerical "session timeout" is allowed.'; -$lng['error']['maxloginattemptsiswrong'] = 'Only numerical "max login attempts" are allowed.'; -$lng['error']['deactivatetimiswrong'] = 'Only numerical "deactivation time" is allowed.'; -$lng['error']['accountprefixiswrong'] = 'The "customerprefix" is wrong.'; -$lng['error']['mysqlprefixiswrong'] = 'The "SQL prefix" is wrong.'; -$lng['error']['ftpprefixiswrong'] = 'The "FTP prefix" is wrong.'; -$lng['error']['ipiswrong'] = 'The "IP-address" is wrong. Only a valid IP-address is allowed.'; -$lng['error']['vmailuidiswrong'] = 'The "mails-uid" is wrong. Only a numerical UID is allowed.'; -$lng['error']['vmailgidiswrong'] = 'The "mails-gid" is wrong. Only a numerical GID is allowed.'; -$lng['error']['adminmailiswrong'] = 'The "sender-address" is wrong. Only a valid email-address is allowed.'; -$lng['error']['pagingiswrong'] = 'The "entries per page"-value is wrong. Only numerical characters are allowed.'; -$lng['error']['phpmyadminiswrong'] = 'The phpMyAdmin-link is not a valid link.'; -$lng['error']['webmailiswrong'] = 'The webmail-link is not a valid link.'; -$lng['error']['webftpiswrong'] = 'The WebFTP-link is not a valid link.'; -$lng['domains']['hasaliasdomains'] = 'Has alias domain(s)'; -$lng['serversettings']['defaultip']['title'] = 'Default IP/Port'; -$lng['serversettings']['defaultip']['description'] = 'Select all IP-addresses you want to use as default for new domains'; -$lng['serversettings']['defaultsslip']['title'] = 'Default SSL IP/Port'; -$lng['serversettings']['defaultsslip']['description'] = 'Select all ssl-enabled IP-addresses you want to use as default for new domains'; -$lng['domains']['statstics'] = 'Usage Statistics'; -$lng['panel']['ascending'] = 'ascending'; -$lng['panel']['descending'] = 'descending'; -$lng['panel']['search'] = 'Search'; -$lng['panel']['used'] = 'used'; - -// ADDED IN 1.2.14-rc3 - -$lng['panel']['translator'] = 'Translator'; - -// ADDED IN 1.2.14-rc4 - -$lng['error']['stringformaterror'] = 'The value for the field "%s" is not in the expected format.'; - -// ADDED IN 1.2.15-rc1 - -$lng['admin']['serversoftware'] = 'Serversoftware'; -$lng['admin']['phpversion'] = 'PHP-Version'; -$lng['admin']['mysqlserverversion'] = 'MySQL server version'; -$lng['admin']['webserverinterface'] = 'Webserver interface'; -$lng['domains']['isassigneddomain'] = 'Is assigned domain'; -$lng['serversettings']['phpappendopenbasedir']['title'] = 'Paths to append to OpenBasedir'; -$lng['serversettings']['phpappendopenbasedir']['description'] = 'These paths (separated by colons) will be added to the OpenBasedir-statement in every vHost-container.'; - -// CHANGED IN 1.2.15-rc1 - -$lng['error']['loginnameissystemaccount'] = 'You cannot create accounts which are similar to system accounts (as for example begin with "%s"). Please enter another account name.'; -$lng['error']['youcantdeleteyourself'] = 'You cannot delete yourself for security reasons.'; -$lng['error']['youcanteditallfieldsofyourself'] = 'Note: You cannot edit all fields of your own account for security reasons.'; - -// ADDED IN 1.2.16-svn1 - -$lng['serversettings']['natsorting']['title'] = 'Use natural human sorting in list view'; -$lng['serversettings']['natsorting']['description'] = 'Sorts lists as web1 -> web2 -> web11 instead of web1 -> web11 -> web2.'; - -// ADDED IN 1.2.16-svn2 - -$lng['serversettings']['deactivateddocroot']['title'] = 'Docroot for deactivated users'; -$lng['serversettings']['deactivateddocroot']['description'] = 'When a user is deactivated this path is used as his docroot. Leave empty for not creating a vHost at all.'; - -// ADDED IN 1.2.16-svn4 - -$lng['panel']['reset'] = 'Discard changes'; -$lng['admin']['accountsettings'] = 'Account settings'; -$lng['admin']['panelsettings'] = 'Panel settings'; -$lng['admin']['systemsettings'] = 'System settings'; -$lng['admin']['webserversettings'] = 'Webserver settings'; -$lng['admin']['mailserversettings'] = 'Mailserver settings'; -$lng['admin']['nameserversettings'] = 'Nameserver settings'; -$lng['admin']['updatecounters'] = 'Recalculate resource usage'; -$lng['question']['admin_counters_reallyupdate'] = 'Do you really want to recalculate resource usage?'; -$lng['panel']['pathDescription'] = 'If the directory doesn\'t exist, it will be created automatically.'; -$lng['panel']['pathDescriptionEx'] = '

If you want a redirect to another domain than this entry has to start with http:// or https://.'; -$lng['panel']['pathDescriptionSubdomain'] = $lng['panel']['pathDescription'] . $lng['panel']['pathDescriptionEx'] . "

If the URL ends with / it is considered a folder, if not, it is treated as file."; - -// ADDED IN 1.2.16-svn6 - -$lng['admin']['templates']['TRAFFIC'] = 'Replaced with the traffic in MB, which was assigned to the customer.'; -$lng['admin']['templates']['TRAFFICUSED'] = 'Replaced with the traffic in MB, which was exhausted by the customer.'; - -// ADDED IN 1.2.16-svn7 - -$lng['admin']['subcanemaildomain']['never'] = 'Never'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'Choosable, default no'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'Choosable, default yes'; -$lng['admin']['subcanemaildomain']['always'] = 'Always'; -$lng['changepassword']['also_change_stats'] = ' also change password for the statistics page'; - -// ADDED IN 1.2.16-svn8 - -$lng['serversettings']['mailpwcleartext']['title'] = 'Also save passwords of mail accounts unencrypted in database'; -$lng['serversettings']['mailpwcleartext']['description'] = 'If this is set to yes, all passwords will also be saved unencrypted (clear text, plain readable for everyone with database access) in the mail_users-table. Only activate this if you intend to use SASL!'; -$lng['admin']['wipecleartextmailpwd'] = 'Clear plaintext passwords'; -$lng['question']['admin_cleartextmailpws_reallywipe'] = 'Do you really want to wipe all unencrypted mail account passwords from the table mail_users? This cannot be reverted! The setting to store email passwords unencrypted will also be set to OFF'; -$lng['admin']['configfiles']['overview'] = 'Overview'; -$lng['admin']['configfiles']['wizard'] = 'Wizard'; -$lng['admin']['configfiles']['distribution'] = 'Distribution'; -$lng['admin']['configfiles']['service'] = 'Service'; -$lng['admin']['configfiles']['daemon'] = 'Daemon'; -$lng['admin']['configfiles']['http'] = 'Webserver (HTTP)'; -$lng['admin']['configfiles']['dns'] = 'Nameserver (DNS)'; -$lng['admin']['configfiles']['mail'] = 'Mailserver (IMAP/POP3)'; -$lng['admin']['configfiles']['smtp'] = 'Mailserver (SMTP)'; -$lng['admin']['configfiles']['ftp'] = 'FTP-server'; -$lng['admin']['configfiles']['etc'] = 'Others (System)'; -$lng['admin']['configfiles']['choosedistribution'] = '-- Choose a distribution --'; -$lng['admin']['configfiles']['chooseservice'] = '-- Choose a service --'; -$lng['admin']['configfiles']['choosedaemon'] = '-- Choose a daemon --'; - -// ADDED IN 1.2.16-svn10 - -$lng['serversettings']['ftpdomain']['title'] = 'FTP accounts @domain'; -$lng['serversettings']['ftpdomain']['description'] = 'Customers can create FTP accounts user@customerdomain?'; -$lng['panel']['back'] = 'Back'; - -// ADDED IN 1.2.16-svn12 - -$lng['serversettings']['mod_fcgid']['title'] = 'Enable FCGID'; -$lng['serversettings']['mod_fcgid']['description'] = 'Use this to run PHP with the corresponding user account.

This needs a special webserver configuration for Apache, see FCGID - handbook'; -$lng['serversettings']['sendalternativemail']['title'] = 'Use alternative email-address'; -$lng['serversettings']['sendalternativemail']['description'] = 'Send the password-email to a different address during email-account-creation'; -$lng['emails']['alternative_emailaddress'] = 'Alternative e-mail-address'; -$lng['mails']['pop_success_alternative']['mailbody'] = 'Hello,\n\nyour Mail account {EMAIL}\nwas set up successfully.\nYour password is {PASSWORD}.\n\nThis is an automatically created\ne-mail, please do not answer!\n\nYours sincerely, your administrator'; -$lng['mails']['pop_success_alternative']['subject'] = 'Mail account set up successfully'; -$lng['admin']['templates']['pop_success_alternative'] = 'Welcome mail for new email accounts sent to alternative address'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Replaced with the POP3/IMAP account password.'; - -// ADDED IN 1.2.16-svn13 - -$lng['error']['documentrootexists'] = 'The directory "%s" already exists for this customer. Please remove this before adding the customer again.'; - -// ADDED IN 1.2.16-svn14 - -$lng['serversettings']['apacheconf_vhost']['title'] = 'Webserver vHost configuration file/dirname'; -$lng['serversettings']['apacheconf_vhost']['description'] = 'Where should the vHost configuration be stored? You could either specify a file (all vHosts in one file) or directory (each vHost in his own file) here.'; -$lng['serversettings']['apacheconf_diroptions']['title'] = 'Webserver diroptions configuration file/dirname'; -$lng['serversettings']['apacheconf_diroptions']['description'] = 'Where should the diroptions configuration be stored? You could either specify a file (all diroptions in one file) or directory (each diroption in his own file) here.'; -$lng['serversettings']['apacheconf_htpasswddir']['title'] = 'Webserver htpasswd dirname'; -$lng['serversettings']['apacheconf_htpasswddir']['description'] = 'Where should the htpasswd files for directory protection be stored?'; - -// ADDED IN 1.2.16-svn15 - -$lng['error']['formtokencompromised'] = 'The request seems to be compromised. For security reasons you were logged out.'; -$lng['serversettings']['mysql_access_host']['title'] = 'MySQL-Access-Hosts'; -$lng['serversettings']['mysql_access_host']['description'] = 'A comma separated list of hosts from which users should be allowed to connect to the MySQL-Server. To allow a subnet the netmask or cidr syntax is valid.'; - -// ADDED IN 1.2.18-svn1 - -$lng['admin']['ipsandports']['create_listen_statement'] = 'Create Listen statement'; -$lng['admin']['ipsandports']['create_namevirtualhost_statement'] = 'Create NameVirtualHost statement'; -$lng['admin']['ipsandports']['create_vhostcontainer'] = 'Create vHost-Container'; -$lng['admin']['ipsandports']['create_vhostcontainer_servername_statement'] = 'Create ServerName statement in vHost-Container'; - -// ADDED IN 1.2.18-svn2 - -$lng['admin']['webalizersettings'] = 'Webalizer settings'; -$lng['admin']['webalizer']['normal'] = 'Normal'; -$lng['admin']['webalizer']['quiet'] = 'Quiet'; -$lng['admin']['webalizer']['veryquiet'] = 'No output'; -$lng['serversettings']['webalizer_quiet']['title'] = 'Webalizer output'; -$lng['serversettings']['webalizer_quiet']['description'] = 'Verbosity of the webalizer-program'; - -// ADDED IN 1.2.18-svn4 - -$lng['admin']['domain_nocustomeraddingavailable'] = 'It\'s not possible to add a domain currently. You first need to add at least one customer.'; -$lng['error']['norepymailiswrong'] = 'The "Noreply-address" is wrong. Only a valid email-address is allowed.'; - -// ADDED IN 1.2.19-svn1 - -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Configuration directory'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Where should all fcgid-configuration files be stored? If you don\'t use a self compiled suexec binary, which is the normal situation, this path must be under /var/www/

NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.
'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Temp directory'; - -// ADDED IN 1.2.19-svn4 - -$lng['menue']['traffic']['traffic'] = 'Traffic'; -$lng['menue']['traffic']['current'] = 'Current Month'; -$lng['traffic']['month'] = "Month"; -$lng['traffic']['day'] = "Day"; -$lng['traffic']['months'][1] = "January"; -$lng['traffic']['months'][2] = "February"; -$lng['traffic']['months'][3] = "March"; -$lng['traffic']['months'][4] = "April"; -$lng['traffic']['months'][5] = "May"; -$lng['traffic']['months'][6] = "June"; -$lng['traffic']['months'][7] = "July"; -$lng['traffic']['months'][8] = "August"; -$lng['traffic']['months'][9] = "September"; -$lng['traffic']['months'][10] = "October"; -$lng['traffic']['months'][11] = "November"; -$lng['traffic']['months'][12] = "December"; -$lng['traffic']['mb'] = "Traffic"; -$lng['traffic']['distribution'] = 'FTP | HTTP | Mail'; -$lng['traffic']['sumhttp'] = 'Total HTTP-Traffic'; -$lng['traffic']['sumftp'] = 'Total FTP-Traffic'; -$lng['traffic']['summail'] = 'Total Mail-Traffic'; - -// ADDED IN 1.2.19-svn6 - -$lng['admin']['loggersettings'] = 'Log settings'; -$lng['serversettings']['logger']['enable'] = 'Logging enabled/disabled'; -$lng['serversettings']['logger']['severity'] = 'Logging level'; -$lng['admin']['logger']['normal'] = 'normal'; -$lng['admin']['logger']['paranoid'] = 'paranoid'; -$lng['serversettings']['logger']['types']['title'] = 'Log-type(s)'; -$lng['serversettings']['logger']['types']['description'] = 'Specify logtypes. To select multiple types, hold down CTRL while selecting.
Available logtypes are: syslog, file, mysql'; -$lng['serversettings']['logger']['logfile'] = 'Logfile path including filename'; -$lng['error']['logerror'] = 'Log-Error: %s'; -$lng['serversettings']['logger']['logcron'] = 'Log cronjobs'; -$lng['serversettings']['logger']['logcronoption']['never'] = 'Never'; -$lng['serversettings']['logger']['logcronoption']['once'] = 'Once'; -$lng['serversettings']['logger']['logcronoption']['always'] = 'Always'; -$lng['question']['logger_reallytruncate'] = 'Do you really want to truncate the table "%s"?'; -$lng['admin']['loggersystem'] = 'System log'; -$lng['logger']['date'] = 'Date'; -$lng['logger']['type'] = 'Type'; -$lng['logger']['action'] = 'Action'; -$lng['logger']['user'] = 'User'; -$lng['logger']['truncate'] = 'Empty log'; - -// ADDED IN 1.2.19-svn7 - -$lng['serversettings']['ssl']['use_ssl']['title'] = 'Enable SSL usage'; -$lng['serversettings']['ssl']['use_ssl']['description'] = 'Check this if you want to use SSL for your webserver'; -$lng['serversettings']['ssl']['ssl_cert_file']['title'] = 'Path to the SSL certificate'; -$lng['serversettings']['ssl']['ssl_cert_file']['description'] = 'Specify the path including the filename of the .crt or .pem file (main certificate)'; -$lng['serversettings']['ssl']['openssl_cnf'] = 'Defaults for creating the Cert file'; -$lng['panel']['reseller'] = 'reseller'; -$lng['panel']['admin'] = 'admin'; -$lng['panel']['customer'] = 'customer/s'; -$lng['error']['nomessagetosend'] = 'You did not enter a message.'; -$lng['error']['norecipientsgiven'] = 'You did not specify any recipient'; -$lng['admin']['emaildomain'] = 'Emaildomain'; -$lng['admin']['email_only'] = 'Only email?'; -$lng['admin']['wwwserveralias'] = 'Add a "www." ServerAlias'; -$lng['admin']['ipsandports']['enable_ssl'] = 'Is this an SSL Port?'; -$lng['admin']['ipsandports']['ssl_cert_file'] = 'Path to the SSL Certificate'; -$lng['panel']['send'] = 'send'; -$lng['admin']['subject'] = 'Subject'; -$lng['admin']['recipient'] = 'Recipient'; -$lng['admin']['message'] = 'Write a Message'; -$lng['admin']['text'] = 'Message'; -$lng['menu']['message'] = 'Messages'; -$lng['error']['errorsendingmail'] = 'The message to "%s" failed'; -$lng['error']['cannotreaddir'] = 'Unable to read directory "%s"'; -$lng['success']['messages_success'] = 'Successfully sent message to %s recipients'; -$lng['message']['norecipients'] = 'No e-mail has been sent because there are no recipients in the database'; -$lng['admin']['sslsettings'] = 'SSL settings'; -$lng['cronjobs']['notyetrun'] = 'Not yet run'; -$lng['serversettings']['default_vhostconf']['title'] = 'Default vHost-settings'; -$lng['admin']['specialsettings_replacements'] = "You can use the following variables:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (if applicable)
"; -$lng['serversettings']['default_vhostconf']['description'] = 'The content of this field will be included into this ip/port vHost container directly. ' . $lng['admin']['specialsettings_replacements'] . ' Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!'; -$lng['serversettings']['apache_globaldiropt']['title'] = 'Directory options for customer-prefix'; -$lng['serversettings']['apache_globaldiropt']['description'] = 'The content of this field will be included into the 05_froxlor_dirfix_nofcgid.conf apache config. If empty, the default value is used:

apache >=2.4
Require all granted
AllowOverride All

apache <=2.2
Order allow,deny
allow from all'; -$lng['serversettings']['default_vhostconf_domain']['description'] = 'The content of this field will be included into the domain vHost container directly. ' . $lng['admin']['specialsettings_replacements'] . ' Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!'; -$lng['error']['invalidip'] = 'Invalid IP address: %s'; -$lng['serversettings']['decimal_places'] = 'Number of decimal places in traffic/webspace output'; - -// ADDED IN 1.2.19-svn8 - -$lng['admin']['dkimsettings'] = 'DomainKey settings'; -$lng['dkim']['dkim_prefix']['title'] = 'Prefix'; -$lng['dkim']['dkim_prefix']['description'] = 'Please specify the path to the DKIM RSA-files as well as to the configuration files for the Milter-plugin'; -$lng['dkim']['dkim_domains']['title'] = 'Domains filename'; -$lng['dkim']['dkim_domains']['description'] = 'Filename of the DKIM Domains parameter specified in the dkim-milter configuration'; -$lng['dkim']['dkim_dkimkeys']['title'] = 'KeyList filename'; -$lng['dkim']['dkim_dkimkeys']['description'] = 'Filename of the DKIM KeyList parameter specified in the dkim-milter configuration'; -$lng['dkim']['dkimrestart_command']['title'] = 'Milter restart command'; -$lng['dkim']['dkimrestart_command']['description'] = 'Please specify the restart command for the DKIM milter service'; -$lng['dkim']['privkeysuffix']['title'] = 'Private keys suffix'; -$lng['dkim']['privkeysuffix']['description'] = 'You can specify an (optional) filename extension/suffix for the generate dkim private keys. Some services like dkim-filter requires this to be empty'; - -// ADDED IN 1.2.19-svn9 - -$lng['admin']['caneditphpsettings'] = 'Can change php-related domain settings?'; - -// ADDED IN 1.2.19-svn12 - -$lng['admin']['allips'] = 'All IP\'s'; -$lng['panel']['nosslipsavailable'] = 'There are currently no ssl ip/port combinations for this server'; -$lng['dkim']['use_dkim']['title'] = 'Activate DKIM support?'; -$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?
Note: DKIM is only supported using dkim-filter, not opendkim (yet)'; -$lng['error']['invalidmysqlhost'] = 'Invalid MySQL host address: %s'; -$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'You cannot enable Webalizer and AWstats at the same time, please chose one of them'; -$lng['serversettings']['webalizer_enabled'] = 'Enable webalizer statistics'; -$lng['serversettings']['awstats_enabled'] = 'Enable AWstats statistics'; -$lng['admin']['awstatssettings'] = 'AWstats settings'; - -// ADDED IN 1.2.19-svn16 - -$lng['admin']['domain_dns_settings'] = 'Domain dns settings'; -$lng['dns']['destinationip'] = 'Domain IP(s)'; -$lng['dns']['standardip'] = 'Server standard IP'; -$lng['dns']['a_record'] = 'A-Record (IPv6 optional)'; -$lng['dns']['cname_record'] = 'CNAME-Record'; -$lng['dns']['mxrecords'] = 'Define MX records'; -$lng['dns']['standardmx'] = 'Server standard MX record'; -$lng['dns']['mxconfig'] = 'Custom MX records'; -$lng['dns']['priority10'] = 'Priority 10'; -$lng['dns']['priority20'] = 'Priority 20'; -$lng['dns']['txtrecords'] = 'Define TXT records'; -$lng['dns']['txtexample'] = 'Example (SPF-entry):
v=spf1 ip4:xxx.xxx.xx.0/23 -all'; -$lng['serversettings']['selfdns']['title'] = 'Customer domain dns settings'; -$lng['serversettings']['selfdnscustomer']['title'] = 'Allow customers to edit domain dns settings'; -$lng['admin']['activated'] = 'Activated'; -$lng['admin']['statisticsettings'] = 'Statistic settings'; -$lng['admin']['or'] = 'or'; - -// ADDED IN 1.2.19-svn17 - -$lng['serversettings']['unix_names']['title'] = 'Use UNIX compatible usernames'; -$lng['serversettings']['unix_names']['description'] = 'Allows you to use - and _ in usernames if No'; -$lng['error']['cannotwritetologfile'] = 'Cannot open logfile %s for writing'; -$lng['admin']['sysload'] = 'System load'; -$lng['admin']['noloadavailable'] = 'not available'; -$lng['admin']['nouptimeavailable'] = 'not available'; -$lng['panel']['backtooverview'] = 'Back to overview'; -$lng['admin']['nosubject'] = '(No Subject)'; -$lng['admin']['configfiles']['statistics'] = 'Statistics'; -$lng['login']['forgotpwd'] = 'Forgot your password?'; -$lng['login']['presend'] = 'Reset password'; -$lng['login']['email'] = 'E-mail address'; -$lng['login']['remind'] = 'Reset my password'; -$lng['login']['usernotfound'] = 'User not found!'; -$lng['mails']['password_reset']['subject'] = 'Password reset'; -$lng['mails']['password_reset']['mailbody'] = 'Hello {SALUTATION},\n\nhere is your link for setting a new password. This link is valid for the next 24 hours.\n\n{LINK}\n\nThank you,\nyour administrator'; -$lng['pwdreminder']['success'] = 'Password reset successfully requested. Please follow the instructions in the email you received.'; - -// ADDED IN 1.2.19-svn18 - -$lng['serversettings']['allow_password_reset']['title'] = 'Allow password reset by customers'; -$lng['pwdreminder']['notallowed'] = 'Password reset is disabled'; - -// ADDED IN 1.2.19-svn21 - -$lng['customer']['title'] = 'Title'; -$lng['customer']['country'] = 'Country'; -$lng['panel']['dateformat'] = 'YYYY-MM-DD'; -$lng['panel']['dateformat_function'] = 'Y-m-d'; - -// Y = Year, m = Month, d = Day - -$lng['panel']['timeformat_function'] = 'H:i:s'; - -// H = Hour, i = Minute, s = Second - -$lng['panel']['default'] = 'Default'; -$lng['panel']['never'] = 'Never'; -$lng['panel']['active'] = 'Active'; -$lng['panel']['please_choose'] = 'Please choose'; -$lng['panel']['allow_modifications'] = 'Allow modifications'; -$lng['domains']['add_date'] = 'Added to Froxlor'; -$lng['domains']['registration_date'] = 'Added to registry'; -$lng['domains']['topleveldomain'] = 'Top-Level-Domain'; - -// ADDED IN 1.2.19-svn22 - -$lng['serversettings']['allow_password_reset']['description'] = 'Customers can reset their password and an activation link will be sent to their e-mail address'; -$lng['serversettings']['allow_password_reset_admin']['title'] = 'Allow password reset by admins'; -$lng['serversettings']['allow_password_reset_admin']['description'] = 'Admins/reseller can reset their password and an activation link will be sent to their e-mail address'; - -// ADDED IN 1.2.19-svn25 - -$lng['emails']['quota'] = 'Quota'; -$lng['emails']['noquota'] = 'No quota'; -$lng['emails']['updatequota'] = 'Update Quota'; -$lng['serversettings']['mail_quota']['title'] = 'Mailbox-quota'; -$lng['serversettings']['mail_quota']['description'] = 'The default quota for a new created mailboxes (MegaByte).'; -$lng['serversettings']['mail_quota_enabled']['title'] = 'Use mailbox-quota for customers'; -$lng['serversettings']['mail_quota_enabled']['description'] = 'Activate to use quotas on mailboxes. Default is No since this requires a special setup.'; -$lng['serversettings']['mail_quota_enabled']['removelink'] = 'Click here to wipe all quotas for mail accounts.'; -$lng['serversettings']['mail_quota_enabled']['enforcelink'] = 'Click here to enforce default quota to all User mail accounts.'; -$lng['question']['admin_quotas_reallywipe'] = 'Do you really want to wipe all quotas on table mail_users? This cannot be reverted!'; -$lng['question']['admin_quotas_reallyenforce'] = 'Do you really want to enforce the default quota to all Users? This cannot be reverted!'; -$lng['error']['vmailquotawrong'] = 'The quotasize must be positive number.'; -$lng['customer']['email_quota'] = 'E-mail quota'; -$lng['customer']['email_imap'] = 'E-mail IMAP'; -$lng['customer']['email_pop3'] = 'E-mail POP3'; -$lng['customer']['mail_quota'] = 'Mailquota'; -$lng['panel']['megabyte'] = 'MegaByte'; -$lng['panel']['not_supported'] = 'Not supported in: '; -$lng['emails']['quota_edit'] = 'Change E-Mail Quota'; -$lng['error']['allocatetoomuchquota'] = 'You tried to allocate %s MB Quota, but you do not have enough left.'; - -$lng['error']['missingfields'] = 'Not all required fields were filled out.'; -$lng['error']['accountnotexisting'] = 'The given email account doesn\'t exist.'; -$lng['admin']['security_settings'] = 'Security Options'; -$lng['admin']['know_what_youre_doing'] = 'Change only, if you know what you\'re doing!'; -$lng['admin']['show_version_login']['title'] = 'Show Froxlor version on login'; -$lng['admin']['show_version_login']['description'] = 'Show the Froxlor version in the footer on the login page'; -$lng['admin']['show_version_footer']['title'] = 'Show Froxlor version in footer'; -$lng['admin']['show_version_footer']['description'] = 'Show the Froxlor version in the footer on the rest of the pages'; -$lng['admin']['froxlor_graphic']['title'] = 'Header graphic for Froxlor'; -$lng['admin']['froxlor_graphic']['description'] = 'What graphic should be shown in the header'; - -// improved froxlor - -$lng['menue']['phpsettings']['maintitle'] = 'PHP Configurations'; -$lng['admin']['phpsettings']['title'] = 'PHP Configuration'; -$lng['admin']['phpsettings']['description'] = 'Short description'; -$lng['admin']['phpsettings']['actions'] = 'Actions'; -$lng['admin']['phpsettings']['activedomains'] = 'In use for domain(s)'; -$lng['admin']['phpsettings']['notused'] = 'Configuration not in use'; -$lng['admin']['misc'] = 'Miscellaneous'; -$lng['admin']['phpsettings']['editsettings'] = 'Change PHP settings'; -$lng['admin']['phpsettings']['addsettings'] = 'Create new PHP settings'; -$lng['admin']['phpsettings']['viewsettings'] = 'View PHP settings'; -$lng['admin']['phpsettings']['phpinisettings'] = 'php.ini settings'; -$lng['error']['nopermissionsorinvalidid'] = 'You don\'t have enough permissions to change these settings or an invalid id was given.'; -$lng['panel']['view'] = 'view'; -$lng['question']['phpsetting_reallydelete'] = 'Do you really want to delete these settings? All domains which use these settings currently will be changed to the default config.'; -$lng['question']['fpmsetting_reallydelete'] = 'Do you really want to delete these php-fpm settings? All php configurations which use these settings currently will be changed to the default config.'; -$lng['admin']['phpsettings']['addnew'] = 'Create new PHP configuration'; -$lng['admin']['fpmsettings']['addnew'] = 'Create new PHP version'; -$lng['error']['phpsettingidwrong'] = 'A PHP Configuration with this id doesn\'t exist'; -$lng['error']['descriptioninvalid'] = 'The description is too short, too long or contains illegal characters.'; -$lng['error']['info'] = 'Info'; -$lng['admin']['phpconfig']['template_replace_vars'] = 'Variables that will be replaced in the configs'; -$lng['admin']['phpconfig']['pear_dir'] = 'Will be replaced with the global setting for the pear directory.'; -$lng['admin']['phpconfig']['open_basedir_c'] = 'Will insert a ; (semicolon) to comment-out/disable open_basedir when set'; -$lng['admin']['phpconfig']['open_basedir'] = 'Will be replaced with the open_basedir setting of the domain.'; -$lng['admin']['phpconfig']['tmp_dir'] = 'Will be replaced with the temporary directory of the domain.'; -$lng['admin']['phpconfig']['open_basedir_global'] = 'Will be replaced with the global value of the path which will be attached to the open_basedir (see webserver settings).'; -$lng['admin']['phpconfig']['customer_email'] = 'Will be replaced with the e-mail address of the customer who owns this domain.'; -$lng['admin']['phpconfig']['admin_email'] = 'Will be replaced with e-mail address of the admin who owns this domain.'; -$lng['admin']['phpconfig']['domain'] = 'Will be replaced with the domain.'; -$lng['admin']['phpconfig']['customer'] = 'Will be replaced with the loginname of the customer who owns this domain.'; -$lng['admin']['phpconfig']['admin'] = 'Will be replaced with the loginname of the admin who owns this domain.'; -$lng['admin']['phpconfig']['docroot'] = 'Will be replaced with the domain\'s document-root.'; -$lng['admin']['phpconfig']['homedir'] = 'Will be replaced with the customer\'s home-directory.'; -$lng['login']['backtologin'] = 'Back to login'; -$lng['serversettings']['mod_fcgid']['starter']['title'] = 'Processes per domain'; -$lng['serversettings']['mod_fcgid']['starter']['description'] = 'How many processes should be started/allowed per domain? The value 0 is recommended cause PHP will then manage the amount of processes itself very efficiently.'; -$lng['serversettings']['mod_fcgid']['wrapper']['title'] = 'Wrapper in Vhosts'; -$lng['serversettings']['mod_fcgid']['wrapper']['description'] = 'How should the wrapper be included in the Vhosts'; -$lng['serversettings']['mod_fcgid']['tmpdir']['description'] = 'Where should the temp directories be stored'; -$lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Global PEAR directories'; -$lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Which global PEAR directories should be replaced in every php.ini config? Different directories must be separated by a colon.'; - -// improved Froxlor 2 - -$lng['admin']['templates']['index_html'] = 'index file for newly created customer directories'; -$lng['admin']['templates']['SERVERNAME'] = 'Replaced with the servername.'; -$lng['admin']['templates']['CUSTOMER'] = 'Replaced with the loginname of the customer.'; -$lng['admin']['templates']['ADMIN'] = 'Replaced with the loginname of the admin.'; -$lng['admin']['templates']['CUSTOMER_EMAIL'] = 'Replaced with the e-mail address of the customer.'; -$lng['admin']['templates']['ADMIN_EMAIL'] = 'Replaced with the e-mail address of the admin.'; -$lng['admin']['templates']['filetemplates'] = 'File templates'; -$lng['admin']['templates']['filecontent'] = 'File content'; -$lng['error']['filecontentnotset'] = 'The file cannot be empty!'; -$lng['serversettings']['index_file_extension']['description'] = 'Which file extension should be used for the index file in newly created customer directories? This file extension will be used, if you or one of your admins has created its own index file template.'; -$lng['serversettings']['index_file_extension']['title'] = 'File extension for index file in newly created customer directories'; -$lng['error']['index_file_extension'] = 'The file extension for the index file must be between 1 and 6 characters long. The extension can only contain characters like a-z, A-Z and 0-9'; -$lng['admin']['expert_settings'] = 'Expert settings!'; -$lng['admin']['mod_fcgid_starter']['title'] = 'PHP Processes for this domain (empty for default value)'; - -$lng['error']['customerdoesntexist'] = 'The customer you have chosen doesn\'t exist.'; -$lng['error']['admindoesntexist'] = 'The admin you have chosen doesn\'t exist.'; - -// ADDED IN 1.2.19-svn37 - -$lng['serversettings']['session_allow_multiple_login']['title'] = 'Allow multiple login'; -$lng['serversettings']['session_allow_multiple_login']['description'] = 'If activated a user could login multiple times.'; -$lng['serversettings']['panel_allow_domain_change_admin']['title'] = 'Allow moving domains between admins'; -$lng['serversettings']['panel_allow_domain_change_admin']['description'] = 'If activated you can change the admin of a domain at domainsettings.
Attention: If a customer isn\'t assigned to the same admin as the domain, the admin can see every other domain of that customer!'; -$lng['serversettings']['panel_allow_domain_change_customer']['title'] = 'Allow moving domains between customers'; -$lng['serversettings']['panel_allow_domain_change_customer']['description'] = 'If activated you can change the customer of a domain at domainsettings.
Attention: Froxlor changes the documentroot to the new customer\'s default homedir (+ domain-folder if activated)'; -$lng['domains']['associated_with_domain'] = 'Associated'; -$lng['domains']['aliasdomains'] = 'Alias domains'; -$lng['error']['ipportdoesntexist'] = 'The ip/port combination you have chosen doesn\'t exist.'; - -// ADDED IN 1.2.19-svn38 - -$lng['admin']['phpserversettings'] = 'PHP Settings'; -$lng['admin']['phpsettings']['binary'] = 'PHP Binary'; -$lng['admin']['phpsettings']['fpmdesc'] = 'PHP-FPM config'; -$lng['admin']['phpsettings']['file_extensions'] = 'File extensions'; -$lng['admin']['phpsettings']['file_extensions_note'] = '(without dot, separated by spaces)'; -$lng['admin']['mod_fcgid_maxrequests']['title'] = 'Maximum php requests for this domain (empty for default value)'; -$lng['serversettings']['mod_fcgid']['maxrequests']['title'] = 'Maximum Requests per domain'; -$lng['serversettings']['mod_fcgid']['maxrequests']['description'] = 'How many requests should be allowed per domain?'; - -// ADDED IN 1.4.2.1-1 - -$lng['mysql']['mysql_server'] = 'MySQL-Server'; - -// ADDED IN 1.4.2.1-2 - -$lng['admin']['ipsandports']['webserverdefaultconfig'] = 'Webserver default config'; -$lng['admin']['ipsandports']['webserverdomainconfig'] = 'Webserver domain config'; -$lng['admin']['ipsandports']['webserverssldomainconfig'] = 'Webserver SSL config'; -$lng['admin']['ipsandports']['ssl_key_file'] = 'Path to the SSL Keyfile'; -$lng['admin']['ipsandports']['ssl_ca_file'] = 'Path to the SSL CA certificate'; -$lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Default vHost-settings for every domain container'; -$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile'; -$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)'; -$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)'; -$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentication, set this only if you know what it is.'; - -$lng['error']['usernamealreadyexists'] = 'The username %s already exists.'; - -$lng['error']['plausibilitychecknotunderstood'] = 'Answer of plausibility check not understood.'; -$lng['error']['errorwhensaving'] = 'An error occurred when saving the field %s'; - -$lng['success']['success'] = 'Information'; -$lng['success']['clickheretocontinue'] = 'Click here to continue'; -$lng['success']['settingssaved'] = 'The settings have been successfully saved.'; - -// ADDED IN FROXLOR 0.9 - -$lng['admin']['spfsettings'] = 'Domain SPF settings'; -$lng['spf']['use_spf'] = 'Activate SPF for domains?'; -$lng['spf']['spf_entry'] = 'SPF entry for all domains'; -$lng['panel']['toomanydirs'] = 'Too many subdirectories. Falling back to manual path-select.'; -$lng['panel']['abort'] = 'Abort'; -$lng['serversettings']['cron']['debug']['title'] = 'Cronscript debugging'; -$lng['serversettings']['cron']['debug']['description'] = 'Activate to keep the lockfile after a cron-run for debugging.
Attention:Keeping the lockfile can cause the next scheduled cron not to run properly.'; -$lng['panel']['not_activated'] = 'not activated'; -$lng['panel']['off'] = 'off'; -$lng['update']['updateinprogress_onlyadmincanlogin'] = 'A newer version of Froxlor has been installed but not yet set up.
Only the administrator can log in and finish the update.'; -$lng['update']['update'] = 'Froxlor update'; -$lng['update']['proceed'] = 'Proceed'; -$lng['update']['update_information']['part_a'] = 'The Froxlor files have been updated to version %newversion. The installed version is %curversion.'; -$lng['update']['update_information']['part_b'] = '

Customers will not be able to log in until the update has been finished.
Proceed?'; -$lng['update']['noupdatesavail'] = 'You already have the latest Froxlor version.'; -$lng['admin']['specialsettingsforsubdomains'] = 'Apply specialsettings to all subdomains (*.example.com)'; -$lng['serversettings']['specialsettingsforsubdomains']['description'] = 'If yes these custom vHost-settings will be added to all subdomains; if no subdomain-specialsettings are being removed.'; -$lng['tasks']['outstanding_tasks'] = 'Outstanding cron-tasks'; -$lng['tasks']['REBUILD_VHOST'] = 'Rebuilding webserver-configuration'; -$lng['tasks']['CREATE_HOME'] = 'Adding new customer %loginname%'; -$lng['tasks']['REBUILD_DNS'] = 'Rebuilding bind-configuration'; -$lng['tasks']['CREATE_FTP'] = 'Creating directory for new ftp-user'; -$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Deleting customer-files %loginname%'; -$lng['tasks']['noneoutstanding'] = 'There are currently no outstanding tasks for Froxlor'; - -// ADDED IN FROXLOR 0.9.1 - -$lng['admin']['accountdata'] = 'Account Data'; -$lng['admin']['contactdata'] = 'Contact Data'; -$lng['admin']['servicedata'] = 'Service Data'; - -// ADDED IN FROXLOR 0.9.2 - -$lng['admin']['newerversionavailable'] = 'There is a newer version of Froxlor available'; - -// ADDED IN FROXLOR 0.9.3 - -$lng['emails']['noemaildomainaddedyet'] = 'You do not have a (email-)domain in your account yet.'; -$lng['error']['hiddenfieldvaluechanged'] = 'The value for the hidden field "%s" changed while editing the settings.

This is usually not a big problem but the settings could not be saved because of this.'; - -// ADDED IN FROXLOR 0.9.3-svn1 - -$lng['serversettings']['panel_password_min_length']['title'] = 'Minimum password length'; -$lng['serversettings']['panel_password_min_length']['description'] = 'Here you can set a minimum length for passwords. \'0\' means: no minimum length required.'; -$lng['error']['notrequiredpasswordlength'] = 'The given password is too short. Please enter at least %s characters.'; -$lng['serversettings']['system_store_index_file_subs']['title'] = 'Store default index file also to new subfolders'; -$lng['serversettings']['system_store_index_file_subs']['description'] = 'If enabled, the default index-file is being stored to every subdomain-path newly created (not if the folder already exists!)'; - -// ADDED IN FROXLOR 0.9.3-svn2 - -$lng['serversettings']['adminmail_return']['title'] = 'Reply-To address'; -$lng['serversettings']['adminmail_return']['description'] = 'Define an e-mail address as reply-to-address for mails sent by the panel.'; -$lng['serversettings']['adminmail_defname'] = 'Panel e-mail sender name'; - -// ADDED IN FROXLOR 0.9.3-svn3 -$lng['dkim']['dkim_algorithm']['title'] = 'Allowed Hash Algorithms'; -$lng['dkim']['dkim_algorithm']['description'] = 'Define allowed hash algorithms, chose "All" for all algorithms or one or more from the other available algorithms'; -$lng['dkim']['dkim_servicetype'] = 'Service Types'; -$lng['dkim']['dkim_keylength']['title'] = 'Key-length'; -$lng['dkim']['dkim_keylength']['description'] = 'Attention: If you change this values, you need to delete all the private/public keys in "%s"'; -$lng['dkim']['dkim_notes']['title'] = 'DKIM Notes'; -$lng['dkim']['dkim_notes']['description'] = 'Notes that might be of interest to a human, e.g. a URL like http://www.dnswatch.info. No interpretation is made by any program. This tag should be used sparingly due to space limitations in DNS. This is intended for use by administrators, not end users.'; - -$lng['admin']['cron']['cronsettings'] = 'Cronjob settings'; -$lng['cron']['cronname'] = 'cronjob-name'; -$lng['cron']['lastrun'] = 'last run'; -$lng['cron']['interval'] = 'interval'; -$lng['cron']['isactive'] = 'enabled'; -$lng['cron']['description'] = 'description'; -$lng['crondesc']['cron_unknown_desc'] = 'no description given'; -$lng['admin']['cron']['add'] = 'Add cronjob'; -$lng['crondesc']['cron_tasks'] = 'generating of configfiles'; -$lng['crondesc']['cron_legacy'] = 'legacy (old) cronjob'; -$lng['crondesc']['cron_traffic'] = 'traffic calculation'; -$lng['cronmgmt']['minutes'] = 'minutes'; -$lng['cronmgmt']['hours'] = 'hours'; -$lng['cronmgmt']['days'] = 'days'; -$lng['cronmgmt']['weeks'] = 'weeks'; -$lng['cronmgmt']['months'] = 'months'; -$lng['admin']['cronjob_edit'] = 'Edit cronjob'; -$lng['cronjob']['cronjobsettings'] = 'Cronjob settings'; -$lng['cronjob']['cronjobintervalv'] = 'Runtime interval value'; -$lng['cronjob']['cronjobinterval'] = 'Runtime interval'; -$lng['panel']['options'] = 'Options'; -$lng['admin']['warning'] = 'WARNING - Please note!'; -$lng['cron']['changewarning'] = 'Changing these values can have a negative cause to the behavior of Froxlor and its automated tasks.
Please only change values here, if you are sure you know what you are doing.'; - -$lng['serversettings']['stdsubdomainhost']['title'] = 'Customer standard subdomain'; -$lng['serversettings']['stdsubdomainhost']['description'] = 'What hostname should be used to create standard subdomains for customer. If empty, the system-hostname is used.'; - -// ADDED IN FROXLOR 0.9.4-svn1 -$lng['ftp']['account_edit'] = 'Edit ftp account'; -$lng['ftp']['editpassdescription'] = 'Set new password or leave blank for no change.'; -$lng['customer']['sendinfomail'] = 'Send data via email to me'; -$lng['mails']['new_database_by_customer']['subject'] = '[Froxlor] New database created'; -$lng['mails']['new_database_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nyou have just added a new database. Here is the entered information:\n\nDatabasename: {DB_NAME}\nPassword: {DB_PASS}\nDescription: {DB_DESC}\nDB-Hostname: {DB_SRV}\nphpMyAdmin: {PMA_URI}\nYours sincerely, your administrator"; -$lng['serversettings']['awstats_path'] = 'Path to AWStats \'awstats_buildstaticpages.pl\''; -$lng['serversettings']['awstats_conf'] = 'AWStats configuration path'; -$lng['error']['overviewsettingoptionisnotavalidfield'] = 'Whoops, a field that should be displayed as an option in the settings-overview is not an excepted type. You can blame the developers for this. This should not happen!'; -$lng['admin']['configfiles']['compactoverview'] = 'Compact-overview'; -$lng['admin']['lastlogin_succ'] = 'Last login'; -$lng['panel']['neverloggedin'] = 'No login yet'; - -// ADDED IN FROXLOR 0.9.6-svn1 -$lng['serversettings']['defaultttl'] = 'Domain TTL for bind in seconds (default \'604800\' = 1 week)'; - -// ADDED IN FROXLOR 0.9.6-svn3 -$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Enable default errordocuments for all customers'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL for error 401'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '
Not supported in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL for error 403'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '
Not supported in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL for error 404'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL for error 500'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '
Not supported in: lighttpd
'; - -// ADDED IN FROXLOR 0.9.6-svn5 -$lng['serversettings']['mod_fcgid']['defaultini'] = 'Default PHP configuration for new domains'; - -// ADDED IN FROXLOR 0.9.6-svn6 -$lng['admin']['ftpserver'] = 'FTP Server'; -$lng['admin']['ftpserversettings'] = 'FTP Server settings'; -$lng['serversettings']['ftpserver']['desc'] = 'If pureftpd is selected the .ftpquota files for user quotas are created and updated daily'; - -// ADDED IN FROXLOR 0.9.7-svn1 -$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'New ftp-user created'; -$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nyou have just added a new ftp-user. Here is the entered information:\n\nUsername: {USR_NAME}\nPassword: {USR_PASS}\nPath: {USR_PATH}\n\nYours sincerely, your administrator"; -$lng['domains']['redirectifpathisurl'] = 'Redirect code (default: empty)'; -$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path
NOTE:Changes are only applied if the given path is an URL.'; -$lng['serversettings']['customredirect_enabled']['title'] = 'Allow customer redirects'; -$lng['serversettings']['customredirect_enabled']['description'] = 'Allow customers to choose the http-status code for redirects which will be used'; -$lng['serversettings']['customredirect_default']['title'] = 'Default redirect'; -$lng['serversettings']['customredirect_default']['description'] = 'Set the default redirect-code which should be used if the customer does not set it himself'; - -// ADDED IN FROXLOR 0.9.7-svn2 -$lng['error']['pathmaynotcontaincolon'] = 'The path you have entered should not contain a colon (":"). Please enter a correct path value.'; - -// ADDED IN FROXLOR 0.9.7-svn3 - -// these stay only in english.lng.php - they are the same -// for all other languages and are used if not found there -$lng['redirect_desc']['rc_default'] = 'default'; -$lng['redirect_desc']['rc_movedperm'] = 'moved permanently'; -$lng['redirect_desc']['rc_found'] = 'found'; -$lng['redirect_desc']['rc_seeother'] = 'see other'; -$lng['redirect_desc']['rc_tempred'] = 'temporary redirect'; - -// ADDED IN FROXLOR 0.9.8 -$lng['error']['exception'] = '%s'; - -// ADDED IN FROXLOR 0.9.9-svn1 -$lng['serversettings']['mail_also_with_mxservers'] = 'Create mail-, imap-, pop3- and smtp-"A record" also with MX-Servers set'; - -// ADDED IN FROXLOR 0.9.10-svn1 -$lng['admin']['webserver_user'] = 'Webserver user-name'; -$lng['admin']['webserver_group'] = 'Webserver group-name'; - -// ADDED IN FROXLOR 0.9.10 -$lng['serversettings']['froxlordirectlyviahostname'] = 'Access Froxlor directly via the hostname'; - -// ADDED IN FROXLOR 0.9.11-svn1 -$lng['serversettings']['panel_password_regex']['title'] = 'Regular expression for passwords'; -$lng['serversettings']['panel_password_regex']['description'] = 'Here you can set a regular expression for passwords-complexity.
Empty = no specific requirement'; -$lng['error']['notrequiredpasswordcomplexity'] = 'The specified password-complexity was not satisfied.
Please contact your administrator if you have any questions about the complexity-specification'; - -// ADDED IN FROXLOR 0.9.11-svn2 -$lng['extras']['execute_perl'] = 'Execute perl/CGI'; -$lng['admin']['perlenabled'] = 'Perl enabled'; - -// ADDED IN FROXLOR 0.9.11-svn3 -$lng['serversettings']['perl_path']['title'] = 'Path to perl'; -$lng['serversettings']['perl_path']['description'] = 'Default is /usr/bin/perl'; - -// ADDED IN FROXLOR 0.9.12-svn1 -$lng['admin']['fcgid_settings'] = 'FCGID'; -$lng['serversettings']['mod_fcgid_ownvhost']['title'] = 'Enable FCGID for the Froxlor vHost'; -$lng['serversettings']['mod_fcgid_ownvhost']['description'] = 'If enabled, Froxlor will also be running under a local user'; -$lng['admin']['mod_fcgid_user'] = 'Local user to use for FCGID (Froxlor vHost)'; -$lng['admin']['mod_fcgid_group'] = 'Local group to use for FCGID (Froxlor vHost)'; - -// ADDED IN FROXLOR 0.9.12-svn2 -$lng['admin']['perl_settings'] = 'Perl/CGI'; -$lng['serversettings']['perl']['suexecworkaround']['title'] = 'Enable SuExec workaround'; -$lng['serversettings']['perl']['suexecworkaround']['description'] = 'Enable only if customer docroots are not within the apache suexec path.
If enabled, Froxlor will generate a symlink from the customers perl-enabled directory + /cgi-bin/ to the given path.
Note that perl will then only work in the folders subdirectory /cgi-bin/ and not in the folder itself (as it does without this fix!)'; -$lng['serversettings']['perl']['suexeccgipath']['title'] = 'Path for customer perl-enabled directory symlinks'; -$lng['serversettings']['perl']['suexeccgipath']['description'] = 'You only need to set this if the SuExec-workaround is enabled.
ATTENTION: Be sure this path is within the suexec path or else this workaround is useless'; -$lng['panel']['descriptionerrordocument'] = 'Can be an URL, path to a file or just a string wrapped around " "
Leave empty to use server default value.'; -$lng['error']['stringerrordocumentnotvalidforlighty'] = 'A string as ErrorDocument does not work in lighttpd, please specify a path to a file'; -$lng['error']['urlerrordocumentnotvalidforlighty'] = 'An URL as ErrorDocument does not work in lighttpd, please specify a path to a file'; - -// ADDED IN FROXLOR 0.9.12-svn3 -$lng['question']['remove_subbutmain_domains'] = 'Also remove domains which are added as full domains but which are subdomains of this domain?'; -$lng['domains']['issubof'] = 'This domain is a subdomain of another domain'; -$lng['domains']['issubofinfo'] = 'You have to set this to the correct domain if you want to add a subdomain as full-domain (e.g. you want to add "www.domain.tld", you have to select "domain.tld" here)'; -$lng['domains']['nosubtomaindomain'] = 'No subdomain of a full domain'; -$lng['admin']['templates']['new_database_by_customer'] = 'Customer-notification when a database has been created'; -$lng['admin']['templates']['new_ftpaccount_by_customer'] = 'Customer-notification when a ftp-user has been created'; -$lng['admin']['templates']['newdatabase'] = 'Notification-mails for new databases'; -$lng['admin']['templates']['newftpuser'] = 'Notification-mails for new ftp-user'; -$lng['admin']['templates']['CUST_NAME'] = 'Customer name'; -$lng['admin']['templates']['DB_NAME'] = 'Database name'; -$lng['admin']['templates']['DB_PASS'] = 'Database password'; -$lng['admin']['templates']['DB_DESC'] = 'Database description'; -$lng['admin']['templates']['DB_SRV'] = 'Database server'; -$lng['admin']['templates']['PMA_URI'] = 'URL to phpMyAdmin (if given)'; -$lng['admin']['notgiven'] = '[not given]'; -$lng['admin']['templates']['USR_NAME'] = 'FTP username'; -$lng['admin']['templates']['USR_PASS'] = 'FTP password'; -$lng['admin']['templates']['USR_PATH'] = 'FTP homedir (relative to customer-docroot)'; - -// ADDED IN FROXLOR 0.9.12-svn4 -$lng['serversettings']['awstats_awstatspath'] = 'Path to AWStats \'awstats.pl\''; - -// ADDED IN FROXLOR 0.9.12-svn6 -$lng['extras']['htpasswdauthname'] = 'Authentication reason (AuthName)'; -$lng['extras']['directoryprotection_edit'] = 'edit directory protection'; -$lng['admin']['templates']['forgotpwd'] = 'Notification-mails for password-reset'; -$lng['admin']['templates']['password_reset'] = 'Customer-notification for passwort-reset'; -$lng['admin']['store_defaultindex'] = 'Store default index-file to customers docroot'; - -// ADDED IN FROXLOR 0.9.14 -$lng['serversettings']['mod_fcgid']['defaultini_ownvhost'] = 'Default PHP configuration for Froxlor-vHost'; -$lng['serversettings']['awstats_icons']['title'] = 'Path to AWstats icons folder'; -$lng['serversettings']['awstats_icons']['description'] = 'e.g. /usr/share/awstats/htdocs/icon/'; -$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Path to the SSL CertificateChainFile'; -$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.'; -$lng['admin']['ipsandports']['docroot']['title'] = 'Custom docroot (empty = point to Froxlor)'; -$lng['admin']['ipsandports']['docroot']['description'] = 'You can define a custom document-root (the destination for a request) for this ip/port combination here.
ATTENTION: Please be careful with what you enter here!'; -$lng['serversettings']['login_domain_login'] = 'Allow login with domains'; -$lng['panel']['unlock'] = 'Unlock'; -$lng['question']['customer_reallyunlock'] = 'Do you really want to unlock customer %s?'; - -// ADDED IN FROXLOR 0.9.15 -$lng['serversettings']['perl_server']['title'] = 'Perl server socket location'; -$lng['serversettings']['perl_server']['description'] = 'A simple guide can be found at: nginx.com'; -$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend'; -$lng['serversettings']['nginx_php_backend']['description'] = 'this is where the PHP process is listening for requests from nginx, can be a unix socket of ip:port combination
*NOT used with php-fpm'; -$lng['serversettings']['phpreload_command']['title'] = 'PHP reload command'; -$lng['serversettings']['phpreload_command']['description'] = 'this is used to reload the PHP backend if any is used
Default: blank
*NOT used with php-fpm'; - -// ADDED IN FROXLOR 0.9.16 -$lng['error']['intvaluetoolow'] = 'The given number is too low (field %s)'; -$lng['error']['intvaluetoohigh'] = 'The given number is too high (field %s)'; -$lng['admin']['phpfpm_settings'] = 'PHP-FPM'; -$lng['serversettings']['phpfpm']['title'] = 'Enable php-fpm'; -$lng['serversettings']['phpfpm']['description'] = 'This needs a special webserver configuration see PHP-FPM handbook'; -$lng['serversettings']['phpfpm_settings']['configdir'] = 'Configuration directory of php-fpm'; -$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configuration Alias-directory of php-fpm'; -$lng['serversettings']['phpfpm_settings']['reload'] = 'php-fpm restart command'; -$lng['serversettings']['phpfpm_settings']['pm'] = 'Process manager control (pm)'; -$lng['serversettings']['phpfpm_settings']['max_children']['title'] = 'The number of child processes'; -$lng['serversettings']['phpfpm_settings']['max_children']['description'] = 'The number of child processes to be created when pm is set to \'static\' and the maximum number of child processes to be created when pm is set to \'dynamic/ondemand\'
Equivalent to the PHP_FCGI_CHILDREN'; -$lng['serversettings']['phpfpm_settings']['start_servers']['title'] = 'The number of child processes created on startup'; -$lng['serversettings']['phpfpm_settings']['start_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\''; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['title'] = 'The desired minimum number of idle server processes'; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'
Note: Mandatory when pm is set to \'dynamic\''; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['title'] = 'The desired maximum number of idle server processes'; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'
Note: Mandatory when pm is set to \'dynamic\''; -$lng['serversettings']['phpfpm_settings']['max_requests']['title'] = 'Requests per child before respawning'; -$lng['serversettings']['phpfpm_settings']['max_requests']['description'] = 'For endless request processing specify \'0\'. Equivalent to PHP_FCGI_MAX_REQUESTS.'; -$lng['error']['phpfpmstillenabled'] = 'PHP-FPM is currently active. Please deactivate it before activating FCGID'; -$lng['error']['fcgidstillenabled'] = 'FCGID is currently active. Please deactivate it before activating PHP-FPM'; -$lng['phpfpm']['vhost_httpuser'] = 'Local user to use for PHP-FPM (Froxlor vHost)'; -$lng['phpfpm']['vhost_httpgroup'] = 'Local group to use for PHP-FPM (Froxlor vHost)'; -$lng['phpfpm']['ownvhost']['title'] = 'Enable PHP-FPM for the Froxlor vHost'; -$lng['phpfpm']['ownvhost']['description'] = 'If enabled, Froxlor will also be running under a local user'; - -// ADDED IN FROXLOR 0.9.17 -$lng['crondesc']['cron_usage_report'] = 'Web- and traffic-reports'; -$lng['serversettings']['report']['report'] = 'Enable sending of reports about web- and traffic-usage'; -$lng['serversettings']['report']['webmax']['title'] = 'Warning-level in percent for webspace'; -$lng['serversettings']['report']['webmax']['description'] = 'Valid values are 0 up to 150. Setting this value to 0 disables this report.'; -$lng['serversettings']['report']['trafficmax']['title'] = 'Warning-level in percent for traffic'; -$lng['serversettings']['report']['trafficmax']['description'] = 'Valid values are 0 up to 150. Setting this value to 0 disables this report.'; -$lng['mails']['trafficmaxpercent']['mailbody'] = 'Dear {NAME},\n\nyou used {TRAFFICUSED} MB of your available {TRAFFIC} MB of traffic.\nThis is more than {MAX_PERCENT}%.\n\nYours sincerely, your administrator'; -$lng['mails']['trafficmaxpercent']['subject'] = 'Reaching your traffic limit'; -$lng['admin']['templates']['trafficmaxpercent'] = 'Notification mail for customers when given maximum of percent of traffic is exhausted'; -$lng['admin']['templates']['MAX_PERCENT'] = 'Replaced with the diskusage/traffic limit for sending reports in percent.'; -$lng['admin']['templates']['USAGE_PERCENT'] = 'Replaced with the diskusage/traffic, which was exhausted by the customer in percent.'; -$lng['admin']['templates']['diskmaxpercent'] = 'Notification mail for customers when given maximum of percent of diskspace is exhausted'; -$lng['admin']['templates']['DISKAVAILABLE'] = 'Replaced with the diskusage in MB, which was assigned to the customer.'; -$lng['admin']['templates']['DISKUSED'] = 'Replaced with the diskusage in MB, which was exhausted by the customer.'; -$lng['serversettings']['dropdown'] = 'Dropdown'; -$lng['serversettings']['manual'] = 'Manual'; -$lng['mails']['diskmaxpercent']['mailbody'] = 'Dear {NAME},\n\nyou used {DISKUSED} MB of your available {DISKAVAILABLE} MB of diskspace.\nThis is more than {MAX_PERCENT}%.\n\nYours sincerely, your administrator'; -$lng['mails']['diskmaxpercent']['subject'] = 'Reaching your diskspace limit'; -$lng['mysql']['database_edit'] = 'Edit database'; - -// ADDED IN FROXLOR 0.9.18 -$lng['error']['domains_cantdeletedomainwithaliases'] = 'You cannot delete a domain which is used for alias-domains. You have to delete the aliases first.'; -$lng['serversettings']['default_theme'] = 'Default theme'; -$lng['menue']['main']['changetheme'] = 'Change theme'; -$lng['panel']['theme'] = 'Theme'; -$lng['success']['rebuildingconfigs'] = 'Successfully inserted tasks for rebuild configfiles'; -$lng['panel']['variable'] = 'Variable'; -$lng['panel']['description'] = 'Description'; -$lng['emails']['back_to_overview'] = 'Back to overview'; - -// ADDED IN FROXLOR 0.9.20 -$lng['error']['user_banned'] = 'Your account has been locked. Please contact your administrator for further information.'; -$lng['serversettings']['validate_domain'] = 'Validate domain names'; -$lng['login']['combination_not_found'] = 'Combination of user and email address not found.'; -$lng['customer']['generated_pwd'] = 'Password suggestion'; -$lng['customer']['usedmax'] = 'Used / Max'; -$lng['admin']['traffic'] = 'Traffic'; -$lng['admin']['domaintraffic'] = 'Domains'; -$lng['admin']['customertraffic'] = 'Customers'; -$lng['traffic']['customer'] = 'Customer'; -$lng['traffic']['domain'] = 'Domain'; -$lng['traffic']['trafficoverview'] = 'Traffic summary by'; -$lng['traffic']['months']['jan'] = 'Jan'; -$lng['traffic']['months']['feb'] = 'Feb'; -$lng['traffic']['months']['mar'] = 'Mar'; -$lng['traffic']['months']['apr'] = 'Apr'; -$lng['traffic']['months']['may'] = 'May'; -$lng['traffic']['months']['jun'] = 'Jun'; -$lng['traffic']['months']['jul'] = 'Jul'; -$lng['traffic']['months']['aug'] = 'Aug'; -$lng['traffic']['months']['sep'] = 'Sep'; -$lng['traffic']['months']['oct'] = 'Oct'; -$lng['traffic']['months']['nov'] = 'Nov'; -$lng['traffic']['months']['dec'] = 'Dec'; -$lng['traffic']['months']['total'] = 'Total'; -$lng['traffic']['details'] = 'Details'; -$lng['menue']['traffic']['table'] = 'Traffic'; - -// ADDED IN FROXLOR 0.9.21 -$lng['gender']['title'] = 'Title'; -$lng['gender']['male'] = 'Mr.'; -$lng['gender']['female'] = 'Mrs.'; -$lng['gender']['undef'] = ''; - -// Country code (ISO-3166-2) -$lng['country']['AF'] = "Afghanistan"; -$lng['country']['AX'] = "Aland Islands"; -$lng['country']['AL'] = "Albania"; -$lng['country']['DZ'] = "Algeria"; -$lng['country']['AS'] = "American Samoa"; -$lng['country']['AD'] = "Andorra"; -$lng['country']['AO'] = "Angola"; -$lng['country']['AI'] = "Anguilla"; -$lng['country']['AQ'] = "Antarctica"; -$lng['country']['AG'] = "Antigua and Barbuda"; -$lng['country']['AR'] = "Argentina"; -$lng['country']['AM'] = "Armenia"; -$lng['country']['AW'] = "Aruba"; -$lng['country']['AU'] = "Australia"; -$lng['country']['AT'] = "Austria"; -$lng['country']['AZ'] = "Azerbaijan"; -$lng['country']['BS'] = "Bahamas"; -$lng['country']['BH'] = "Bahrain"; -$lng['country']['BD'] = "Bangladesh"; -$lng['country']['BB'] = "Barbados"; -$lng['country']['BY'] = "Belarus"; -$lng['country']['BE'] = "Belgium"; -$lng['country']['BZ'] = "Belize"; -$lng['country']['BJ'] = "Benin"; -$lng['country']['BM'] = "Bermuda"; -$lng['country']['BT'] = "Bhutan"; -$lng['country']['BO'] = "Bolivia, Plurinational State of"; -$lng['country']['BQ'] = "Bonaire, Saint Eustatius and Saba"; -$lng['country']['BA'] = "Bosnia and Herzegovina"; -$lng['country']['BW'] = "Botswana"; -$lng['country']['BV'] = "Bouvet Island"; -$lng['country']['BR'] = "Brazil"; -$lng['country']['IO'] = "British Indian Ocean Territory"; -$lng['country']['BN'] = "Brunei Darussalam"; -$lng['country']['BG'] = "Bulgaria"; -$lng['country']['BF'] = "Burkina Faso"; -$lng['country']['BI'] = "Burundi"; -$lng['country']['KH'] = "Cambodia"; -$lng['country']['CM'] = "Cameroon"; -$lng['country']['CA'] = "Canada"; -$lng['country']['CV'] = "Cape Verde"; -$lng['country']['KY'] = "Cayman Islands"; -$lng['country']['CF'] = "Central African Republic"; -$lng['country']['TD'] = "Chad"; -$lng['country']['CL'] = "Chile"; -$lng['country']['CN'] = "China"; -$lng['country']['CX'] = "Christmas Island"; -$lng['country']['CC'] = "Cocos (Keeling) Islands"; -$lng['country']['CO'] = "Colombia"; -$lng['country']['KM'] = "Comoros"; -$lng['country']['CG'] = "Congo"; -$lng['country']['CD'] = "Congo, The Democratic Republic of the"; -$lng['country']['CK'] = "Cook Islands"; -$lng['country']['CR'] = "Costa Rica"; -$lng['country']['CI'] = "Cote D'ivoire"; -$lng['country']['HR'] = "Croatia"; -$lng['country']['CU'] = "Cuba"; -$lng['country']['CW'] = "Curacao"; -$lng['country']['CY'] = "Cyprus"; -$lng['country']['CZ'] = "Czech Republic"; -$lng['country']['DK'] = "Denmark"; -$lng['country']['DJ'] = "Djibouti"; -$lng['country']['DM'] = "Dominica"; -$lng['country']['DO'] = "Dominican Republic"; -$lng['country']['EC'] = "Ecuador"; -$lng['country']['EG'] = "Egypt"; -$lng['country']['SV'] = "El Salvador"; -$lng['country']['GQ'] = "Equatorial Guinea"; -$lng['country']['ER'] = "Eritrea"; -$lng['country']['EE'] = "Estonia"; -$lng['country']['ET'] = "Ethiopia"; -$lng['country']['FK'] = "Falkland Islands (Malvinas)"; -$lng['country']['FO'] = "Faroe Islands"; -$lng['country']['FJ'] = "Fiji"; -$lng['country']['FI'] = "Finland"; -$lng['country']['FR'] = "France"; -$lng['country']['GF'] = "French Guiana"; -$lng['country']['PF'] = "French Polynesia"; -$lng['country']['TF'] = "French Southern Territories"; -$lng['country']['GA'] = "Gabon"; -$lng['country']['GM'] = "Gambia"; -$lng['country']['GE'] = "Georgia"; -$lng['country']['DE'] = "Germany"; -$lng['country']['GH'] = "Ghana"; -$lng['country']['GI'] = "Gibraltar"; -$lng['country']['GR'] = "Greece"; -$lng['country']['GL'] = "Greenland"; -$lng['country']['GD'] = "Grenada"; -$lng['country']['GP'] = "Guadeloupe"; -$lng['country']['GU'] = "Guam"; -$lng['country']['GT'] = "Guatemala"; -$lng['country']['GG'] = "Guernsey"; -$lng['country']['GN'] = "Guinea"; -$lng['country']['GW'] = "Guinea-Bissau"; -$lng['country']['GY'] = "Guyana"; -$lng['country']['HT'] = "Haiti"; -$lng['country']['HM'] = "Heard Island and McDonald Islands"; -$lng['country']['VA'] = "Holy See (Vatican City State)"; -$lng['country']['HN'] = "Honduras"; -$lng['country']['HK'] = "Hong Kong"; -$lng['country']['HU'] = "Hungary"; -$lng['country']['IS'] = "Iceland"; -$lng['country']['IN'] = "India"; -$lng['country']['ID'] = "Indonesia"; -$lng['country']['IR'] = "Iran, Islamic Republic of"; -$lng['country']['IQ'] = "Iraq"; -$lng['country']['IE'] = "Ireland"; -$lng['country']['IM'] = "Isle of Man"; -$lng['country']['IL'] = "Israel"; -$lng['country']['IT'] = "Italy"; -$lng['country']['JM'] = "Jamaica"; -$lng['country']['JP'] = "Japan"; -$lng['country']['JE'] = "Jersey"; -$lng['country']['JO'] = "Jordan"; -$lng['country']['KZ'] = "Kazakhstan"; -$lng['country']['KE'] = "Kenya"; -$lng['country']['KI'] = "Kiribati"; -$lng['country']['KP'] = "Korea, Democratic People's Republic of"; -$lng['country']['KR'] = "Korea, Republic of"; -$lng['country']['KW'] = "Kuwait"; -$lng['country']['KG'] = "Kyrgyzstan"; -$lng['country']['LA'] = "Lao People's Democratic Republic"; -$lng['country']['LV'] = "Latvia"; -$lng['country']['LB'] = "Lebanon"; -$lng['country']['LS'] = "Lesotho"; -$lng['country']['LR'] = "Liberia"; -$lng['country']['LY'] = "Libyan Arab Jamahiriya"; -$lng['country']['LI'] = "Liechtenstein"; -$lng['country']['LT'] = "Lithuania"; -$lng['country']['LU'] = "Luxembourg"; -$lng['country']['MO'] = "Macao"; -$lng['country']['MK'] = "Macedonia, The Former Yugoslav Republic of"; -$lng['country']['MG'] = "Madagascar"; -$lng['country']['MW'] = "Malawi"; -$lng['country']['MY'] = "Malaysia"; -$lng['country']['MV'] = "Maldives"; -$lng['country']['ML'] = "Mali"; -$lng['country']['MT'] = "Malta"; -$lng['country']['MH'] = "Marshall Islands"; -$lng['country']['MQ'] = "Martinique"; -$lng['country']['MR'] = "Mauritania"; -$lng['country']['MU'] = "Mauritius"; -$lng['country']['YT'] = "Mayotte"; -$lng['country']['MX'] = "Mexico"; -$lng['country']['FM'] = "Micronesia, Federated States of"; -$lng['country']['MD'] = "Moldova, Republic of"; -$lng['country']['MC'] = "Monaco"; -$lng['country']['MN'] = "Mongolia"; -$lng['country']['ME'] = "Montenegro"; -$lng['country']['MS'] = "Montserrat"; -$lng['country']['MA'] = "Morocco"; -$lng['country']['MZ'] = "Mozambique"; -$lng['country']['MM'] = "Myanmar"; -$lng['country']['NA'] = "Namibia"; -$lng['country']['NR'] = "Nauru"; -$lng['country']['NP'] = "Nepal"; -$lng['country']['NL'] = "Netherlands"; -$lng['country']['NC'] = "New Caledonia"; -$lng['country']['NZ'] = "New Zealand"; -$lng['country']['NI'] = "Nicaragua"; -$lng['country']['NE'] = "Niger"; -$lng['country']['NG'] = "Nigeria"; -$lng['country']['NU'] = "Niue"; -$lng['country']['NF'] = "Norfolk Island"; -$lng['country']['MP'] = "Northern Mariana Islands"; -$lng['country']['NO'] = "Norway"; -$lng['country']['OM'] = "Oman"; -$lng['country']['PK'] = "Pakistan"; -$lng['country']['PW'] = "Palau"; -$lng['country']['PS'] = "Palestinian Territory, Occupied"; -$lng['country']['PA'] = "Panama"; -$lng['country']['PG'] = "Papua New Guinea"; -$lng['country']['PY'] = "Paraguay"; -$lng['country']['PE'] = "Peru"; -$lng['country']['PH'] = "Philippines"; -$lng['country']['PN'] = "Pitcairn"; -$lng['country']['PL'] = "Poland"; -$lng['country']['PT'] = "Portugal"; -$lng['country']['PR'] = "Puerto Rico"; -$lng['country']['QA'] = "Qatar"; -$lng['country']['RE'] = "Reunion"; -$lng['country']['RO'] = "Romania"; -$lng['country']['RU'] = "Russian Federation"; -$lng['country']['RW'] = "Rwanda"; -$lng['country']['BL'] = "Saint Barthelemy"; -$lng['country']['SH'] = "Saint Helena, Ascension and Tristan Da Cunha"; -$lng['country']['KN'] = "Saint Kitts and Nevis"; -$lng['country']['LC'] = "Saint Lucia"; -$lng['country']['MF'] = "Saint Martin (French Part)"; -$lng['country']['PM'] = "Saint Pierre and Miquelon"; -$lng['country']['VC'] = "Saint Vincent and the Grenadines"; -$lng['country']['WS'] = "Samoa"; -$lng['country']['SM'] = "San Marino"; -$lng['country']['ST'] = "Sao Tome and Principe"; -$lng['country']['SA'] = "Saudi Arabia"; -$lng['country']['SN'] = "Senegal"; -$lng['country']['RS'] = "Serbia"; -$lng['country']['SC'] = "Seychelles"; -$lng['country']['SL'] = "Sierra Leone"; -$lng['country']['SG'] = "Singapore"; -$lng['country']['SX'] = "Sint Maarten (Dutch Part)"; -$lng['country']['SK'] = "Slovakia"; -$lng['country']['SI'] = "Slovenia"; -$lng['country']['SB'] = "Solomon Islands"; -$lng['country']['SO'] = "Somalia"; -$lng['country']['ZA'] = "South Africa"; -$lng['country']['GS'] = "South Georgia and the South Sandwich Islands"; -$lng['country']['ES'] = "Spain"; -$lng['country']['LK'] = "Sri Lanka"; -$lng['country']['SD'] = "Sudan"; -$lng['country']['SR'] = "Suriname"; -$lng['country']['SJ'] = "Svalbard and Jan Mayen"; -$lng['country']['SZ'] = "Swaziland"; -$lng['country']['SE'] = "Sweden"; -$lng['country']['CH'] = "Switzerland"; -$lng['country']['SY'] = "Syrian Arab Republic"; -$lng['country']['TW'] = "Taiwan, Province of China"; -$lng['country']['TJ'] = "Tajikistan"; -$lng['country']['TZ'] = "Tanzania, United Republic of"; -$lng['country']['TH'] = "Thailand"; -$lng['country']['TL'] = "Timor-Leste"; -$lng['country']['TG'] = "Togo"; -$lng['country']['TK'] = "Tokelau"; -$lng['country']['TO'] = "Tonga"; -$lng['country']['TT'] = "Trinidad and Tobago"; -$lng['country']['TN'] = "Tunisia"; -$lng['country']['TR'] = "Turkey"; -$lng['country']['TM'] = "Turkmenistan"; -$lng['country']['TC'] = "Turks and Caicos Islands"; -$lng['country']['TV'] = "Tuvalu"; -$lng['country']['UG'] = "Uganda"; -$lng['country']['UA'] = "Ukraine"; -$lng['country']['AE'] = "United Arab Emirates"; -$lng['country']['GB'] = "United Kingdom"; -$lng['country']['US'] = "United States"; -$lng['country']['UM'] = "United States Minor Outlying Islands"; -$lng['country']['UY'] = "Uruguay"; -$lng['country']['UZ'] = "Uzbekistan"; -$lng['country']['VU'] = "Vanuatu"; -$lng['country']['VE'] = "Venezuela, Bolivarian Republic of"; -$lng['country']['VN'] = "Viet Nam"; -$lng['country']['VG'] = "Virgin Islands, British"; -$lng['country']['VI'] = "Virgin Islands, U.S."; -$lng['country']['WF'] = "Wallis and Futuna"; -$lng['country']['EH'] = "Western Sahara"; -$lng['country']['YE'] = "Yemen"; -$lng['country']['ZM'] = "Zambia"; -$lng['country']['ZW'] = "Zimbabwe"; - -// ADDED IN FROXLOR 0.9.22-svn1 -$lng['diskquota'] = 'Quota'; -$lng['serversettings']['diskquota_enabled'] = 'Quota activated?'; -$lng['serversettings']['diskquota_repquota_path']['description'] = 'Path to repquota'; -$lng['serversettings']['diskquota_quotatool_path']['description'] = 'Path to quotatool'; -$lng['serversettings']['diskquota_customer_partition']['description'] = 'Partition, on which the customer files are stored'; -$lng['tasks']['CREATE_QUOTA'] = 'Set quota on filesystem'; -$lng['error']['session_timeout'] = 'Value too low'; -$lng['error']['session_timeout_desc'] = 'You should not set the session timeout lower than 1 minute.'; - -// ADDED IN FROXLOR 0.9.24-svn1 -$lng['admin']['assignedmax'] = 'Assigned / Max'; -$lng['admin']['usedmax'] = 'Used / Max'; -$lng['admin']['used'] = 'Used'; -$lng['mysql']['size'] = 'Size'; - -$lng['error']['invalidhostname'] = 'Hostname needs to be a valid domain. It can\'t be empty nor can it consist only of whitespaces'; - -$lng['traffic']['http'] = 'HTTP'; -$lng['traffic']['ftp'] = 'FTP'; -$lng['traffic']['mail'] = 'Mail'; - -// ADDED IN 0.9.27-svn1 -$lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Idle Timeout'; -$lng['serversettings']['mod_fcgid']['idle_timeout']['description'] = 'Timeout setting for Mod FastCGI.'; -$lng['serversettings']['phpfpm_settings']['idle_timeout']['title'] = 'Idle Timeout'; -$lng['serversettings']['phpfpm_settings']['idle_timeout']['description'] = 'Timeout setting for PHP FPM FastCGI.'; - -// ADDED IN 0.9.27-svn2 -$lng['panel']['cancel'] = 'Cancel'; -$lng['admin']['speciallogwarning'] = '
WARNING: By changing this setting you will lose all your old statistics for this domain.
'; - -// ADDED IN 0.9.28-svn2 -$lng['serversettings']['vmail_maildirname']['title'] = 'Maildir name'; -$lng['serversettings']['vmail_maildirname']['description'] = 'Maildir directory into user\'s account. Normally \'Maildir\', in some implementations \'.maildir\', and directly into user\'s directory if left blank.'; -$lng['tasks']['DELETE_EMAIL_DATA'] = 'Delete customer e-mail data.'; - -// ADDED IN 0.9.28-svn5 -$lng['error']['operationnotpermitted'] = 'Operation not permitted!'; -$lng['error']['featureisdisabled'] = 'Feature %s is disabled. Please contact your service provider.'; -$lng['serversettings']['catchall_enabled']['title'] = 'Use Catchall'; -$lng['serversettings']['catchall_enabled']['description'] = 'Do you want to provide your customers the catchall-feature?'; - -// ADDED IN 0.9.28.svn6 -$lng['serversettings']['apache_24']['title'] = 'Use modifications for Apache 2.4'; -$lng['serversettings']['apache_24']['description'] = 'ATTENTION: use only if you actually have apache version 2.4 or higher installed
otherwise your webserver will not be able to start'; -$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Path to fastcgi_params file'; -$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specify the path to nginx\'s fastcgi_params file including filename'; - -// Added in Froxlor 0.9.28-rc2 -$lng['serversettings']['documentroot_use_default_value']['title'] = 'Use domain name as default value for DocumentRoot path'; -$lng['serversettings']['documentroot_use_default_value']['description'] = 'If enabled and DocumentRoot path is empty, default value will be the (sub)domain name.

Examples:
/var/customers/customer_name/example.com/
/var/customers/customer_name/subdomain.example.com/'; - -$lng['error']['usercurrentlydeactivated'] = 'The user %s is currently deactivated'; -$lng['admin']['speciallogfile']['title'] = 'Separate logfile'; -$lng['admin']['speciallogfile']['description'] = 'Enable this to get a separate access-log file for this domain'; -$lng['error']['setlessthanalreadyused'] = 'You cannot set less resources of \'%s\' than this user already used
'; -$lng['error']['stringmustntbeempty'] = 'The value for the field %s must not be empty'; -$lng['admin']['domain_editable']['title'] = 'Allow editing of domain'; -$lng['admin']['domain_editable']['desc'] = 'If set to yes, the customer is allowed to change several domain-settings.
If set to no, nothing can be changed by the customer.'; -$lng['admin']['writeaccesslog']['title'] = 'Write an access log'; -$lng['admin']['writeaccesslog']['description'] = 'Enable this to get an access-log file for this domain'; -$lng['admin']['writeerrorlog']['title'] = 'Write an error log'; -$lng['admin']['writeerrorlog']['description'] = 'Enable this to get an error-log file for this domain'; - -// Added in Froxlor 0.9.29-dev -$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['title'] = 'Hide standard-subdomains in PHP-configuration overview'; -$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['description'] = 'If activated the standard-subdomains for customers will not be displayed in the php-configurations overview

Note: This is only visible if you have enabled FCGID or PHP-FPM'; -$lng['serversettings']['passwordcryptfunc']['title'] = 'Choose which password-crypt method is to be used'; -$lng['serversettings']['systemdefault'] = 'System default'; -$lng['serversettings']['panel_allow_theme_change_admin'] = 'Allow admins to change the theme'; -$lng['serversettings']['panel_allow_theme_change_customer'] = 'Allow customers to change the theme'; -$lng['serversettings']['axfrservers']['title'] = 'AXFR servers'; -$lng['serversettings']['axfrservers']['description'] = 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.'; -$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode'; -$lng['serversettings']['powerdns_mode']['description'] = 'Select the PoweDNS mode: Native for no replication (Default) / Master if DNS replication is needed.'; -$lng['panel']['ssleditor'] = 'SSL settings for this domain'; -$lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete certificate content in the textbox'; -$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate'; -$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file'; -$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)'; -$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '

Client authentication, set this only if you know what it is.'; -$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)'; -$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '

Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.'; -$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate'; -$lng['error']['sslcertificatewrongdomain'] = 'The given certificate does not belong to this domain'; -$lng['error']['sslcertificateinvalidcert'] = 'The given certificate-content does not seem to be a valid certificate'; -$lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does not belong to the given certificate'; -$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate'; -$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate'; -$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory'; -$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?

NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.
'; -$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration'; - -// Added in Froxlor 0.9.30 -$lng['crondesc']['cron_mailboxsize'] = 'Calculating of mailbox-sizes'; -$lng['domains']['ipandport_multi']['title'] = 'IP address(es)'; -$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.

NOTE: IP addresses cannot be changed when the domain is configured as alias-domain of another domain.
'; -$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL IP address(es)'; -$lng['domains']['ssl_redirect']['title'] = 'SSL redirect'; -$lng['domains']['ssl_redirect']['description'] = 'This option creates redirects for non-ssl vhosts so that all requests are redirected to the SSL-vhost.

e.g. a request to http://domain.tld/ will redirect you to https://domain.tld/'; -$lng['admin']['phpinfo'] = 'PHPinfo()'; -$lng['admin']['selectserveralias'] = 'ServerAlias value for the domain'; -$lng['admin']['selectserveralias_desc'] = 'Choose whether froxlor should create a wildcard-entry (*.domain.tld), a WWW-alias (www.domain.tld) or no alias at all'; -$lng['domains']['serveraliasoption_wildcard'] = 'Wildcard (*.domain.tld)'; -$lng['domains']['serveraliasoption_www'] = 'WWW (www.domain.tld)'; -$lng['domains']['serveraliasoption_none'] = 'No alias'; -$lng['error']['givendirnotallowed'] = 'The given directory in field %s is not allowed.'; -$lng['serversettings']['ssl']['ssl_cipher_list']['title'] = 'Configure the allowed SSL ciphers'; -$lng['serversettings']['ssl']['ssl_cipher_list']['description'] = 'This is a list of ciphers that you want (or don\'t want) to use when talking SSL. For a list of ciphers and how to include/exclude them, see sections "CIPHER LIST FORMAT" and "CIPHER STRINGS" on the man-page for ciphers.

Default value is:
ECDH+AESGCM:ECDH+AES256:!aNULL:!MD5:!DSS:!DH:!AES128
'; - -// Added in Froxlor 0.9.31 -$lng['panel']['dashboard'] = 'Dashboard'; -$lng['panel']['assigned'] = 'Assigned'; -$lng['panel']['available'] = 'Available'; -$lng['customer']['services'] = 'Services'; -$lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'FastCGI IPC directory'; -$lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'The directory where the php-fpm sockets will be stored by the webserver.
This directory has to be readable for the webserver'; -$lng['panel']['news'] = 'News'; -$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using the SSL redirect is only possible when the domain has at least one ssl-enabled IP/port combination assigned.'; -$lng['error']['fcgidstillenableddeadlock'] = 'FCGID is currently active.
Please deactivate it before switching to another webserver than Apache2 or lighttpd'; -$lng['error']['send_report_title'] = 'Send error report'; -$lng['error']['send_report_desc'] = 'Thank you for reporting this error and helping us to improve Froxlor.
This is the email which will be sent to the Froxlor developer team:'; -$lng['error']['send_report'] = 'Send report'; -$lng['error']['send_report_error'] = 'Error when sending report:
%s'; -$lng['error']['notallowedtouseaccounts'] = 'Your account does not allow using IMAP/POP3. You cannot add email accounts.'; -$lng['pwdreminder']['changed'] = 'Your password has been updated successfully. You can now login with your new password.'; -$lng['pwdreminder']['wrongcode'] = 'Sorry, your activation-code does not exist or has already expired.'; -$lng['admin']['templates']['LINK'] = 'Replaced with the customers password reset link.'; -$lng['pwdreminder']['choosenew'] = 'Set new password'; -$lng['serversettings']['allow_error_report_admin']['title'] = 'Allow administrators/resellers to report database-errors to Froxlor'; -$lng['serversettings']['allow_error_report_admin']['description'] = 'Please note: Never send any personal (customer-)data to us!'; -$lng['serversettings']['allow_error_report_customer']['title'] = 'Allow customers to report database-errors to Froxlor'; -$lng['serversettings']['allow_error_report_customer']['description'] = 'Please note: Never send any personal (customer-)data to us!'; -$lng['admin']['phpsettings']['enable_slowlog'] = 'Enable slowlog (per domain)'; -$lng['admin']['phpsettings']['request_terminate_timeout'] = 'Request terminate-timeout'; -$lng['admin']['phpsettings']['request_slowlog_timeout'] = 'Request slowlog-timeout'; -$lng['admin']['templates']['SERVER_HOSTNAME'] = 'Replaces the system-hostname (URL to froxlor)'; -$lng['admin']['templates']['SERVER_IP'] = 'Replaces the default server ip-address'; -$lng['admin']['templates']['SERVER_PORT'] = 'Replaces the default server port'; -$lng['admin']['templates']['DOMAINNAME'] = 'Replaces the customers standard-subdomain (can be empty if none is generated)'; -$lng['admin']['show_news_feed']['title'] = 'Show news-feed on admin-dashboard'; -$lng['admin']['show_news_feed']['description'] = 'Enable this to show the official Froxlor newsfeed (https://inside.froxlor.org/news/) on your dashboard and never miss important information or release-announcements.'; -$lng['panel']['newsfeed_disabled'] = 'The newsfeed is disabled. Click the edit icon to go to the settings.'; - -// Added in Froxlor 0.9.32 -$lng['logger']['reseller'] = "Reseller"; -$lng['logger']['admin'] = "Administrator"; -$lng['logger']['cron'] = "Cronjob"; -$lng['logger']['login'] = "Login"; -$lng['logger']['intern'] = "Internal"; -$lng['logger']['unknown'] = "Unknown"; -$lng['serversettings']['mailtraffic_enabled']['title'] = "Analyse mail traffic"; -$lng['serversettings']['mailtraffic_enabled']['description'] = "Enable analysing of mailserver logs to calculate the traffic"; -$lng['serversettings']['mdaserver']['title'] = "MDA type"; -$lng['serversettings']['mdaserver']['description'] = "Type of the Mail Delivery Server"; -$lng['serversettings']['mdalog']['title'] = "MDA log"; -$lng['serversettings']['mdalog']['description'] = "Logfile of the Mail Delivery Server"; -$lng['serversettings']['mtaserver']['title'] = "MTA type"; -$lng['serversettings']['mtaserver']['description'] = "Type of the Mail Transfer Agent"; -$lng['serversettings']['mtalog']['title'] = "MTA log"; -$lng['serversettings']['mtalog']['description'] = "Logfile of the Mail Transfer Agent"; -$lng['panel']['ftpdesc'] = 'FTP description'; -$lng['admin']['cronsettings'] = 'Cronjob settings'; -$lng['serversettings']['system_cronconfig']['title'] = 'Cron configuration file'; -$lng['serversettings']['system_cronconfig']['description'] = 'Path to the cron-service configuration-file. This file will be updated regularly and automatically by froxlor.
Note: Please be sure to use the same filename as for the main froxlor cronjob (default: /etc/cron.d/froxlor)!

If you are using FreeBSD, please specify /etc/crontab here!'; -$lng['tasks']['DELETE_FTP_DATA'] = 'Delete customer ftp-account data.'; -$lng['tasks']['REBUILD_CRON'] = 'Rebuilding the cron.d-file'; -$lng['serversettings']['system_crondreload']['title'] = 'Cron-daemon reload command'; -$lng['serversettings']['system_crondreload']['description'] = 'Specify the command to execute in order to reload your systems cron-daemon'; -$lng['admin']['integritycheck'] = 'Database validation'; -$lng['admin']['integrityid'] = '#'; -$lng['admin']['integrityname'] = 'Name'; -$lng['admin']['integrityresult'] = 'Result'; -$lng['admin']['integrityfix'] = 'Fix problems automatically'; -$lng['question']['admin_integritycheck_reallyfix'] = 'Do you really want to try fixing all database integrity problems automatically?'; -$lng['serversettings']['system_croncmdline']['title'] = 'Cron execution command (php-binary)'; -$lng['serversettings']['system_croncmdline']['description'] = 'Command to execute our cronjobs. Change this only if you know what you are doing (default: "/usr/bin/nice -n 5 /usr/bin/php -q")!'; -$lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.'; -$lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.'; -$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates'; -$lng['serversettings']['system_cron_allowautoupdate']['description'] = '
ATTENTION:
This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.

Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option
'; -$lng['error']['passwordshouldnotbeusername'] = 'The password should not be the same as the username.'; - -// Added in Froxlor 0.9.33 -$lng['admin']['customer_show_news_feed'] = "Show newsfeed on customer-dashboard"; -$lng['admin']['customer_news_feed_url']['title'] = "Use custom RSS-feed"; -$lng['admin']['customer_news_feed_url']['description'] = "Specify a custom RSS-feed that will be shown to your customers on their dashboard.
Leave this empty to use the official froxlor newsfeed (https://inside.froxlor.org/news/)."; -$lng['serversettings']['dns_createhostnameentry'] = "Create bind-zone/config for system hostname"; -$lng['serversettings']['panel_password_alpha_lower']['title'] = 'Lowercase character'; -$lng['serversettings']['panel_password_alpha_lower']['description'] = 'Password must contain at least one lowercase letter (a-z).'; -$lng['serversettings']['panel_password_alpha_upper']['title'] = 'Uppercase character'; -$lng['serversettings']['panel_password_alpha_upper']['description'] = 'Password must contain at least one uppercase letter (A-Z).'; -$lng['serversettings']['panel_password_numeric']['title'] = 'Numbers'; -$lng['serversettings']['panel_password_numeric']['description'] = 'Password must contain at least one number (0-9).'; -$lng['serversettings']['panel_password_special_char_required']['title'] = 'Special character'; -$lng['serversettings']['panel_password_special_char_required']['description'] = 'Password must contain at least one of the characters defined below.'; -$lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list'; -$lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.'; -$lng['phpfpm']['use_mod_proxy']['title'] = 'Use mod_proxy / mod_proxy_fcgi'; -$lng['phpfpm']['use_mod_proxy']['description'] = 'Must be enabled when using Debian 9.x (Stretch) or newer. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9'; -$lng['error']['no_phpinfo'] = 'Sorry, unable to read phpinfo()'; - -$lng['admin']['movetoadmin'] = 'Move customer'; -$lng['admin']['movecustomertoadmin'] = 'Move customer to the selected admin/reseller
Leave this empty for no change.
If the desired admin does not show up in the list, his customer-limit has been reached.'; -$lng['error']['moveofcustomerfailed'] = 'Moving the customer to the selected admin/reseller failed. Keep in mind that all other changes to the customer were applied successfully at this stage.

Error-message: %s'; - -$lng['domains']['domain_import'] = 'Import Domains'; -$lng['domains']['import_separator'] = 'Separator'; -$lng['domains']['import_offset'] = 'Offset'; -$lng['domains']['import_file'] = 'CSV-File'; -$lng['success']['domain_import_successfully'] = 'Successfully imported %s domains.'; -$lng['error']['domain_import_error'] = 'Following error occurred while importing domains: %s'; -$lng['admin']['note'] = 'Note'; -$lng['domains']['import_description'] = 'Detailed information about the structure of the import-file and how to import successfully, please visit https://docs.froxlor.org/adminguide/domainimport.html'; -$lng['usersettings']['custom_notes']['title'] = 'Custom notes'; -$lng['usersettings']['custom_notes']['description'] = 'Feel free to put any notes you want/need in here. They will show up in the admin/customer overview for the corresponding user.'; -$lng['usersettings']['custom_notes']['show'] = 'Show your notes on the dashboard of the user'; -$lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID and PHP-FPM cannot be activated at the same time'; - -// Added in Froxlor 0.9.34 -$lng['admin']['configfiles']['legend'] = '

You are about to configure a service/daemon

'; -$lng['admin']['configfiles']['commands'] = 'Commands: These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.'; -$lng['admin']['configfiles']['files'] = 'Config files: The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.
Please note: The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"'; -$lng['serversettings']['apache_itksupport']['title'] = 'Use modifications for Apache ITK-MPM'; -$lng['serversettings']['apache_itksupport']['description'] = 'ATTENTION: use only if you actually have apache itk-mpm enabled
otherwise your webserver will not be able to start'; -$lng['integrity_check']['databaseCharset'] = 'Character set of database (should be UTF-8)'; -$lng['integrity_check']['domainIpTable'] = 'IP <‐> domain references'; -$lng['integrity_check']['subdomainSslRedirect'] = 'False SSL-redirect flag for non-ssl domains'; -$lng['integrity_check']['froxlorLocalGroupMemberForFcgidPhpFpm'] = 'froxlor-user in the customer groups (for FCGID/php-fpm)'; -$lng['integrity_check']['webserverGroupMemberForFcgidPhpFpm'] = 'Webserver-user in the customer groups (for FCGID/php-fpm)'; -$lng['integrity_check']['subdomainLetsencrypt'] = 'Main domains with no SSL-Port assigned don\'t have any subdomains with active SSL redirect'; -$lng['admin']['mod_fcgid_umask']['title'] = 'Umask (default: 022)'; - -// Added for apcuinfo -$lng['admin']['apcuinfo'] = 'APCu info'; -$lng['error']['no_apcuinfo'] = 'No cache info available. APCu does not appear to be running.'; -$lng['apcuinfo']['clearcache'] = 'Clear APCu cache'; -$lng['apcuinfo']['generaltitle'] = 'General Cache Information'; -$lng['apcuinfo']['version'] = 'APCu Version'; -$lng['apcuinfo']['phpversion'] = 'PHP Version'; -$lng['apcuinfo']['host'] = 'APCu Host'; -$lng['apcuinfo']['sharedmem'] = 'Shared Memory'; -$lng['apcuinfo']['sharedmemval'] = '%d Segment(s) with %s (%s memory)'; -$lng['apcuinfo']['start'] = 'Start Time'; -$lng['apcuinfo']['uptime'] = 'Uptime'; -$lng['apcuinfo']['upload'] = 'File Upload Support'; -$lng['apcuinfo']['cachetitle'] = 'Cache Information'; -$lng['apcuinfo']['cvar'] = 'Cached Variables'; -$lng['apcuinfo']['hit'] = 'Hits'; -$lng['apcuinfo']['miss'] = 'Misses'; -$lng['apcuinfo']['reqrate'] = 'Request Rate (hits, misses)'; -$lng['apcuinfo']['creqsec'] = 'cache requests/second'; -$lng['apcuinfo']['hitrate'] = 'Hit Rate'; -$lng['apcuinfo']['missrate'] = 'Miss Rate'; -$lng['apcuinfo']['insrate'] = 'Insert Rate'; -$lng['apcuinfo']['cachefull'] = 'Cache full count'; -$lng['apcuinfo']['runtime'] = 'Runtime Settings'; -$lng['apcuinfo']['memnote'] = 'Memory Usage'; -$lng['apcuinfo']['total'] = 'Total'; -$lng['apcuinfo']['free'] = 'Free'; -$lng['apcuinfo']['used'] = 'Used'; -$lng['apcuinfo']['hitmiss'] = 'Hits & Misses'; -$lng['apcuinfo']['detailmem'] = 'Detailed Memory Usage and Fragmentation'; -$lng['apcuinfo']['fragment'] = 'Fragmentation'; -$lng['apcuinfo']['nofragment'] = 'No fragmentation'; -$lng['apcuinfo']['fragments'] = 'Fragments'; - -// Added for opcache info -$lng['admin']['opcacheinfo'] = 'OPcache Info'; -$lng['error']['no_opcacheinfo'] = 'No cache info available. OPCache does not appear to be running.'; -$lng['opcacheinfo']['generaltitle'] = 'General Information'; -$lng['opcacheinfo']['resetcache'] = 'Reset OPcache'; -$lng['opcacheinfo']['version'] = 'OPCache version'; -$lng['opcacheinfo']['phpversion'] = 'PHP version'; -$lng['opcacheinfo']['runtimeconf'] = 'Runtime Configuration'; -$lng['opcacheinfo']['start'] = 'Start time'; -$lng['opcacheinfo']['lastreset'] = 'Last restart'; -$lng['opcacheinfo']['oomrestarts'] = 'OOM restart count'; -$lng['opcacheinfo']['hashrestarts'] = 'Hash restart count'; -$lng['opcacheinfo']['manualrestarts'] = 'Manual restart count'; -$lng['opcacheinfo']['hitsc'] = 'Hits count'; -$lng['opcacheinfo']['missc'] = 'Miss count'; -$lng['opcacheinfo']['blmissc'] = 'Blacklist miss count'; -$lng['opcacheinfo']['status'] = 'Status'; -$lng['opcacheinfo']['never'] = 'never'; -$lng['opcacheinfo']['enabled'] = 'OPcache Enabled'; -$lng['opcacheinfo']['cachefull'] = 'Cache full'; -$lng['opcacheinfo']['restartpending'] = 'Pending restart'; -$lng['opcacheinfo']['restartinprogress'] = 'Restart in progress'; -$lng['opcacheinfo']['cachedscripts'] = 'Cached scripts count'; -$lng['opcacheinfo']['memusage'] = 'Memory usage'; -$lng['opcacheinfo']['totalmem'] = 'Total memory'; -$lng['opcacheinfo']['usedmem'] = 'Used memory'; -$lng['opcacheinfo']['freemem'] = 'Free memory'; -$lng['opcacheinfo']['wastedmem'] = 'Wasted memory'; -$lng['opcacheinfo']['maxkey'] = 'Maximum keys'; -$lng['opcacheinfo']['usedkey'] = 'Used keys'; -$lng['opcacheinfo']['wastedkey'] = 'Wasted keys'; -$lng['opcacheinfo']['strinterning'] = 'String interning'; -$lng['opcacheinfo']['strcount'] = 'String count'; -$lng['opcacheinfo']['keystat'] = 'Cached keys statistic'; -$lng['opcacheinfo']['used'] = 'Used'; -$lng['opcacheinfo']['free'] = 'Free'; -$lng['opcacheinfo']['blacklist'] = 'Blacklist'; -$lng['opcacheinfo']['novalue'] = 'no value'; -$lng['opcacheinfo']['true'] = 'true'; -$lng['opcacheinfo']['false'] = 'false'; -$lng['opcacheinfo']['funcsavail'] = 'Available functions'; - -// Added for let's encrypt -$lng['admin']['letsencrypt']['title'] = 'Use Let\'s Encrypt'; -$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from Let\'s Encrypt. The certificate will be created and renewed automatically.
ATTENTION: If wildcards are enabled, this option will automatically be disabled.'; -$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt'; -$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from Let\'s Encrypt. The certificate will be created and renewed automatically.'; -$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.'; -$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely'; -$lng['panel']['letsencrypt'] = 'Using Let\'s encrypt'; -$lng['crondesc']['cron_letsencrypt'] = 'updating Let\'s Encrypt certificates'; -$lng['serversettings']['letsencryptca']['title'] = "ACME environment"; -$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt / ZeroSSL certificates."; -$lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt country code"; -$lng['serversettings']['letsencryptcountrycode']['description'] = "2 letter country code used to generate Let's Encrypt certificates."; -$lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt state"; -$lng['serversettings']['letsencryptstate']['description'] = "State used to generate Let's Encrypt certificates."; -$lng['serversettings']['letsencryptchallengepath']['title'] = "Path for Let's Encrypt challenges"; -$lng['serversettings']['letsencryptchallengepath']['description'] = "Directory where the Let's Encrypt challenges should be offered from via a global alias."; -$lng['serversettings']['letsencryptkeysize']['title'] = "Key size for new Let's Encrypt certificates"; -$lng['serversettings']['letsencryptkeysize']['description'] = "Size of the key in Bits for new Let's Encrypt certificates."; -$lng['serversettings']['letsencryptreuseold']['title'] = "Re-use Let's Encrypt key"; -$lng['serversettings']['letsencryptreuseold']['description'] = "If activated, the same key will be used for every renew, otherwise a new key will be generated every time."; -$lng['serversettings']['leenabled']['title'] = "Enable Let's Encrypt"; -$lng['serversettings']['leenabled']['description'] = "If activated, customers are able to let froxlor automatically generate and renew Let's Encrypt ssl-certificates for domains with a ssl IP/port.

Please remember that you need to go through the webserver-configuration when enabled because this feature needs a special configuration."; -$lng['domains']['ssl_redirect_temporarilydisabled'] = "
The SSL redirect is temporarily deactivated while a new Let's Encrypt certificate is generated. It will be activated again after the certificate was generated."; - -// Added for CAA record support -$lng['serversettings']['caa_entry']['title'] = 'Generate CAA DNS records'; -$lng['serversettings']['caa_entry']['description'] = 'Automatically generates CAA records for SSL-enabled domains that are using Let\'s Encrypt'; -$lng['serversettings']['caa_entry_custom']['title'] = 'Additional CAA DNS records'; -$lng['serversettings']['caa_entry_custom']['description'] = 'DNS Certification Authority Authorization (CAA) is an Internet security policy mechanism which allows domain name holders to indicate to certificate authorities
whether they are authorized to issue digital certificates for a particular domain name. It does this by means of a new "CAA" Domain Name System (DNS) resource record.

The content of this field will be included into the DNS zone directly (each line results in a CAA record).
If Let\'s Encrypt is enabled for this domain, this entry will always be added automatically and does not need to be added manually:
0 issue "letsencrypt.org" (If domain is a wildcard domain, issuewild will be used instead).
To enable Incident Reporting, you can add an iodef record. An example for sending such report to me@example.com would be:
0 iodef "mailto:me@example.com"

Attention: The code won\'t be checked for any errors. If it contains errors, your CAA records might not work!'; - -// Autoupdate -$lng['admin']['autoupdate'] = 'Auto-Update'; -$lng['error']['customized_version'] = 'It looks like your Froxlor installation has been modified, no support sorry.'; -$lng['error']['autoupdate_0'] = 'Unknown error'; -$lng['error']['autoupdate_1'] = 'PHP setting allow_url_fopen is disabled. Autoupdate needs this setting to be enabled in php.ini'; -$lng['error']['autoupdate_2'] = 'PHP zip extension not found, please ensure it is installed and activated'; -$lng['error']['autoupdate_4'] = 'The froxlor archive could not be stored to the disk :('; -$lng['error']['autoupdate_5'] = 'version.froxlor.org returned inacceptable values :('; -$lng['error']['autoupdate_6'] = 'Whoops, there was no (valid) version given to download :('; -$lng['error']['autoupdate_7'] = 'The downloaded archive could not be found :('; -$lng['error']['autoupdate_8'] = 'The archive could not be extracted :('; -$lng['error']['autoupdate_9'] = 'The downloaded file did not pass the integrity check. Please try to update again.'; -$lng['error']['autoupdate_10'] = 'Minimum supported version of PHP is 7.4.0'; -$lng['error']['autoupdate_11'] = 'Webupdate is disabled'; - -$lng['admin']['server_php'] = 'PHP'; -$lng['domains']['termination_date'] = 'Date of termination'; -$lng['domains']['termination_date_overview'] = 'terminated as of '; -$lng['panel']['set'] = 'Apply'; -$lng['customer']['selectserveralias_addinfo'] = 'This option can be set when editing the domain. Its initial value is inherited from the parent-domain.'; -$lng['error']['mailaccistobedeleted'] = "Another account with the same name (%s) is currently being deleted and can therefore not be added at this moment."; - -$lng['menue']['extras']['backup'] = 'Backup'; -$lng['extras']['backup'] = 'Create backup'; -$lng['extras']['backup_web'] = 'Backup web-data'; -$lng['extras']['backup_mail'] = 'Backup mail-data'; -$lng['extras']['backup_dbs'] = 'Backup databases'; -$lng['error']['customerhasongoingbackupjob'] = 'There is already a backup job waiting to be processed, please be patient.'; -$lng['success']['backupscheduled'] = 'Your backup job has been scheduled. Please wait for it to be processed'; -$lng['success']['backupaborted'] = 'Your scheduled backup has been cancelled'; -$lng['crondesc']['cron_backup'] = 'Process backup jobs'; -$lng['error']['backupfunctionnotenabled'] = 'The backup function is not enabled'; -$lng['serversettings']['backupenabled']['title'] = "Enable backup for customers"; -$lng['serversettings']['backupenabled']['description'] = "If activated, the customer will be able to schedule backup jobs (cron-backup) which generates an archive within his docroot (subdirectory chosable by customer)"; -$lng['extras']['path_protection_label'] = 'Important'; -$lng['extras']['path_protection_info'] = 'We strongly recommend protecting the given path, see "Extras" -> "Directory protection"'; -$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Backup job for customer %loginname%'; - -$lng['error']['dns_domain_nodns'] = 'DNS is not enabled for this domain'; -$lng['error']['dns_content_empty'] = 'No content given'; -$lng['error']['dns_content_invalid'] = 'DNS content invalid'; -$lng['error']['dns_arec_noipv4'] = 'No valid IP address for A-record given'; -$lng['error']['dns_aaaarec_noipv6'] = 'No valid IP address for AAAA-record given'; -$lng['error']['dns_mx_prioempty'] = 'Invalid MX priority given'; -$lng['error']['dns_mx_needdom'] = 'The MX content value must be a valid domain-name'; -$lng['error']['dns_mx_noalias'] = 'The MX-content value cannot be an CNAME entry.'; -$lng['error']['dns_cname_invaliddom'] = 'Invalid domain-name for CNAME record'; -$lng['error']['dns_cname_nomorerr'] = 'There already exists a resource-record with the same record-name. It can not be used as CNAME.'; -$lng['error']['dns_other_nomorerr'] = 'There already exists a CNAME record with the same record-name. It can not be used for another type.'; -$lng['error']['dns_ns_invaliddom'] = 'Invalid domain-name for NS record'; -$lng['error']['dns_srv_prioempty'] = 'Invalid SRV priority given'; -$lng['error']['dns_srv_invalidcontent'] = 'Invalid SRV content, must contain of fields weight, port and target, e.g.: 5 5060 sipserver.example.com.'; -$lng['error']['dns_srv_needdom'] = 'The SRV target value must be a valid domain-name'; -$lng['error']['dns_srv_noalias'] = 'The SRV-target value cannot be an CNAME entry.'; -$lng['error']['dns_duplicate_entry'] = 'Record already exists'; -$lng['success']['dns_record_added'] = 'Record added successfully'; -$lng['success']['dns_record_deleted'] = 'Record deleted successfully'; -$lng['dnseditor']['edit'] = 'edit DNS'; -$lng['dnseditor']['records'] = 'records'; -$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission'; -$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor'; -$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries'; -$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.'; -$lng['serversettings']['dns_server']['title'] = 'DNS server daemon'; -$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates'; - -$lng['error']['domain_nopunycode'] = 'You must not specify punycode (IDNA). The domain will automatically be converted'; -$lng['admin']['dnsenabled'] = 'Enable DNS editor'; -$lng['error']['dns_record_toolong'] = 'Records/labels can only be up to 63 characters'; - -// Added in froxlor 0.9.37-rc1 -$lng['serversettings']['panel_customer_hide_options']['title'] = 'Hide menu items and traffic charts in customer panel'; -$lng['serversettings']['panel_customer_hide_options']['description'] = 'Select items to hide in customer panel. To select multiple options, hold down CTRL while selecting.'; - -// Added in froxlor 0.9.38-rc1 -$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users'; -$lng['serversettings']['allow_allow_customer_shell']['description'] = 'Please note: Shell access allows the user to execute various binaries on your system. Use with extrem caution. Please only activate this if you REALLY know what you are doing!!!'; -$lng['serversettings']['available_shells']['title'] = 'List of available shells'; -$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.

Note that the default shell /bin/false will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case'; -$lng['panel']['shell'] = 'Shell'; -$lng['serversettings']['le_froxlor_enabled']['title'] = "Enable Let's Encrypt for the froxlor vhost"; -$lng['serversettings']['le_froxlor_enabled']['description'] = "If activated, the froxlor vhost will automatically be secured using a Let's Encrypt certificate."; -$lng['serversettings']['le_froxlor_redirect']['title'] = "Enable SSL-redirect for the froxlor vhost"; -$lng['serversettings']['le_froxlor_redirect']['description'] = "If activated, all http requests to your froxlor will be redirected to the corresponding SSL site."; -$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost settings'; -$lng['serversettings']['option_unavailable_websrv'] = '
Available only for: %s'; -$lng['serversettings']['option_unavailable'] = '
Option not available due to other settings.'; -$lng['serversettings']['letsencryptacmeconf']['title'] = "Path to the acme.conf snippet"; -$lng['serversettings']['letsencryptacmeconf']['description'] = "File name of the config snippet which allows the web server to serve the acme challenge."; -$lng['admin']['hostname'] = 'Hostname'; -$lng['admin']['memory'] = 'Memory usage'; -$lng['serversettings']['mail_use_smtp'] = 'Set mailer to use SMTP'; -$lng['serversettings']['mail_smtp_host'] = 'Specify SMTP server'; -$lng['serversettings']['mail_smtp_usetls'] = 'Enable TLS encryption'; -$lng['serversettings']['mail_smtp_auth'] = 'Enable SMTP authentication'; -$lng['serversettings']['mail_smtp_port'] = 'TCP port to connect to'; -$lng['serversettings']['mail_smtp_user'] = 'SMTP username'; -$lng['serversettings']['mail_smtp_passwd'] = 'SMTP password'; -$lng['domains']['ssl_certificates'] = 'SSL certificates'; -$lng['domains']['ssl_certificate_removed'] = 'The certificate with the id #%s has been removed successfully'; -$lng['domains']['ssl_certificate_error'] = "Error reading certificate for domain: %s"; -$lng['domains']['no_ssl_certificates'] = "There are no domains with SSL certificate"; -$lng['admin']['webserversettings_ssl'] = 'Webserver SSL settings'; -$lng['admin']['domain_hsts_maxage']['title'] = 'HTTP Strict Transport Security (HSTS)'; -$lng['admin']['domain_hsts_maxage']['description'] = 'Specify the max-age value for the Strict-Transport-Security header
The value 0 will disable HSTS for the domain. Most user set a value of 31536000 (one year).'; -$lng['admin']['domain_hsts_incsub']['title'] = 'Include HSTS for any subdomain'; -$lng['admin']['domain_hsts_incsub']['description'] = 'The optional "includeSubDomains" directive, if present, signals the UA that the HSTS Policy applies to this HSTS Host as well as any subdomains of the host\'s domain name.'; -$lng['admin']['domain_hsts_preload']['title'] = 'Include domain in HSTS preload list'; -$lng['admin']['domain_hsts_preload']['description'] = 'If you would like this domain to be included in the HSTS preload list maintained by Chrome (and used by Firefox and Safari), then use activate this.
Sending the preload directive from your site can have PERMANENT CONSEQUENCES and prevent users from accessing your site and any of its subdomains.
Please read the details at hstspreload.appspot.com/#removal before sending the header with "preload".'; - -$lng['serversettings']['http2_support']['title'] = 'HTTP2 Support'; -$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.
ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)'; - -$lng['error']['noipportgiven'] = 'No IP/port given'; - -// Added in froxlor 0.9.38.8 -$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling'; -$lng['admin']['domain_ocsp_stapling']['description'] = 'See Wikipedia for a detailed explanation of OCSP stapling'; -$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '
WARNING: Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!'; -$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: path to the OCSP stapling cache'; -$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Configures the cache used to store OCSP responses which get included in TLS handshakes.'; -$lng['serversettings']['nssextrausers']['title'] = 'Use libnss-extrausers instead of libnss-mysql'; -$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).
For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)'; -$lng['admin']['domain_http2']['title'] = 'HTTP2 support'; -$lng['admin']['domain_http2']['description'] = 'See Wikipedia for a detailed explanation of HTTP2'; -$lng['admin']['testmail'] = 'SMTP test'; -$lng['success']['testmailsent'] = 'Test mail sent successfully'; -$lng['serversettings']['le_domain_dnscheck']['title'] = "Validate DNS of domains when using Let's Encrypt"; -$lng['serversettings']['le_domain_dnscheck']['description'] = "If activated, froxlor will validate whether the domain which requests a Let's Encrypt certificate resolves to at least one of the system ip addresses."; -$lng['menue']['phpsettings']['fpmdaemons'] = 'PHP-FPM versions'; -$lng['admin']['phpsettings']['activephpconfigs'] = 'In use for php-config(s)'; -$lng['admin']['phpsettingsforsubdomains'] = 'Apply php-config to all subdomains:'; -$lng['serversettings']['phpsettingsforsubdomains']['description'] = 'If yes the chosen php-config will be updated to all subdomains'; -$lng['serversettings']['leapiversion']['title'] = "Choose Let's Encrypt ACME implementation"; -$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported."; -$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts'; -$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version'; -$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. Notice: Some older browsers may not support the newest protocol versions.

Default value is:
TLSv1.2
'; -$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions'; -$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php'; -$lng['phpfpm']['ini_flags'] = 'Enter possible php_flags for php.ini. One entry per line'; -$lng['phpfpm']['ini_values'] = 'Enter possible php_values for php.ini. One entry per line'; -$lng['phpfpm']['ini_admin_flags'] = 'Enter possible php_admin_flags for php.ini. One entry per line'; -$lng['phpfpm']['ini_admin_values'] = 'Enter possible php_admin_values for php.ini. One entry per line'; -$lng['serversettings']['phpfpm_settings']['envpath'] = 'Paths to add to the PATH environment. Leave empty for no PATH environment variable'; -$lng['admin']['configfiles']['importexport'] = 'Import/Export'; -$lng['success']['settingsimported'] = 'Settings imported successfully'; -$lng['error']['jsonextensionnotfound'] = 'This feature requires the php json-extension.'; - -// added in froxlor 0.9.39 -$lng['admin']['plans']['name'] = 'Plan name'; -$lng['admin']['plans']['description'] = 'Description'; -$lng['admin']['plans']['last_update'] = 'Last updated'; -$lng['admin']['plans']['plans'] = 'Hosting plans'; -$lng['admin']['plans']['plan_details'] = 'Plan details'; -$lng['admin']['plans']['add'] = 'Add new plan'; -$lng['admin']['plans']['edit'] = 'Edit plan'; -$lng['admin']['plans']['use_plan'] = 'Apply plan'; -$lng['question']['plan_reallydelete'] = 'Do you really want to delete the hosting plan %s?'; -$lng['admin']['notryfiles']['title'] = 'No autogenerated try_files'; -$lng['admin']['notryfiles']['description'] = 'Say yes here if you want to specify a custom try_files directive in specialsettings (needed for some wordpress plugins for example).'; -$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Override FPM-daemon settings (pm, max_children, etc.)'; -$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '
Only used if "Override FPM-daemon settings" is set to "Yes"'; -$lng['panel']['backuppath']['title'] = 'Destination path for the backup'; -$lng['panel']['backuppath']['description'] = 'This is the path where the backups will be stored. If backup of web-data is selected, all files from the homedir are stored excluding the backup-folder specified here.'; - -// added in froxlor 0.10.0 -$lng['panel']['none_value'] = 'None'; -$lng['menue']['main']['apihelp'] = 'API help'; -$lng['menue']['main']['apikeys'] = 'API keys'; -$lng['apikeys']['no_api_keys'] = 'No API keys found'; -$lng['apikeys']['key_add'] = 'Add new key'; -$lng['apikeys']['apikey_removed'] = 'The api key with the id #%s has been removed successfully'; -$lng['apikeys']['apikey_added'] = 'A new api key has been generated successfully'; -$lng['apikeys']['clicktoview'] = 'Click to view'; -$lng['apikeys']['allowed_from'] = 'Allowed from'; -$lng['apikeys']['allowed_from_help'] = 'Comma separated list of ip addresses / networks.
Default is empty (allow from all).'; -$lng['apikeys']['valid_until'] = 'Valid until'; -$lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD'; -$lng['serversettings']['enable_api']['title'] = 'Enable external API usage'; -$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see https://docs.froxlor.org/'; -$lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)'; -$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.
Example: /etc/ssl/webserver/dhparams.pem

If the file does not exist, it will be created automatically with the following command: openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.'; -$lng['2fa']['2fa'] = '2FA options'; -$lng['2fa']['2fa_enabled'] = 'Activate Two-factor authentication (2FA)'; -$lng['login']['2fa'] = 'Two-factor authentication (2FA)'; -$lng['login']['2facode'] = 'Please enter 2FA code'; -$lng['2fa']['2fa_removed'] = '2FA removed successfully'; -$lng['2fa']['2fa_added'] = '2FA activated successfully
View 2FA details'; -$lng['2fa']['2fa_add'] = 'Activate 2FA'; -$lng['2fa']['2fa_delete'] = 'Deactivate 2FA'; -$lng['2fa']['2fa_verify'] = 'Verify code'; -$lng['mails']['2fa']['mailbody'] = 'Hello,\n\nyour 2FA login-code is: {CODE}.\n\nThis is an automatically created\ne-mail, please do not answer!\n\nYours sincerely, your administrator'; -$lng['mails']['2fa']['subject'] = 'Froxlor - 2FA Code'; -$lng['2fa']['2fa_overview_desc'] = 'Here you can activate a two-factor authentication for your account.

You can either use an authenticator-app (time-based one-time password / TOTP) or let froxlor send you an email to your account-address after each successful login with a one-time password.'; -$lng['2fa']['2fa_email_desc'] = 'Your account is set up to use one-time passwords via e-mail. To deactivate, click on "' . $lng['2fa']['2fa_delete'] . '"'; -$lng['2fa']['2fa_ga_desc'] = 'Your account is set up to use time-based one-time passwords via authenticator-app. Please scan the QR code below with your desired authenticator app to generate the codes. To deactivate, click on "' . $lng['2fa']['2fa_delete'] . '"'; -$lng['admin']['logviewenabled'] = 'Enable access to access/error-logs'; -$lng['panel']['viewlogs'] = 'View logfiles'; -$lng['panel']['not_configured'] = 'System not configured yet. Click here to go to configurations.'; -$lng['panel']['ihave_configured'] = 'I have configured the services'; -$lng['panel']['system_is_configured'] = 'System is already set as configured'; -$lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted the settings prior to configuring the services here'; -$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database'; -$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%'; -$lng['admin']['novhostcontainer'] = '

None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available'; -$lng['serversettings']['errorlog_level']['title'] = 'Error log-level'; -$lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.'; -$lng['serversettings']['letsencryptecc']['title'] = "Issue ECC / ECDSA certificate"; -$lng['serversettings']['letsencryptecc']['description'] = "If set to a valid key-size the certificate issued will use ECC / ECDSA"; -$lng['serversettings']['froxloraliases']['title'] = "Domain aliases for froxlor vhost"; -$lng['serversettings']['froxloraliases']['description'] = "Comma separated list of domains to add as server alias to the froxlor vhost"; - -$lng['serversettings']['ssl']['tlsv13_cipher_list']['title'] = 'Configure explicit TLSv1.3 ciphers if used'; -$lng['serversettings']['ssl']['tlsv13_cipher_list']['description'] = 'This is a list of ciphers that you want (or don\'t want) to use when talking TLSv1.3. For a list of ciphers and how to include/exclude them, see the docs for TLSv1.3.

Default value is empty'; -$lng['usersettings']['api_allowed']['title'] = 'Allow API access'; -$lng['usersettings']['api_allowed']['description'] = 'When enabled in the settings, this user can create API keys and access the froxlor API'; -$lng['usersettings']['api_allowed']['notice'] = 'API access is not allowed for your account.'; -$lng['serversettings']['default_sslvhostconf']['title'] = 'Default SSL vHost-settings'; -$lng['serversettings']['includedefault_sslvhostconf'] = 'Include non-SSL vHost-settings in SSL-vHost'; -$lng['admin']['ownsslvhostsettings'] = 'Own SSL vHost-settings'; -$lng['admin']['ipsandports']['ssl_default_vhostconf_domain'] = 'Default SSL vHost-settings for every domain container'; -$lng['customer']['total_diskspace'] = 'Total diskspace'; -$lng['admin']['domain_override_tls'] = 'Override system TLS settings'; -$lng['domains']['isaliasdomainof'] = 'Is aliasdomain for %s'; -$lng['serversettings']['apply_specialsettings_default']['title'] = 'Default value for "' . $lng['admin']['specialsettingsforsubdomains'] . "' setting when editing a domain"; -$lng['serversettings']['apply_phpconfigs_default']['title'] = 'Default value for "' . $lng['admin']['phpsettingsforsubdomains'] . "' setting when editing a domain"; -$lng['admin']['domain_sslenabled'] = 'Enable usage of SSL'; -$lng['admin']['domain_honorcipherorder'] = 'Honor the (server) cipher order, default no'; -$lng['admin']['domain_sessiontickets'] = 'Enable TLS sessiontickets (RFC 5077), default yes'; - -$lng['admin']['domain_sessionticketsenabled']['title'] = 'Enable usage of TLS sessiontickets globally'; -$lng['admin']['domain_sessionticketsenabled']['description'] = 'Default yes
Requires apache-2.4.11+ or nginx-1.5.9+'; - -$lng['serversettings']['phpfpm_settings']['restart_note'] = 'Attention: The config won\'t be checked for any errors. If it contains errors, PHP-FPM might not start again!'; -$lng['serversettings']['phpfpm_settings']['custom_config']['title'] = 'Custom configuration'; -$lng['serversettings']['phpfpm_settings']['custom_config']['description'] = 'Add custom configuration to each PHP-FPM version instance, for example pm.status_path = /status for monitoring. Variables below can be used here. ' . ' ' . $lng['serversettings']['phpfpm_settings']['restart_note'] . ''; - -$lng['serversettings']['awstats']['logformat']['title'] = 'LogFormat setting'; -$lng['serversettings']['awstats']['logformat']['description'] = 'If you use customized logformat for your webserver, you need change the awstats LogFormat too.
Default is 1. For more information check documentation here.'; -$lng['error']['cannotdeletesuperadmin'] = 'The first admin cannot be deleted.'; -$lng['error']['no_wwwcnamae_ifwwwalias'] = 'Cannot set CNAME record for "www" as domain is set to generate a www-alias. Please change settings to either "No alias" or "Wildcard alias"'; -$lng['serversettings']['hide_incompatible_settings'] = 'Hide incompatible settings'; - -$lng['serversettings']['soaemail'] = 'Mail address to use in SOA records (defaults to sender address from panel settings if empty)'; -$lng['imprint'] = 'Legal notes'; -$lng['serversettings']['imprint_url']['title'] = 'URL to legal notes / imprint'; -$lng['serversettings']['imprint_url']['description'] = 'Specify an URL to your legal notes / imprint site. The link will be visible on the login screen and on the footer when logged in.'; -$lng['terms'] = 'Terms of use'; -$lng['serversettings']['terms_url']['title'] = 'URL to terms of use'; -$lng['serversettings']['terms_url']['description'] = 'Specify an URL to your terms of use site. The link will be visible on the login screen and on the footer when logged in.'; -$lng['privacy'] = 'Privacy policy'; -$lng['serversettings']['privacy_url']['title'] = 'URL to privacy policy'; -$lng['serversettings']['privacy_url']['description'] = 'Specify an URL to your privacy policy site / imprint site. The link will be visible on the login screen and on the footer when logged in.'; -$lng['admin']['domaindefaultalias'] = 'Default ServerAlias value for new domains'; - -$lng['serversettings']['logo_image_header']['title'] = 'Logo Image (Header)'; -$lng['serversettings']['logo_image_header']['description'] = 'Upload your own logo image to be shown in the header after login (recommended height 30px)'; -$lng['serversettings']['logo_image_login']['title'] = 'Logo Image (Login)'; -$lng['serversettings']['logo_image_login']['description'] = 'Upload your own logo image to be shown during login'; -$lng['panel']['image_field_delete'] = 'Delete the existing current image'; -$lng['serversettings']['logo_overridetheme']['title'] = 'Overwrites logo defined in theme by "Logo Image" (Header and Login, see below)'; -$lng['serversettings']['logo_overridetheme']['description'] = 'This needs to be set to "true" if you intend to use your uploaded logo; alternatively you can still use the theme-based "logo_custom.png" and "logo_custom_login.png" possibility.'; -$lng['serversettings']['logo_overridecustom']['title'] = 'Overwrite custom logo (logo_custom.png and logo_custom_login.png) defined in theme by "Logo Image" (Header and Login, see below)'; -$lng['serversettings']['logo_overridecustom']['description'] = 'Set this to "true" if you want to ignore theme-specific custom logos for header and login and use "Logo Image"'; -$lng['serversettings']['createstdsubdom_default']['title'] = 'Preselected value for "'.$lng['admin']['stdsubdomain_add'].'" when creating a customer'; -$lng['serversettings']['froxlorusergroup']['title'] = 'Custom system group for all customer users'; -$lng['serversettings']['froxlorusergroup']['description'] = 'Usage of libnss-extrausers (system-settings) is required for this to take effect. An empty value skips creation or removes existing group.'; -$lng['error']['local_group_exists'] = 'The given group already exists on the system.'; -$lng['error']['local_group_invalid'] = 'The given group name is invalid'; -$lng['error']['invaliddnsforletsencrypt'] = 'The domains DNS does not include any of the chosen IP addresses. Let\'s Encrypt certificate generation not possible.'; -$lng['error']['notallowedphpconfigused'] = 'Trying to use php-config which is not assigned to customer'; - -$lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'] = 'Assign this configuration to all currently existing customers'; -$lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'] = 'Set this to "true" if you want to assign this configuration to all currently existing customers so it can be used by them. This setting is not permanent but can be run multiple times.'; -$lng['error']['pathmustberelative'] = 'The user does not have the permission to specify directories outside the customers home-directory. Please specify a relative path (no leading /).'; -$lng['serversettings']['acmeshpath']['title'] = 'Path to acme.sh'; -$lng['serversettings']['acmeshpath']['description'] = 'Set this to where acme.sh is installed to, including the acme.sh script
Default is /root/.acme.sh/acme.sh'; - -$lng['panel']['usage_statistics'] = 'Resource usage'; -$lng['panel']['security_question'] = 'Security question'; -$lng['ssl_certificates']['certificate_for'] = 'Certificate for'; -$lng['ssl_certificates']['valid_from'] = 'Valid from'; -$lng['ssl_certificates']['valid_until'] = 'Valid until'; -$lng['ssl_certificates']['issuer'] = 'Issuer'; -$lng['panel']['listing_empty'] = 'No entries found'; -$lng['admin']['configfiles']['finishnote'] = 'Parameter file generated successfully. Now run the following command as root:'; -$lng['admin']['configfiles']['description'] = 'Configure the system services'; -$lng['admin']['configfiles']['skipconfig'] = 'Don\'t (re)configure'; -$lng['admin']['configfiles']['recommendednote'] = 'Recommended/required services based on current system settings'; -$lng['admin']['configfiles']['selectrecommended'] = 'Select recommended'; -$lng['update']['description'] = 'Running database updates for your froxlor installation'; -$lng['admin']['smtpsettings'] = 'SMTP settings'; -$lng['panel']['unspecified'] = 'unspecified'; -$lng['admin']['smtptestaddr'] = 'Send test-mail to'; -$lng['admin']['smtptestnote'] = 'Note that the values below reflect your current settings and can only be adjusted there (see link in top right corner)'; -$lng['panel']['backtooverview'] = 'Back to overview'; -$lng['panel']['settingsmode'] = 'Mode'; -$lng['panel']['settingsmodebasic'] = 'Basic'; -$lng['panel']['settingsmodeadvanced'] = 'Advanced'; -$lng['panel']['settingsmodetoggle'] = 'Click to toggle mode'; -$lng['panel']['modalclose'] = 'Close'; -$lng['panel']['managetablecolumnsmodal']['title'] = 'Manage table columns'; -$lng['panel']['managetablecolumnsmodal']['description'] = 'Here you can customize the visible columns'; -$lng['question']['apikey_reallydelete'] = 'Do you really want to delete this api-key?'; diff --git a/lng/fr.lng.php b/lng/fr.lng.php new file mode 100644 index 00000000..7017d11a --- /dev/null +++ b/lng/fr.lng.php @@ -0,0 +1,778 @@ + + * @author Tim Zielosko + * @author Aldo Reset + * @author Romain MARIADASSOU + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + 'admin' => [ + 'overview' => 'Sommaire', + 'ressourcedetails' => 'Ressources utilisées', + 'systemdetails' => 'Informations du système', + 'froxlordetails' => 'Informations de Froxlor', + 'installedversion' => 'Version installée', + 'latestversion' => 'Dernière version en date', + 'lookfornewversion' => [ + 'clickhere' => 'Vérifier par internet', + 'error' => 'Erreur pour vérifier la dernière version', + ], + 'resources' => 'Ressources', + 'customer' => 'Compte', + 'customers' => 'Comptes', + 'customer_add' => 'Ajouter un compte', + 'customer_edit' => 'Modifier un compte', + 'domains' => 'Domaines', + 'domain_add' => 'Ajouter un domaine', + 'domain_edit' => 'Modifier le domaine', + 'subdomainforemail' => 'Sous-domaines comme domaine e-mail', + 'admin' => 'Administrateur', + 'admins' => 'Administrateurs', + 'admin_add' => 'Ajouter un administrateur', + 'admin_edit' => 'Modifier un administrateur', + 'customers_see_all' => 'Peut voir tous les comptes ?', + 'domains_see_all' => 'Peut voir tous les Domaines ?', + 'change_serversettings' => 'Peut modifier la configuration du serveur ?', + 'server' => 'Système', + 'serversettings' => 'Paramètres', + 'rebuildconf' => 'Régénérer la configuration', + 'stdsubdomain' => 'Sous-domaine type', + 'stdsubdomain_add' => 'Ajouter un sous-domaine type', + 'phpenabled' => 'PHP activé', + 'deactivated' => 'Désactiver', + 'deactivated_user' => 'Désactiver l\'utilisateur', + 'sendpassword' => 'Envoyer le mot de passe', + 'ownvhostsettings' => 'Configuration spéciale du vHost', + 'configfiles' => [ + 'serverconfiguration' => 'Exemple de configuration', + 'overview' => 'Aperçu', + 'wizard' => 'Assistant', + 'distribution' => 'Distribution', + 'service' => 'Service', + 'daemon' => 'Démon', + 'http' => 'Serveur Web (HTTP)', + 'dns' => 'Serveur de Noms (DNS)', + 'mail' => 'Serveur de Mails (IMAP/POP3)', + 'smtp' => 'Serveur de Mails (SMTP)', + 'ftp' => 'Serveur FTP', + 'etc' => 'Autres (Système)', + 'choosedistribution' => '-- Choisissez une distribution --', + 'chooseservice' => '-- Choisissez un service --', + 'choosedaemon' => '-- Choisissez un démon --', + 'statistics' => 'Statistiques', + ], + 'templates' => [ + 'templates' => 'Modèles', + 'template_add' => 'Ajouter un modèle', + 'template_edit' => 'Modifier un modèle', + 'action' => 'Action', + 'email' => 'E-mail', + 'subject' => 'Référence', + 'mailbody' => 'Texte de l\'e-mail', + 'createcustomer' => 'E-mail de bienvenue pour les nouveaux clients', + 'pop_success' => 'E-mail de bienvenue pour les nouveaux accès e-mail', + 'template_replace_vars' => 'Les variables qui seront remplacées dans le template :', + 'FIRSTNAME' => 'Sera remplacé par le prénom.', + 'NAME' => 'Sera remplacé par le nom.', + 'USERNAME' => 'Sera remplacé par le login.', + 'PASSWORD' => 'Sera remplacé par le mot de passe du client.', + 'EMAIL' => 'Sera remplacé par l\'accès e-mail.', + 'TRAFFIC' => 'Sera remplacé par le taux de trafic qui a été attribué à l\'utilisateur.', + 'TRAFFICUSED' => 'Sera remplacé par le taux de trafic qui a été consommé par l\'utilisateur.', + 'pop_success_alternative' => 'Message de bienvenue envoyé à l\'adresse e-mail alternative pour les nouveaux comptes e-mails', + 'EMAIL_PASSWORD' => 'Remplacer par le mot de passe du compte POP3 / IMAP.', + ], + 'ipsandports' => [ + 'ipsandports' => 'IPs et ports', + 'add' => 'Ajouter une IP / port', + 'edit' => 'Modifier une IP / port', + 'create_listen_statement' => 'Déclaration des ports d\'écoute', + 'create_namevirtualhost_statement' => 'Déclaration des hôtes virtuels "NameVirtualHost"', + 'create_vhostcontainer' => 'Déclaration des conteneurs virtuels "vHost"', + 'create_vhostcontainer_servername_statement' => 'Déclaration des noms d\'hôtes "ServerName" dans les conteneurs virtuels "vHost"', + 'enable_ssl' => 'Est-ce un port SSL ?', + 'ssl_cert_file' => 'Emplacement du certificat SSL', + ], + 'memorylimitdisabled' => 'Désactivé', + 'valuemandatory' => 'Cette valeur est obligatoire', + 'valuemandatorycompany' => 'Vous devez indiquer au moins l\'une des 3 valeurs suivantes : "nom" ou "prénom" ou "entreprise"', + 'serversoftware' => 'Logiciel Serveur', + 'phpversion' => 'Version de PHP', + 'phpmemorylimit' => 'Limite mémoire de PHP', + 'mysqlserverversion' => 'Version du serveur MySQL', + 'mysqlclientversion' => 'Version du client MySQL', + 'webserverinterface' => 'Interface Web', + 'accountsettings' => 'Paramètres du compte', + 'panelsettings' => 'Paramètres du panel', + 'systemsettings' => 'Paramètres du système', + 'webserversettings' => 'Paramètres du serveur Web', + 'mailserversettings' => 'Paramètres du serveur de Mail', + 'nameserversettings' => 'Paramètres du serveur de Noms', + 'updatecounters' => 'Recalculer les ressources utilisées', + 'subcanemaildomain' => [ + 'never' => 'Jamais', + 'choosableno' => 'A choisir, par défaut : non', + 'choosableyes' => 'A choisir, par défaut : oui', + 'always' => 'Toujours', + ], + 'webalizersettings' => 'Paramètres pour Webalizer', + 'webalizer' => [ + 'normal' => 'Normal', + 'quiet' => 'Silencieux', + 'veryquiet' => 'Aucune sortie', + ], + 'domain_nocustomeraddingavailable' => 'Il n\'est acutellement pas possible d\'ajouter de domaines. Vous devez d\'abord ajouter un client.', + 'loggersettings' => 'Paramètres des logs', + 'logger' => [ + 'normal' => 'normal', + 'paranoid' => 'paranoïaque', + ], + 'loggersystem' => 'Log système', + 'emaildomain' => 'Domaine e-mail', + 'email_only' => 'Seulement des e-mails ?', + 'wwwserveralias' => 'Ajouter un "www." à l\'alias du serveur "ServerAlias"', + 'subject' => 'Sujet', + 'recipient' => 'Destinataire', + 'message' => 'Ecrire un message', + 'text' => 'Message', + 'sslsettings' => 'Paramètres SSL', + 'dkimsettings' => 'Paramètres DKIM', + 'caneditphpsettings' => 'Peut changer les paramétres PHP du domaine ?', + 'allips' => 'Toutes les adresses IP', + 'awstatssettings' => 'Paramètres Awstats', + 'domain_dns_settings' => 'Paramètres DNS', + 'activated' => 'Activé', + 'statisticsettings' => 'Paramètres des statistiques', + 'or' => 'ou', + 'sysload' => 'Charge du système', + 'noloadavailable' => 'Non disponible', + 'nouptimeavailable' => 'Non disponible', + 'nosubject' => '(Aucun sujet)', + ], + 'changepassword' => [ + 'old_password' => 'Ancien mot de passe', + 'new_password' => 'Nouveau mot de passe', + 'new_password_confirm' => 'Nouveau mot de passe (confirmation)', + 'new_password_ifnotempty' => 'Nouveau mot de passe (Veuillez laisser vide pour ne pas changer)', + 'also_change_ftp' => 'Changer aussi le mot de passe du compte FTP principal ?', + 'also_change_webalizer' => 'Changer aussi le mot de passe des statistiques Webalizer ?', + ], + 'cronjobs' => [ + 'notyetrun' => 'Pas encore lancé', + ], + 'customer' => [ + 'documentroot' => 'Chemin', + 'name' => 'Nom', + 'firstname' => 'Prénom', + 'company' => 'Entreprise', + 'street' => 'Rue', + 'zipcode' => 'Code postal', + 'city' => 'Ville', + 'phone' => 'Téléphone', + 'fax' => 'Fax', + 'email' => 'E-mail', + 'customernumber' => 'Numéro du client', + 'diskspace' => 'Espace Web (Mo)', + 'traffic' => 'Trafic (Go)', + 'mysqls' => 'Base(s) de données MySQL', + 'emails' => 'Adresse(s) e-mail', + 'accounts' => 'Accès e-mail', + 'forwarders' => 'Transfert(s) e-mail', + 'ftps' => 'Accès FTP', + 'subdomains' => 'Sous-domaine(s)', + 'domains' => 'Domaine(s)', + 'email_quota' => 'Quota e-mail', + 'email_imap' => 'E-mail IMAP', + 'email_pop3' => 'E-mail POP3', + 'mail_quota' => 'Quota e-mail', + 'title' => 'Titre', + 'country' => 'Pays', + ], + 'dkim' => [ + 'dkim_prefix' => [ + 'title' => 'Prefix DKIM', + 'description' => 'Veuillez entrer l\'emplacement des fichiers RSA pour DKIM ainsi que l\'emplacement du fichier de configuration pour le plugin Milter', + ], + 'dkim_domains' => [ + 'title' => 'Nom du fichier DKIM', + 'description' => 'Nom du fichier des paramètres DKIM pour les domaines tel que entré dans la configuration de DKIM-milter', + ], + 'dkim_dkimkeys' => [ + 'title' => 'Nom du fichier des clefs DKIM', + 'description' => 'Nom du fichier des paramètres des clefs DKIM tel que entré dans la configuration de DKIM-milter', + ], + 'dkimrestart_command' => [ + 'title' => 'Commande de redémarrage de DKIM-milter', + 'description' => 'Veuillez entrer la commande de redémarrage du service DKIM-milter', + ], + 'use_dkim' => [ + 'title' => 'Activer le support DKIM ?', + 'description' => 'Voulez-vous utiliser le système DKIM (DomainKeys Identified Mail) ?', + ], + ], + 'dns' => [ + 'destinationip' => 'IP du domaine', + 'standardip' => 'IP standard du serveur', + 'a_record' => 'Enregistrement de type "A" (IPv6 optionnel)', + 'cname_record' => 'Enregistrement CNAME', + 'mxrecords' => 'Définition des enregistrements MX', + 'standardmx' => 'Enregistrements MX standard du serveur', + 'mxconfig' => 'Enregistrements MX personnalisé', + 'priority10' => 'Priorité 10', + 'priority20' => 'Priorité 20', + 'txtrecords' => 'Définir des enregistrement TXT', + 'txtexample' => 'Exemple (pour SPF) :
v=spf1 ip4:xxx.xxx.xx.0/23 -all', + ], + 'domain' => [ + 'openbasedirpath' => 'Dossier "OpenBasedir"', + 'docroot' => 'Identique au dossier ci-dessus', + 'homedir' => 'Dossier Principal', + ], + 'domains' => [ + 'description' => 'Ici, vous pouvez ajouter des sites et domaines et changer leurs doosiers.
Il vous faudra patienter quelques minutes après chaque changement pour que la configuration soit activée.', + 'domainsettings' => 'Configuration des Domaines', + 'domainname' => 'Nom du Domaine', + 'subdomain_add' => 'Ajouter un sous-domaine', + 'subdomain_edit' => 'Changer un sous-domaine', + 'wildcarddomain' => 'Domaine générique (Wilcard) ?', + 'aliasdomain' => 'Alias pour le domaine', + 'noaliasdomain' => 'Domaine sans alias', + 'hasaliasdomains' => 'Le domaine possède un ou des alias.', + 'statstics' => 'Fréquentation', + 'isassigneddomain' => 'Le domaine est attribué', + 'add_date' => 'Ajouter à Froxlor', + 'registration_date' => 'Ajouter à l\'enregistrement', + ], + 'emails' => [ + 'description' => 'Ici, vous pouvez ajouter vos boîtes e-mails.

Les informations pour configurer votre logiciel e-mail sont les suivantes :

Nom du serveur : votre-domaine.com
Identifiant : l\'adresse e-mail
Mot de passe : le mot de passe que vous avez choisi', + 'emailaddress' => 'Adresse', + 'emails_add' => 'Ajouter une adresse e-mail', + 'emails_edit' => 'Changer une adresse e-mail', + 'catchall' => 'Catchall', + 'iscatchall' => 'Définir comme adresse "catchall" ?', + 'account' => 'Accès', + 'account_add' => 'Ajouter un accès', + 'account_delete' => 'Supprimer l\'accès', + 'from' => 'de', + 'to' => 'à', + 'forwarders' => 'Réexpédition', + 'forwarder_add' => 'Ajouter un renvoi', + 'alternative_emailaddress' => 'Adresse e-mail alternative', + 'quota' => 'Quota', + 'noquota' => 'Pas de quota', + 'updatequota' => 'Mise à jour', + ], + 'error' => [ + 'error' => 'Erreur', + 'directorymustexist' => 'Le dossier que vous avez choisi n\'existe pas. Veuillez ajouter le dossier avec votre client FTP.', + 'filemustexist' => 'Le fichier que vous avez sélectionné n\'existe pas.', + 'allresourcesused' => 'Vous avez déjà utilisé toutes les ressources.', + 'domains_cantdeletemaindomain' => 'Vous ne pouvez pas supprimer un domaine qui est utilisé pour des adresses e-mails.', + 'domains_canteditdomain' => 'Vous n\'avez pas le droit de configurer ce domaine.', + 'domains_cantdeletedomainwithemail' => 'Vous ne pouvez pas supprimer un domaine qui est utilisé pour des e-mails. Vous devez d\'abord supprimer toutes les adresses e-mails qu\'il contient.', + 'firstdeleteallsubdomains' => 'Il faut d\'abord supprimer tous les sous-domaines avant d\'ajouter un domaine "wildcard".', + 'youhavealreadyacatchallforthisdomain' => 'Vous avez déjà défini une adresse "catchall" pour ce domaine.', + 'ftp_cantdeletemainaccount' => 'Vous ne pouvez pas supprimer votre accès principal.', + 'login' => 'Identifiant / mot de passe invalide.', + 'login_blocked' => 'Cet identifiant a été bloqué à cause de nombreuses tentatives de connexions invalides.
Veuillez réessayer dans %s secondes.', + 'notallreqfieldsorerrors' => 'Vous n\'avez pas rempli toutes les cases obligatoires ou vous les avez remplis avec des informations invalides.', + 'oldpasswordnotcorrect' => 'L\'ancien mot de passe n\'est pas correct.', + 'youcantallocatemorethanyouhave' => 'Vous ne pouvez pas distribuer plus de ressources qu\'il n\'en reste.', + 'mustbeurl' => 'Vous n\'avez pas entré une adresse URL valide.', + 'invalidpath' => 'Vous n\'avez pas choisi une adresse URL valide (probablement à cause de problèmes avec le listing de dossiers ?)', + 'stringisempty' => 'Entrée manquante', + 'stringiswrong' => 'Entrée invalide', + 'newpasswordconfirmerror' => 'Le nouveau mot de passe et sa confirmation ne sont pas identiques pas.', + 'mydomain' => '"domaine"', + 'loginnameexists' => 'L\'identifiant "%s" existe déjà.', + 'emailiswrong' => 'L\'adresse "%s" contient des signes invalides ou est incomplète.', + 'loginnameiswrong' => 'L\'identifiant "%s" contient des signes invalides.', + 'userpathcombinationdupe' => 'Cette combinaison d\'identifiant et de dossier existe déjà.', + 'patherror' => 'Erreur générale ! Le dossier ne doit pas être vide.', + 'errordocpathdupe' => 'Il y a déjà une option concernant le dossier "%s".', + 'adduserfirst' => 'Vous devez d\'abord ajouter un.', + 'domainalreadyexists' => 'Le domaine "%s" existe déjà.', + 'nolanguageselect' => 'Aucune langue choisis.', + 'nosubjectcreate' => 'Il faut entrer un sujet.', + 'nomailbodycreate' => 'Il faut entrer un corps de texte.', + 'templatenotfound' => 'Aucun modèle trouvé.', + 'alltemplatesdefined' => 'Vous avez déjà appliqué des modèles pour toutes les langues.', + 'wwwnotallowed' => 'Un sous-domaine ne peut pas s\'appeler www.', + 'subdomainiswrong' => 'Le sous-domaine "%s" contient des signes invalides.', + 'domaincantbeempty' => 'Le nom de domaine ne doit pas être vide.', + 'domainexistalready' => 'Le domaine "%s" existe déjà.', + 'domainisaliasorothercustomer' => 'L\'alias du domaine choisi est soit un alias existant d\'un autre client ou soit fait référence à lui même.', + 'emailexistalready' => 'L\'adresse "%s" existe déjà.', + 'maindomainnonexist' => 'Le domaine "%s" n\'existe pas.', + 'destinationnonexist' => 'Veuillez écrire votre adresse de renvoi à l\'emplacement "à".', + 'destinationalreadyexistasmail' => 'Le renvoi vers l\'adresse "%s" existe déjà comme adresse active.', + 'destinationalreadyexist' => 'Il existe déjà une réexpédition vers l\'adresse "%s".', + 'destinationiswrong' => 'L\'adresse "%s" contient des signes invalides ou est incomplète.', + 'loginnameissystemaccount' => 'Vous ne pouvez pas créer de compte ressemblant aux comptes système (ex : "%s"). Veuillez entrer un autre nom de compte.', + 'ipstillhasdomains' => 'La combinaison IP / port est encore utilisée, veuillez réassigner le ou les domaines existant(s) avec cette adresse IP / port concerné(s) à une autre combinaison IP / port avant de supprimer celle-ci.', + 'cantdeletedefaultip' => 'Vous ne pouvez pas supprimer cette combinaison IP / Port, veuillez d\'abord attribuer une autre combinaison IP / Port par défaut à ce revendeur avant de supprimer celle-ci.', + 'cantdeletesystemip' => 'Vous ne pouvez pas créer, modifier ou supprimer l\'IP du système.', + 'myipdefault' => 'Choissez une combinaison IP / port par défaut.', + 'myipnotdouble' => 'Cette combinaison existe déjà', + 'cantchangesystemip' => 'Vous ne pouvez pas modifier l\'adresse IP du système, ni en ajouter de nouvelle.', + 'sessiontimeoutiswrong' => 'Seule une valeur numérique pour le temps d\'inactivité est autorisée.', + 'maxloginattemptsiswrong' => 'Seule une valeur numérique pour "nombre maximum de tentative de connexion" est autorisée.', + 'deactivatetimiswrong' => 'Seule une valeur numérique pour la durée de désactivation est autorisée.', + 'accountprefixiswrong' => 'Le "Préfixe client" n\'est pas valide.', + 'mysqlprefixiswrong' => 'Le "Préfixe SQL" n\'est pas valide.', + 'ftpprefixiswrong' => 'Le "Préfixe FTP" n\'est pas valide.', + 'ipiswrong' => 'L\'"Adresse IP" n\'est pas valide.', + 'vmailuidiswrong' => 'L\'"UID e-mail" est incorrect. Seul un UID numérique est autorisé.', + 'vmailgidiswrong' => 'Le "GID e-mail" est incorrect. Seul un GID numérique est autorisé.', + 'adminmailiswrong' => 'L\'adresse e-mail de l\'administrateur est incorrect. Seulement une adresse e-mail valide est autorisé.', + 'pagingiswrong' => 'La valeur "Nombre de résultats page" est incorrecte. Seul une valeur numérique est autorisée.', + 'phpmyadminiswrong' => 'Le lien pour phpMyAdmin n\'est pas valide.', + 'webmailiswrong' => 'Le lien pour le WebMail n\'est pas valide.', + 'webftpiswrong' => 'Le lien pour le WebFTP n\'est pas valide.', + 'stringformaterror' => 'La valeur pour "%s" n\'est pas dans un format reconnu.', + 'youcantdeleteyourself' => 'Vous ne pouvez pas supprimer votre propre compte pour des raisons évidente de sécurité ...', + 'youcanteditallfieldsofyourself' => 'Note : Vous ne pouvez pas éditer tous les champs de votre propre compte pour des raisons de sécurité.', + 'documentrootexists' => 'Le dossier "%s" existe déjà pour cet utilisateur. Veuillez le supprimer / déplacer avant de réessayer l\'ajout de cet utilisateur.', + 'formtokencompromised' => 'La requète semble compromise. Pour des raisons de sécurité, vous avez été déconnecté.', + 'logerror' => 'Erreur log : %s', + 'nomessagetosend' => 'Vous n\'avez pas entré de message.', + 'norecipientsgiven' => 'Vous n\'avez pas spécifier de destinataire', + 'errorsendingmail' => 'Echec d\'envoi du message à "%s"', + 'cannotreaddir' => 'Impossible de lire dossier "%s"', + 'vmailquotawrong' => 'La taille du quota doit être entre 1 et 999', + 'invalidip' => 'Adresse IP invalide : %s', + 'invalidmysqlhost' => 'Adresse hôte MySQL invalide : "%s"', + 'cannotuseawstatsandwebalizeratonetime' => 'Vous ne pouvez pas activer AWStats et Webalizer en même temps. Veuillez n\'en choisir qu\'un seul.', + 'cannotwritetologfile' => 'Ne peut ouvrir le fichier de log %s en écriture', + ], + 'extras' => [ + 'description' => 'Ici, vous pouvez ajouter des extras, comme par exemple, la protection de dossiers du site.
Il vous faudra patienter quelques minutes après chaque changement pour que la configuration soit activée.', + 'directoryprotection_add' => 'Ajouter une protection de dossier', + 'view_directory' => 'Aperçu du dossier', + 'pathoptions_add' => 'Ajouter des options sur le dossier', + 'directory_browsing' => 'Afficher le contenu des dossiers', + 'pathoptions_edit' => 'Modifier les options de dossier', + 'errordocument404path' => 'Emplacement du document "Erreur 404"', + 'errordocument403path' => 'Emplacement du document "Erreur 403"', + 'errordocument500path' => 'Emplacement du document "Erreur 500"', + 'errordocument401path' => 'Emplacement du document "Erreur 401"', + ], + 'ftp' => [ + 'description' => 'Ici, vous pouvez ajouter des accès FTP supplémentaires.
Les changements, ainsi que l\'accès, sont immédiatement opérationnels.', + 'account_add' => 'Ajouter un accès', + ], + 'index' => [ + 'customerdetails' => 'Informations personnelles', + 'accountdetails' => 'Informations du compte', + ], + 'logger' => [ + 'date' => 'Date', + 'type' => 'Type', + 'action' => 'Action', + 'user' => 'Utilisateur', + 'truncate' => 'Vider les logs', + ], + 'login' => [ + 'username' => 'Identifiant', + 'password' => 'Mot de passe', + 'language' => 'Langue', + 'login' => 'Se connecter', + 'logout' => 'Se déconnecter', + 'profile_lng' => 'Langue du profil', + 'forgotpwd' => 'Mot de passe oublié ?', + 'presend' => 'Réinitialiser le mot de passe', + 'email' => 'Adresse e-mail', + 'remind' => 'Réinitialiser mon mot de passe', + 'usernotfound' => 'Erreur : utilisateur inconnu !', + ], + 'mails' => [ + 'pop_success' => [ + 'mailbody' => 'Bonjour,\\n\\nvotre accès POP3 / IMAP {EMAIL}\\na été créé avec succès.\\n\\nCeci est un e-mail généré automatiquement, veuillez ne pas répondre à ce message.\\n\\nCordialement,\\nL\'équipe Froxlor\\nhttp://www.froxlor.org', + 'subject' => 'Accès POP3 / IMAP créé', + ], + 'createcustomer' => [ + 'mailbody' => 'Bonjour {FIRSTNAME} {NAME},\\n\\nVous trouverez ci-dessous vos informations d\'accès au panel d\'administration :\\n\\nAdresse d\'administration : http://demo.froxlor.org\\n\\nIdentifiant : {USERNAME}\\nMot de passe : {PASSWORD}\\n\\nCordialement,\\nL\'équipe Froxlor\\nhttp://www.froxlor.org\\n', + 'subject' => 'Froxlor : Informations pour votre accès au panel d\'administration', + ], + 'pop_success_alternative' => [ + 'mailbody' => 'Bonjour,\\n\\nVotre compte e-mail {EMAIL} a été correctement créé.\\n\\nVotre mot de passe est : {PASSWORD}.\\n\\nCeci est un message généré automatiquemenent, veuillez ne pas répondre à cet e-mail car il ne serait être consulter.\\n\\nCordialement,\\nL\'équipe Froxlor.', + 'subject' => 'Compte e-mail correctement créé', + ], + 'password_reset' => [ + 'subject' => 'réinitialisation du mot de passe', + 'mailbody' => 'Bonjour {USERNAME},\\n\\nVotre mot de passe pour Froxlor a été réinitialiser !\\nLe nouveau mot de passe est : {LINK}\\n\\nCordialement,\\nL\'équipe Froxlor.', + ], + ], + 'menu' => [ + 'message' => 'Messages', + ], + 'menue' => [ + 'main' => [ + 'main' => 'Général', + 'changepassword' => 'Changer de mot de passe', + 'changelanguage' => 'Changer de langue', + 'username' => 'Utilisateur : ', + ], + 'email' => [ + 'email' => 'E-mail', + 'emails' => 'Adresse(s) e-mail(s)', + 'webmail' => 'Webmail', + ], + 'mysql' => [ + 'mysql' => 'MySQL', + 'databases' => 'Bases de données', + 'phpmyadmin' => 'phpMyAdmin', + ], + 'domains' => [ + 'domains' => 'Domaines', + 'settings' => 'Paramétres des sites', + ], + 'ftp' => [ + 'ftp' => 'FTP', + 'accounts' => 'Comptes d\'accès FTP', + 'webftp' => 'WebFTP', + ], + 'extras' => [ + 'extras' => 'Extras', + 'directoryprotection' => 'Protection des dossiers', + 'pathoptions' => 'Options des dossiers', + ], + 'traffic' => [ + 'traffic' => 'Trafic', + 'current' => 'Mois actuel', + ], + ], + 'message' => [ + 'norecipients' => 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données', + ], + 'mysql' => [ + 'databasename' => 'Nom de la base de données', + 'databasedescription' => 'Description de la base de données', + 'database_create' => 'Ajouter une base de données', + 'description' => 'Ici, vous pouvez ajouter et effacer des bases de données MySQL.
Les changements, ainsi que les bases de données, sont immédiatement opérationnels.
Dans le menu, vous trouverez un lien vers phpMyAdmin, avec lequel vous pouvez gérer vos bases de données.

L\'accès aux bases de données depuis les scripts PHP fonctionne comme suit : (Il faut remplacer les valeurs en italique par vos informations !)

$connexion = mysql_connect(\'localhost\', \'Votre identifiant\', \'Votre mot de passe\');
mysql_select_db(\'Le nom de la base de données\', $connexion);', + ], + 'panel' => [ + 'edit' => 'Modifier', + 'delete' => 'Supprimer', + 'create' => 'Ajouter', + 'save' => 'Sauvegarder', + 'yes' => 'Oui', + 'no' => 'Non', + 'emptyfornochanges' => 'Laissez vide pour ne pas modifier', + 'emptyfordefault' => 'Laissez vide pour l\'option standard', + 'path' => 'Dossier', + 'toggle' => 'Activer / Désactiver', + 'next' => 'continuer', + 'dirsmissing' => 'Dossiers non disponibles ou illisibles', + 'urloverridespath' => 'URL (supplante la valeur dossier)', + 'pathorurl' => 'Dossier ou URL', + 'ascending' => 'ascendant', + 'descending' => 'descendant', + 'search' => 'Rechercher', + 'used' => 'utilisé', + 'translator' => 'Traducteur(s)', + 'reset' => 'Ignorer les changements', + 'pathDescription' => 'Si le dossier n\'existe pas, il sera créé automatiquement.', + 'back' => 'Retour', + 'reseller' => 'revendeur', + 'admin' => 'administrateur', + 'customer' => 'client(s)', + 'send' => 'envoyé', + 'nosslipsavailable' => 'Il n\'y a actuellement aucune combinaison IP / Port configurer pour SSL', + 'backtooverview' => 'Retour à l\'aperçu', + 'dateformat' => 'YYYY-MM-DD', + 'dateformat_function' => 'Y-m-d', + 'timeformat_function' => 'H:i:s', + 'default' => 'Par défaut', + 'never' => 'Jamais', + 'active' => 'Actif', + 'please_choose' => 'Veuillez choisir', + ], + 'pwdreminder' => [ + 'success' => 'Mot de passe correctement réinitialiser.
Vous devriez recevoir un e-mail avec votre nouveau mot de passe d\'ici quelques minutes.', + 'notallowed' => 'La réinitialisation des mots de passe est désactivée.', + ], + 'question' => [ + 'question' => 'Question de sécurité', + 'admin_customer_reallydelete' => 'Etes-vous sûr de vouloir supprimer le compte "%s" ?
ATTENTION ! Toutes ses informations seront supprimées ! Une fois fait, il vous appartiendra de supprimer manuellement tous les dossiers du compte sur le système de fichiers.', + 'admin_domain_reallydelete' => 'Etes-vous sûr de vouloir supprimer le domaine "%s" ?', + 'admin_domain_reallydisablesecuritysetting' => 'Etes-vous sûr de vouloir désactiver les modes de sécurité suivants : OpenBasedir et / oû SafeMode ?', + 'admin_admin_reallydelete' => 'Etes-vous sûr de vouloir supprimer l\'administrateur "%s" ?
Tous ses comptes seront affectés à l\'administrateur principal.', + 'admin_template_reallydelete' => 'Etes-vous sûr de vouloir supprimer le modèle "%s" ?', + 'domains_reallydelete' => 'Etes-vous sûr de vouloir supprimer le domaine "%s" ?', + 'email_reallydelete' => 'Etes-vous sûr de vouloir supprimer l\'adresse e-mail "%s" ? ', + 'email_reallydelete_account' => 'Etes-vous sûr de vouloir supprimer l\'accès e-mail "%s" ?', + 'email_reallydelete_forwarder' => 'Etes-vous sûr de vouloir supprimer le renvoi vers "%s" ?', + 'extras_reallydelete' => 'Etes-vous sûr de vouloir supprimer la protection du dossier "%s" ?', + 'extras_reallydelete_pathoptions' => 'Etes-vous sûr de vouloir supprimer les options du dossier "%s" ?', + 'ftp_reallydelete' => 'Etes-vous sûr de vouloir supprimer l\'accès ftp "%s" ?', + 'mysql_reallydelete' => 'Etes-vous sûr de vouloir supprimer la base de données "%s" ?
ATTENTION : Toutes les données seront perdues à jamais !', + 'admin_configs_reallyrebuild' => 'Etes-vous sûr de vouloir régénérer les fichiers de configuration Apache et Bind ?', + 'admin_ip_reallydelete' => 'Etes-vous sûr de vouloir supprimer l\'adresse IP "%s" ?', + 'admin_domain_reallydocrootoutofcustomerroot' => 'Etes-vous sûr de vouloir différencier la racine principale de ce domaine de la racine principale du client ?', + 'admin_counters_reallyupdate' => 'Etes-vous sûr de vouloir recalculer les ressources utilisées ?', + 'admin_cleartextmailpws_reallywipe' => 'Etes-vous sûr de vouloir retirer tous les mots de passe en clairs des comptes e-mails de la table mail_users ? Cette action ne peut être annulée !', + 'logger_reallytruncate' => 'Etes-vous sûr de vouloir vider la table "%s" ?', + 'admin_quotas_reallywipe' => 'Etes-vous sûr de vouloir retirer tous les quotas de la table mail_users ? Cette action ne peut être annulée !', + ], + 'serversettings' => [ + 'session_timeout' => [ + 'title' => 'Durée d\'inactivité maximale', + 'description' => 'Combien de secondes d\'inactivité avant qu\'une session ne se ferme ?', + ], + 'accountprefix' => [ + 'title' => 'Préfix des comptes', + 'description' => 'Quel préfix doivent avoir les comptes ?', + ], + 'mysqlprefix' => [ + 'title' => 'Préfix SQL', + 'description' => 'Quel préfix doivent avoir les bases de données ?', + ], + 'ftpprefix' => [ + 'title' => 'Préfix FTP', + 'description' => 'Quel préfix doivent avoir les accès FTP ?', + ], + 'documentroot_prefix' => [ + 'title' => 'Dossier de stockage', + 'description' => 'Oû doivent être stockés tous les dossiers et fichiers des différents comptes ?', + ], + 'logfiles_directory' => [ + 'title' => 'Dossier des fichiers de log', + 'description' => 'Oû doivent être stockés les archives des logs d\'accès du serveur Web ?', + ], + 'ipaddress' => [ + 'title' => 'Adresse IP', + 'description' => 'Quelle est l\'adresse IP du serveur ?', + ], + 'hostname' => [ + 'title' => 'Nom d\'hôte', + 'description' => 'Quel est le nom d\'hôte (hostname) du serveur ?', + ], + 'apachereload_command' => [ + 'title' => 'Commande de rechargement d\'Apache', + 'description' => 'Quelle est la commande pour recharger / redémarrer Apache ?', + ], + 'bindconf_directory' => [ + 'title' => 'Emplacement du dossier de configuration de Bind / Named', + 'description' => 'Oû doit être stocké la configuration de Bind / Named ?', + ], + 'bindreload_command' => [ + 'title' => 'Commande de rechargement de Bind / Named', + 'description' => 'Quelle est la commande pour recharger / redémarrer Bind / Named ?', + ], + 'vmail_uid' => [ + 'title' => 'UID des e-mails', + 'description' => 'Quel UID doivent avoir les e-mails ?', + ], + 'vmail_gid' => [ + 'title' => 'GID des e-mails', + 'description' => 'Quel GID doivent avoir les e-mails ?', + ], + 'vmail_homedir' => [ + 'title' => 'Emplacement des e-mails', + 'description' => 'Dans quel dossier doivent être stocker les e-mails ?', + ], + 'adminmail' => [ + 'title' => 'Adresse e-mail de l\'administrateur', + 'description' => 'Quelle est l\'adresse e-mail par défaut des e-mails envoyés par Froxlor ?', + ], + 'phpmyadmin_url' => [ + 'title' => 'Adresse URL de phpMyAdmin', + 'description' => 'A quelle adresse se trouve phpMyAdmin ?', + ], + 'webmail_url' => [ + 'title' => 'Adresse URL du WebMail', + 'description' => 'A quelle adresse se trouve le WebMail ?', + ], + 'webftp_url' => [ + 'title' => 'Adresse URL du WebFTP', + 'description' => 'A quelle adresse se trouve le WebFTP ?', + ], + 'language' => [ + 'description' => 'Quelle langue est la langue par défaut ?', + ], + 'maxloginattempts' => [ + 'title' => 'Nombre d\'essais maximum avant désactivation', + 'description' => 'Nombre de tentatives maximum avant la désactivation de l\'accès.', + ], + 'deactivatetime' => [ + 'title' => 'Durée de la désactivation', + 'description' => 'Durée (en secondes) pendant laquelle l\'accès sera désactivé.', + ], + 'pathedit' => [ + 'title' => 'Mode de sélection des dossiers', + 'description' => 'Choisir un dossier par une liste déroulante ou l\'entrer manuellement ?', + ], + 'nameservers' => [ + 'title' => 'Serveurs de nom «Nameservers»', + 'description' => 'Une liste séparée par des virgules contenant les noms d\'hôtes de tous les serveurs de noms. Le premier dans la liste sera le serveur primaire.', + ], + 'mxservers' => [ + 'title' => 'Serveurs de messagerie «MX»', + 'description' => 'Une liste séparée par des virgules contenant les serveurs de messagerie avec leur poid : un nombre et le nom d\'hôte séparé par un espace; par exemple : "10 mx.exemple.com".', + ], + 'paging' => [ + 'title' => 'Nombre de résultats par page', + 'description' => 'Nombre de résultats par page ? (0 = Désactive la pagination)', + ], + 'defaultip' => [ + 'title' => 'IP / Port par défaut', + 'description' => 'Quel est l\'IP / Port par défaut ?', + ], + 'phpappendopenbasedir' => [ + 'title' => 'Dossier(s) de l\'OpenBasedir', + 'description' => 'Liste de dossiers séparée par des virgules qui sera ajouté à la variable "OpenBasedir" des conteneurs vHosts.', + ], + 'natsorting' => [ + 'title' => 'Utiliser un tri naturel dans les différentes vues', + 'description' => 'Trier les listes comme web1 -> web2 -> etc ... -> web11 au lieu de web1 -> web11 -> web2.', + ], + 'deactivateddocroot' => [ + 'title' => 'Dossier "DocumentRoot" pour les utilisateurs désactivés', + 'description' => 'Quand un utilisateur est désactivé, ce dossier sera utilisé comme dossier racine pour le serveur Web. Laissez vide pour ne pas créer de vHost et ne rien afficher du tout lorsque l\'utilisateur est désactivé.', + ], + 'mailpwcleartext' => [ + 'title' => 'Sauvegarder aussi les mots de passe des comptes e-mails de façon décrypter dans la base de données', + 'description' => 'Si cela est à Oui, tous les mots de passe seront aussi sauvegarder de façon décrypter dans la table mail_users (en texte clair pour toutes personnes qui auraient accès à la base de données). Activer cette option, uniquement si vous en avez vraiment besoin !', + 'removelink' => 'Cliquez ici pour retirer tous les mots de passe en texte clair de la base de données.', + ], + 'ftpdomain' => [ + 'title' => 'Comptes FTP @domaine', + 'description' => 'Les utilisateurs peuvent-ils créer des comptes FTP de la forme utilisateur@domaine.com ?', + ], + 'mod_fcgid' => [ + 'title' => 'Utiliser PHP par mod_fcgid / suexec', + 'description' => 'Utiliser mod_fcgid / suexec / libnss_mysql pour lancer PHP avec le compte correspondant à l\'utilisateur ?
Cela à besoin d\'une configuration spécifique d\'Apache !', + 'configdir' => [ + 'title' => 'Dossier de configuration FCGI', + 'description' => 'Oû doivent être stockés les fichiers de configuration pour FCGI ?', + ], + 'tmpdir' => [ + 'title' => 'Dossier temporaire pour FCGI', + ], + ], + 'sendalternativemail' => [ + 'title' => 'Utiliser une adresse e-mail alternative', + 'description' => 'Envoyer le mot de passe du compte e-mail à une adresse différents pour la création du compte e-mail ?', + ], + 'apacheconf_vhost' => [ + 'title' => 'Dossier / fichier de configuration des vHosts pour Apache', + 'description' => 'Oû doit être stocké le fichier de configuration des vHosts ? Vous pouvez soit entrer le nom d\'un fichier (tous les vHosts dans un seul fichier), soit le nom d\'un dossier (chacun des vHosts dans un fichier séparé du dossier).', + ], + 'apacheconf_diroptions' => [ + 'title' => 'Fichier / dossier de configuration des options des dossiers pour Apache', + 'description' => 'Oû doit être stocké le fichier de configuration des options de dossiers ? Vous pouvez soit entrer le nom d\'un fichier (toutes les options des dossiers dans un seul fichier), soit le nom d\'un dossier (chacune des options de dossier dans un fichier séparé du dossier).', + ], + 'apacheconf_htpasswddir' => [ + 'title' => 'Dossier du fichier htpasswd pour Apache', + 'description' => 'Oû doit être stocké le fichier de configuration de protection des dossiers "htpasswd" pour Apache ?', + ], + 'mysql_access_host' => [ + 'title' => 'Hôtes de connexion MySQL', + 'description' => 'Une liste séparée par des virgules contenant la liste des hôtes depuis lesquels les utilisateurs sont autorisés à se connecter au serveur MySQL.', + ], + 'webalizer_quiet' => [ + 'title' => 'Sortie Webalizer', + 'description' => 'Verbosité du programme Webalizer', + ], + 'logger' => [ + 'enable' => 'Activer / Désactiver les logs', + 'severity' => 'Niveau de log', + 'types' => [ + 'title' => 'Type(s) de log', + 'description' => 'Spécifiez les types de log séparés par des virgules.
Les types de log disponible sont : syslog, file, mysql', + ], + 'logfile' => 'Nom du fichier de log, dossier + nom du fichier', + 'logcron' => 'Loguer les travaux de cron', + 'logcronoption' => [ + 'never' => 'Jamais', + 'once' => 'Une fois', + 'always' => 'Toujours', + ], + ], + 'ssl' => [ + 'openssl_cnf' => 'Paramètres par défaut pour créer le certificat', + ], + 'default_vhostconf' => [ + 'title' => 'Paramètres par défaut pour les vHosts', + ], + 'mail_quota' => [ + 'title' => 'Quota de la boîte aux lettres', + 'description' => 'Quota par défaut pour toutes nouvelles boîtes aux lettres créées.', + ], + 'mail_quota_enabled' => [ + 'title' => 'Utiliser les quotas de boîtes aux lettres pour les clients', + 'description' => 'Activez cette option pour utiliser les quotas sur les boîtes aux lettres. Par défaut, cette option est à Non car cela requiert une configuration spécifique.', + 'removelink' => 'Cliquez ici pour retirer tous les quotas de tous les comptes e-mails.', + ], + 'decimal_places' => 'Nombre de décimales à afficher pour le trafic / espace web', + 'webalizer_enabled' => 'Activer les statistiques Webalizer', + 'awstats_enabled' => 'Activer les statistiques AWStats', + 'selfdns' => [ + 'title' => 'Paramètres manuel des DNS du domaine', + ], + 'selfdnscustomer' => [ + 'title' => 'Permettre aux clients de modifier les paramètes DNS du domaine', + ], + 'unix_names' => [ + 'title' => 'Utiliser des noms d\'utilisateurs compatible UNIX', + 'description' => 'Vous permet d\'utiliser les - et _ dans les noms d\'utilisateurs si l\'option est à Non', + ], + 'allow_password_reset' => [ + 'title' => 'Permettre aux clients de réinitialiser leurs mots de passe', + 'description' => 'Les clients peuvent réinitialiser leurs mots de passe et il sera envoyé à leurs propres adresses e-mails', + ], + 'allow_password_reset_admin' => [ + 'title' => 'Permettre la réinitialisation des mots de passe par les administrateurs', + 'description' => 'Les administrateurs / revendeurs peuvent réinitialiser leurs mots de passe et il sera envoyé à leurs propres adresses e-mails', + ], + ], + 'success' => [ + 'messages_success' => 'Le message a été envoyé aux destinataires "%s"', + ], + 'traffic' => [ + 'month' => 'Mois', + 'day' => 'Jour', + 'months' => [ + 1 => 'Janvier', + 2 => 'Février', + 3 => 'Mars', + 4 => 'Avril', + 5 => 'Mai', + 6 => 'Juin', + 7 => 'Juillet', + 8 => 'Août', + 9 => 'Septembre', + 10 => 'Octobre', + 11 => 'Novembre', + 12 => 'Décembre', + ], + 'mb' => 'Trafic (Mo)', + 'distribution' => 'FTP | HTTP | E-mail', + 'sumhttp' => 'Trafic HTTP total entrant', + 'sumftp' => 'Trafic FTP total entrant', + 'summail' => 'Trafic E-mail total entrant', + ], + 'translator' => 'Tim Zielosko, Aldo Reset, Romain MARIADASSOU', +]; diff --git a/lng/french.lng.php b/lng/french.lng.php deleted file mode 100644 index 4c401f56..00000000 --- a/lng/french.lng.php +++ /dev/null @@ -1,763 +0,0 @@ - - * @author Aldo Reset - * @author Romain MARIADASSOU - * @author Froxlor Team - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Some importants rules of typograhie in french : - * These signs << ! ? : " & >> must be be preceded by white space - * -> We can make the white space like that : <<   >> - * -> so the white space is still committed to the previous letter and punctuation mark as follows. - * These signs << . ; , ' >> should be glued to the previous letter - * These signs << / | = >> would be preceded and followed with a white as mush as possible, it is much clear from reading. - */ - -/** - * Global - */ -$lng['translator'] = 'Tim Zielosko, Aldo Reset, Romain MARIADASSOU'; -$lng['panel']['edit'] = 'Modifier'; -$lng['panel']['delete'] = 'Supprimer'; -$lng['panel']['create'] = 'Ajouter'; -$lng['panel']['save'] = 'Sauvegarder'; -$lng['panel']['yes'] = 'Oui'; -$lng['panel']['no'] = 'Non'; -$lng['panel']['emptyfornochanges'] = 'Laissez vide pour ne pas modifier'; -$lng['panel']['emptyfordefault'] = 'Laissez vide pour l\'option standard'; -$lng['panel']['path'] = 'Dossier'; -$lng['panel']['toggle'] = 'Activer / Désactiver'; -$lng['panel']['next'] = 'continuer'; -$lng['panel']['dirsmissing'] = 'Dossiers non disponibles ou illisibles'; - -/** - * Login - */ - -$lng['login']['username'] = 'Identifiant'; -$lng['login']['password'] = 'Mot de passe'; -$lng['login']['language'] = 'Langue'; -$lng['login']['login'] = 'Se connecter'; -$lng['login']['logout'] = 'Se déconnecter'; -$lng['login']['profile_lng'] = 'Langue du profil'; - -/** - * Customer - */ - -$lng['customer']['documentroot'] = 'Chemin'; -$lng['customer']['name'] = 'Nom'; -$lng['customer']['firstname'] = 'Prénom'; -$lng['customer']['company'] = 'Entreprise'; -$lng['customer']['street'] = 'Rue'; -$lng['customer']['zipcode'] = 'Code postal'; -$lng['customer']['city'] = 'Ville'; -$lng['customer']['phone'] = 'Téléphone'; -$lng['customer']['fax'] = 'Fax'; -$lng['customer']['email'] = 'E-mail'; -$lng['customer']['customernumber'] = 'Numéro du client'; -$lng['customer']['diskspace'] = 'Espace Web (Mo)'; -$lng['customer']['traffic'] = 'Trafic (Go)'; -$lng['customer']['mysqls'] = 'Base(s) de données MySQL'; -$lng['customer']['emails'] = 'Adresse(s) e-mail'; -$lng['customer']['accounts'] = 'Accès e-mail'; -$lng['customer']['forwarders'] = 'Transfert(s) e-mail'; -$lng['customer']['ftps'] = 'Accès FTP'; -$lng['customer']['subdomains'] = 'Sous-domaine(s)'; -$lng['customer']['domains'] = 'Domaine(s)'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Général'; -$lng['menue']['main']['changepassword'] = 'Changer de mot de passe'; -$lng['menue']['main']['changelanguage'] = 'Changer de langue'; -$lng['menue']['email']['email'] = 'E-mail'; -$lng['menue']['email']['emails'] = 'Adresse(s) e-mail(s)'; -$lng['menue']['email']['webmail'] = 'Webmail'; -$lng['menue']['mysql']['mysql'] = 'MySQL'; -$lng['menue']['mysql']['databases'] = 'Bases de données'; -$lng['menue']['mysql']['phpmyadmin'] = 'phpMyAdmin'; -$lng['menue']['domains']['domains'] = 'Domaines'; -$lng['menue']['domains']['settings'] = 'Paramétres des sites'; -$lng['menue']['ftp']['ftp'] = 'FTP'; -$lng['menue']['ftp']['accounts'] = 'Comptes d\'accès FTP'; -$lng['menue']['ftp']['webftp'] = 'WebFTP'; -$lng['menue']['extras']['extras'] = 'Extras'; -$lng['menue']['extras']['directoryprotection'] = 'Protection des dossiers'; -$lng['menue']['extras']['pathoptions'] = 'Options des dossiers'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Informations personnelles'; -$lng['index']['accountdetails'] = 'Informations du compte'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Ancien mot de passe'; -$lng['changepassword']['new_password'] = 'Nouveau mot de passe'; -$lng['changepassword']['new_password_confirm'] = 'Nouveau mot de passe (confirmation)'; -$lng['changepassword']['new_password_ifnotempty'] = 'Nouveau mot de passe (Veuillez laisser vide pour ne pas changer)'; -$lng['changepassword']['also_change_ftp'] = 'Changer aussi le mot de passe du compte FTP principal ?'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Ici, vous pouvez ajouter des sites et domaines et changer leurs doosiers.
Il vous faudra patienter quelques minutes après chaque changement pour que la configuration soit activée.'; -$lng['domains']['domainsettings'] = 'Configuration des Domaines'; -$lng['domains']['domainname'] = 'Nom du Domaine'; -$lng['domains']['subdomain_add'] = 'Ajouter un sous-domaine'; -$lng['domains']['subdomain_edit'] = 'Changer un sous-domaine'; -$lng['domains']['wildcarddomain'] = 'Domaine générique (Wilcard) ?'; -$lng['domains']['aliasdomain'] = 'Alias pour le domaine'; -$lng['domains']['noaliasdomain'] = 'Domaine sans alias'; - -/** - * E-mails - */ - -$lng['emails']['description'] = 'Ici, vous pouvez ajouter vos boîtes e-mails.

Les informations pour configurer votre logiciel e-mail sont les suivantes :

Nom du serveur : votre-domaine.com
Identifiant : l\'adresse e-mail
Mot de passe : le mot de passe que vous avez choisi'; -$lng['emails']['emailaddress'] = 'Adresse'; -$lng['emails']['emails_add'] = 'Ajouter une adresse e-mail'; -$lng['emails']['emails_edit'] = 'Changer une adresse e-mail'; -$lng['emails']['catchall'] = 'Catchall'; -$lng['emails']['iscatchall'] = 'Définir comme adresse "catchall" ?'; -$lng['emails']['account'] = 'Accès'; -$lng['emails']['account_add'] = 'Ajouter un accès'; -$lng['emails']['account_delete'] = 'Supprimer l\'accès'; -$lng['emails']['from'] = 'de'; -$lng['emails']['to'] = 'à'; -$lng['emails']['forwarders'] = 'Réexpédition'; -$lng['emails']['forwarder_add'] = 'Ajouter un renvoi'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Ici, vous pouvez ajouter des accès FTP supplémentaires.
Les changements, ainsi que l\'accès, sont immédiatement opérationnels.'; -$lng['ftp']['account_add'] = 'Ajouter un accès'; - -/** - * MySQL - */ - -$lng['mysql']['databasename'] = 'Nom de la base de données'; -$lng['mysql']['databasedescription'] = 'Description de la base de données'; -$lng['mysql']['database_create'] = 'Ajouter une base de données'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Ici, vous pouvez ajouter des extras, comme par exemple, la protection de dossiers du site.
Il vous faudra patienter quelques minutes après chaque changement pour que la configuration soit activée.'; -$lng['extras']['directoryprotection_add'] = 'Ajouter une protection de dossier'; -$lng['extras']['view_directory'] = 'Aperçu du dossier'; -$lng['extras']['pathoptions_add'] = 'Ajouter des options sur le dossier'; -$lng['extras']['directory_browsing'] = 'Afficher le contenu des dossiers'; -$lng['extras']['pathoptions_edit'] = 'Modifier les options de dossier'; -$lng['extras']['errordocument404path'] = 'Emplacement du document "Erreur 404"'; -$lng['extras']['errordocument403path'] = 'Emplacement du document "Erreur 403"'; -$lng['extras']['errordocument500path'] = 'Emplacement du document "Erreur 500"'; -$lng['extras']['errordocument401path'] = 'Emplacement du document "Erreur 401"'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Erreur'; -$lng['error']['directorymustexist'] = 'Le dossier que vous avez choisi n\'existe pas. Veuillez ajouter le dossier avec votre client FTP.'; -$lng['error']['filemustexist'] = 'Le fichier que vous avez sélectionné n\'existe pas.'; -$lng['error']['allresourcesused'] = 'Vous avez déjà utilisé toutes les ressources.'; -$lng['error']['domains_cantdeletemaindomain'] = 'Vous ne pouvez pas supprimer un domaine qui est utilisé pour des adresses e-mails.'; -$lng['error']['domains_canteditdomain'] = 'Vous n\'avez pas le droit de configurer ce domaine.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'Vous ne pouvez pas supprimer un domaine qui est utilisé pour des e-mails. Vous devez d\'abord supprimer toutes les adresses e-mails qu\'il contient.'; -$lng['error']['firstdeleteallsubdomains'] = 'Il faut d\'abord supprimer tous les sous-domaines avant d\'ajouter un domaine "wildcard".'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'Vous avez déjà défini une adresse "catchall" pour ce domaine.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'Vous ne pouvez pas supprimer votre accès principal.'; -$lng['error']['login'] = 'Identifiant / mot de passe invalide.'; -$lng['error']['login_blocked'] = 'Cet identifiant a été bloqué à cause de nombreuses tentatives de connexions invalides.
Veuillez réessayer dans %s secondes.'; -$lng['error']['notallreqfieldsorerrors'] = 'Vous n\'avez pas rempli toutes les cases obligatoires ou vous les avez remplis avec des informations invalides.'; -$lng['error']['oldpasswordnotcorrect'] = 'L\'ancien mot de passe n\'est pas correct.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'Vous ne pouvez pas distribuer plus de ressources qu\'il n\'en reste.'; -$lng['error']['mustbeurl'] = 'Vous n\'avez pas entré une adresse URL valide.'; -$lng['error']['invalidpath'] = 'Vous n\'avez pas choisi une adresse URL valide (probablement à cause de problèmes avec le listing de dossiers ?)'; -$lng['error']['stringisempty'] = 'Entrée manquante'; -$lng['error']['stringiswrong'] = 'Entrée invalide'; -$lng['error']['newpasswordconfirmerror'] = 'Le nouveau mot de passe et sa confirmation ne sont pas identiques pas.'; -$lng['error']['mydomain'] = '"domaine"'; -$lng['error']['loginnameexists'] = 'L\'identifiant "%s" existe déjà.'; -$lng['error']['emailiswrong'] = 'L\'adresse "%s" contient des signes invalides ou est incomplète.'; -$lng['error']['loginnameiswrong'] = 'L\'identifiant "%s" contient des signes invalides.'; -$lng['error']['userpathcombinationdupe'] = 'Cette combinaison d\'identifiant et de dossier existe déjà.'; -$lng['error']['patherror'] = 'Erreur générale ! Le dossier ne doit pas être vide.'; -$lng['error']['errordocpathdupe'] = 'Il y a déjà une option concernant le dossier "%s".'; -$lng['error']['adduserfirst'] = 'Vous devez d\'abord ajouter un.'; -$lng['error']['domainalreadyexists'] = 'Le domaine "%s" existe déjà.'; -$lng['error']['nolanguageselect'] = 'Aucune langue choisis.'; -$lng['error']['nosubjectcreate'] = 'Il faut entrer un sujet.'; -$lng['error']['nomailbodycreate'] = 'Il faut entrer un corps de texte.'; -$lng['error']['templatenotfound'] = 'Aucun modèle trouvé.'; -$lng['error']['alltemplatesdefined'] = 'Vous avez déjà appliqué des modèles pour toutes les langues.'; -$lng['error']['wwwnotallowed'] = 'Un sous-domaine ne peut pas s\'appeler www.'; -$lng['error']['subdomainiswrong'] = 'Le sous-domaine "%s" contient des signes invalides.'; -$lng['error']['domaincantbeempty'] = 'Le nom de domaine ne doit pas être vide.'; -$lng['error']['domainexistalready'] = 'Le domaine "%s" existe déjà.'; -$lng['error']['domainisaliasorothercustomer'] = 'L\'alias du domaine choisi est soit un alias existant d\'un autre client ou soit fait référence à lui même.'; -$lng['error']['emailexistalready'] = 'L\'adresse "%s" existe déjà.'; -$lng['error']['maindomainnonexist'] = 'Le domaine "%s" n\'existe pas.'; -$lng['error']['destinationnonexist'] = 'Veuillez écrire votre adresse de renvoi à l\'emplacement "à".'; -$lng['error']['destinationalreadyexistasmail'] = 'Le renvoi vers l\'adresse "%s" existe déjà comme adresse active.'; -$lng['error']['destinationalreadyexist'] = 'Il existe déjà une réexpédition vers l\'adresse "%s".'; -$lng['error']['destinationiswrong'] = 'L\'adresse "%s" contient des signes invalides ou est incomplète.'; -// $lng['error']['loginnameissystemaccount'] = 'Vous ne pouvez pas créer un compte identique au compte système, veuillez réessayer avec un autre nom.'; -$lng['error']['loginnameissystemaccount'] = 'Vous ne pouvez pas créer de compte ressemblant aux comptes système (ex : "%s"). Veuillez entrer un autre nom de compte.'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Question de sécurité'; -$lng['question']['admin_customer_reallydelete'] = 'Etes-vous sûr de vouloir supprimer le compte "%s" ?
ATTENTION ! Toutes ses informations seront supprimées ! Une fois fait, il vous appartiendra de supprimer manuellement tous les dossiers du compte sur le système de fichiers.'; -$lng['question']['admin_domain_reallydelete'] = 'Etes-vous sûr de vouloir supprimer le domaine "%s" ?'; -$lng['question']['admin_domain_reallydisablesecuritysetting'] = 'Etes-vous sûr de vouloir désactiver les modes de sécurité suivants : OpenBasedir et / oû SafeMode ?'; -$lng['question']['admin_admin_reallydelete'] = 'Etes-vous sûr de vouloir supprimer l\'administrateur "%s" ?
Tous ses comptes seront affectés à l\'administrateur principal.'; -$lng['question']['admin_template_reallydelete'] = 'Etes-vous sûr de vouloir supprimer le modèle "%s" ?'; -$lng['question']['domains_reallydelete'] = 'Etes-vous sûr de vouloir supprimer le domaine "%s" ?'; -$lng['question']['email_reallydelete'] = 'Etes-vous sûr de vouloir supprimer l\'adresse e-mail "%s" ? '; -$lng['question']['email_reallydelete_account'] = 'Etes-vous sûr de vouloir supprimer l\'accès e-mail "%s" ?'; -$lng['question']['email_reallydelete_forwarder'] = 'Etes-vous sûr de vouloir supprimer le renvoi vers "%s" ?'; -$lng['question']['extras_reallydelete'] = 'Etes-vous sûr de vouloir supprimer la protection du dossier "%s" ?'; -$lng['question']['extras_reallydelete_pathoptions'] = 'Etes-vous sûr de vouloir supprimer les options du dossier "%s" ?'; -$lng['question']['ftp_reallydelete'] = 'Etes-vous sûr de vouloir supprimer l\'accès ftp "%s" ?'; -$lng['question']['mysql_reallydelete'] = 'Etes-vous sûr de vouloir supprimer la base de données "%s" ?
ATTENTION : Toutes les données seront perdues à jamais !'; -$lng['question']['admin_configs_reallyrebuild'] = 'Etes-vous sûr de vouloir régénérer les fichiers de configuration Apache et Bind ?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['mailbody'] = 'Bonjour,\n\nvotre accès POP3 / IMAP {EMAIL}\na été créé avec succès.\n\nCeci est un e-mail généré automatiquement, veuillez ne pas répondre à ce message.\n\nCordialement,\nL\'équipe Froxlor\nhttp://www.froxlor.org'; -$lng['mails']['pop_success']['subject'] = 'Accès POP3 / IMAP créé'; -$lng['mails']['createcustomer']['mailbody'] = 'Bonjour {FIRSTNAME} {NAME},\n\nVous trouverez ci-dessous vos informations d\'accès au panel d\'administration :\n\nAdresse d\'administration : http://demo.froxlor.org\n\nIdentifiant : {USERNAME}\nMot de passe : {PASSWORD}\n\nCordialement,\nL\'équipe Froxlor\nhttp://www.froxlor.org\n'; -$lng['mails']['createcustomer']['subject'] = 'Froxlor : Informations pour votre accès au panel d\'administration'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Sommaire'; -$lng['admin']['ressourcedetails'] = 'Ressources utilisées'; -$lng['admin']['systemdetails'] = 'Informations du système'; -$lng['admin']['froxlordetails'] = 'Informations de Froxlor'; -$lng['admin']['installedversion'] = 'Version installée'; -$lng['admin']['latestversion'] = 'Dernière version en date'; -$lng['admin']['lookfornewversion']['clickhere'] = 'Vérifier par internet'; -$lng['admin']['lookfornewversion']['error'] = 'Erreur pour vérifier la dernière version'; -$lng['admin']['resources'] = 'Ressources'; -$lng['admin']['customer'] = 'Compte'; -$lng['admin']['customers'] = 'Comptes'; -$lng['admin']['customer_add'] = 'Ajouter un compte'; -$lng['admin']['customer_edit'] = 'Modifier un compte'; -$lng['admin']['domains'] = 'Domaines'; -$lng['admin']['domain_add'] = 'Ajouter un domaine'; -$lng['admin']['domain_edit'] = 'Modifier le domaine'; -$lng['admin']['subdomainforemail'] = 'Sous-domaines comme domaine e-mail'; -$lng['admin']['admin'] = 'Administrateur'; -$lng['admin']['admins'] = 'Administrateurs'; -$lng['admin']['admin_add'] = 'Ajouter un administrateur'; -$lng['admin']['admin_edit'] = 'Modifier un administrateur'; -$lng['admin']['customers_see_all'] = 'Peut voir tous les comptes ?'; -$lng['admin']['domains_see_all'] = 'Peut voir tous les Domaines ?'; -$lng['admin']['change_serversettings'] = 'Peut modifier la configuration du serveur ?'; -$lng['admin']['server'] = 'Système'; -$lng['admin']['serversettings'] = 'Paramètres'; -$lng['admin']['rebuildconf'] = 'Régénérer la configuration'; -$lng['admin']['stdsubdomain'] = 'Sous-domaine type'; -$lng['admin']['stdsubdomain_add'] = 'Ajouter un sous-domaine type'; -$lng['admin']['phpenabled'] = 'PHP activé'; -$lng['admin']['deactivated'] = 'Désactiver'; -$lng['admin']['deactivated_user'] = 'Désactiver l\'utilisateur'; -$lng['admin']['sendpassword'] = 'Envoyer le mot de passe'; -$lng['admin']['ownvhostsettings'] = 'Configuration spéciale du vHost'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Exemple de configuration'; -$lng['admin']['templates']['templates'] = 'Modèles'; -$lng['admin']['templates']['template_add'] = 'Ajouter un modèle'; -$lng['admin']['templates']['template_edit'] = 'Modifier un modèle'; -$lng['admin']['templates']['action'] = 'Action'; -$lng['admin']['templates']['email'] = 'E-mail'; -$lng['admin']['templates']['subject'] = 'Référence'; -$lng['admin']['templates']['mailbody'] = 'Texte de l\'e-mail'; -$lng['admin']['templates']['createcustomer'] = 'E-mail de bienvenue pour les nouveaux clients'; -$lng['admin']['templates']['pop_success'] = 'E-mail de bienvenue pour les nouveaux accès e-mail'; -$lng['admin']['templates']['template_replace_vars'] = 'Les variables qui seront remplacées dans le template :'; -$lng['admin']['templates']['FIRSTNAME'] = 'Sera remplacé par le prénom.'; -$lng['admin']['templates']['NAME'] = 'Sera remplacé par le nom.'; -$lng['admin']['templates']['USERNAME'] = 'Sera remplacé par le login.'; -$lng['admin']['templates']['PASSWORD'] = 'Sera remplacé par le mot de passe du client.'; -$lng['admin']['templates']['EMAIL'] = 'Sera remplacé par l\'accès e-mail.'; - -/** - * Serversettings - */ - -$lng['serversettings']['session_timeout']['title'] = 'Durée d\'inactivité maximale'; -$lng['serversettings']['session_timeout']['description'] = 'Combien de secondes d\'inactivité avant qu\'une session ne se ferme ?'; -$lng['serversettings']['accountprefix']['title'] = 'Préfix des comptes'; -$lng['serversettings']['accountprefix']['description'] = 'Quel préfix doivent avoir les comptes ?'; -$lng['serversettings']['mysqlprefix']['title'] = 'Préfix SQL'; -$lng['serversettings']['mysqlprefix']['description'] = 'Quel préfix doivent avoir les bases de données ?'; -$lng['serversettings']['ftpprefix']['title'] = 'Préfix FTP'; -$lng['serversettings']['ftpprefix']['description'] = 'Quel préfix doivent avoir les accès FTP ?'; -$lng['serversettings']['documentroot_prefix']['title'] = 'Dossier de stockage'; -$lng['serversettings']['documentroot_prefix']['description'] = 'Oû doivent être stockés tous les dossiers et fichiers des différents comptes ?'; -$lng['serversettings']['logfiles_directory']['title'] = 'Dossier des fichiers de log'; -$lng['serversettings']['logfiles_directory']['description'] = 'Oû doivent être stockés les archives des logs d\'accès du serveur Web ?'; -$lng['serversettings']['ipaddress']['title'] = 'Adresse IP'; -$lng['serversettings']['ipaddress']['description'] = 'Quelle est l\'adresse IP du serveur ?'; -$lng['serversettings']['hostname']['title'] = 'Nom d\'hôte'; -$lng['serversettings']['hostname']['description'] = 'Quel est le nom d\'hôte (hostname) du serveur ?'; -$lng['serversettings']['apachereload_command']['title'] = 'Commande de rechargement d\'Apache'; -$lng['serversettings']['apachereload_command']['description'] = 'Quelle est la commande pour recharger / redémarrer Apache ?'; -$lng['serversettings']['bindconf_directory']['title'] = 'Emplacement du dossier de configuration de Bind / Named'; -$lng['serversettings']['bindconf_directory']['description'] = 'Oû doit être stocké la configuration de Bind / Named ?'; -$lng['serversettings']['bindreload_command']['title'] = 'Commande de rechargement de Bind / Named'; -$lng['serversettings']['bindreload_command']['description'] = 'Quelle est la commande pour recharger / redémarrer Bind / Named ?'; -$lng['serversettings']['vmail_uid']['title'] = 'UID des e-mails'; -$lng['serversettings']['vmail_uid']['description'] = 'Quel UID doivent avoir les e-mails ?'; -$lng['serversettings']['vmail_gid']['title'] = 'GID des e-mails'; -$lng['serversettings']['vmail_gid']['description'] = 'Quel GID doivent avoir les e-mails ?'; -$lng['serversettings']['vmail_homedir']['title'] = 'Emplacement des e-mails'; -$lng['serversettings']['vmail_homedir']['description'] = 'Dans quel dossier doivent être stocker les e-mails ?'; -$lng['serversettings']['adminmail']['title'] = 'Adresse e-mail de l\'administrateur'; -$lng['serversettings']['adminmail']['description'] = 'Quelle est l\'adresse e-mail par défaut des e-mails envoyés par Froxlor ?'; -$lng['serversettings']['phpmyadmin_url']['title'] = 'Adresse URL de phpMyAdmin'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'A quelle adresse se trouve phpMyAdmin ?'; -$lng['serversettings']['webmail_url']['title'] = 'Adresse URL du WebMail'; -$lng['serversettings']['webmail_url']['description'] = 'A quelle adresse se trouve le WebMail ?'; -$lng['serversettings']['webftp_url']['title'] = 'Adresse URL du WebFTP'; -$lng['serversettings']['webftp_url']['description'] = 'A quelle adresse se trouve le WebFTP ?'; -$lng['serversettings']['language']['description'] = 'Quelle langue est la langue par défaut ?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Nombre d\'essais maximum avant désactivation'; -$lng['serversettings']['maxloginattempts']['description'] = 'Nombre de tentatives maximum avant la désactivation de l\'accès.'; -$lng['serversettings']['deactivatetime']['title'] = 'Durée de la désactivation'; -$lng['serversettings']['deactivatetime']['description'] = 'Durée (en secondes) pendant laquelle l\'accès sera désactivé.'; -$lng['serversettings']['pathedit']['title'] = 'Mode de sélection des dossiers'; -$lng['serversettings']['pathedit']['description'] = 'Choisir un dossier par une liste déroulante ou l\'entrer manuellement ?'; -$lng['serversettings']['nameservers']['title'] = 'Serveurs de nom «Nameservers»'; -$lng['serversettings']['nameservers']['description'] = 'Une liste séparée par des virgules contenant les noms d\'hôtes de tous les serveurs de noms. Le premier dans la liste sera le serveur primaire.'; -$lng['serversettings']['mxservers']['title'] = 'Serveurs de messagerie «MX»'; -$lng['serversettings']['mxservers']['description'] = 'Une liste séparée par des virgules contenant les serveurs de messagerie avec leur poid : un nombre et le nom d\'hôte séparé par un espace; par exemple : "10 mx.exemple.com".'; - -/** - * CHANGED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['mysql']['description'] = 'Ici, vous pouvez ajouter et effacer des bases de données MySQL.
Les changements, ainsi que les bases de données, sont immédiatement opérationnels.
Dans le menu, vous trouverez un lien vers phpMyAdmin, avec lequel vous pouvez gérer vos bases de données.

L\'accès aux bases de données depuis les scripts PHP fonctionne comme suit : (Il faut remplacer les valeurs en italique par vos informations !)

$connexion = mysql_connect(\'localhost\', \'Votre identifiant\', \'Votre mot de passe\');
mysql_select_db(\'Le nom de la base de données\', $connexion);'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['serversettings']['paging']['title'] = 'Nombre de résultats par page'; -$lng['serversettings']['paging']['description'] = 'Nombre de résultats par page ? (0 = Désactive la pagination)'; -$lng['error']['ipstillhasdomains'] = 'La combinaison IP / port est encore utilisée, veuillez réassigner le ou les domaines existant(s) avec cette adresse IP / port concerné(s) à une autre combinaison IP / port avant de supprimer celle-ci.'; -$lng['error']['cantdeletedefaultip'] = 'Vous ne pouvez pas supprimer cette combinaison IP / Port, veuillez d\'abord attribuer une autre combinaison IP / Port par défaut à ce revendeur avant de supprimer celle-ci.'; -$lng['error']['cantdeletesystemip'] = 'Vous ne pouvez pas créer, modifier ou supprimer l\'IP du système.'; -$lng['error']['myipdefault'] = 'Choissez une combinaison IP / port par défaut.'; -$lng['error']['myipnotdouble'] = 'Cette combinaison existe déjà'; -$lng['question']['admin_ip_reallydelete'] = 'Etes-vous sûr de vouloir supprimer l\'adresse IP "%s" ?'; -$lng['admin']['ipsandports']['ipsandports'] = 'IPs et ports'; -$lng['admin']['ipsandports']['add'] = 'Ajouter une IP / port'; -$lng['admin']['ipsandports']['edit'] = 'Modifier une IP / port'; - -// ADDED IN 1.2.13-rc3 - -$lng['error']['cantchangesystemip'] = 'Vous ne pouvez pas modifier l\'adresse IP du système, ni en ajouter de nouvelle.'; -$lng['question']['admin_domain_reallydocrootoutofcustomerroot'] = 'Etes-vous sûr de vouloir différencier la racine principale de ce domaine de la racine principale du client ?'; - -// ADDED IN 1.2.14-rc1 - -$lng['admin']['memorylimitdisabled'] = 'Désactivé'; -$lng['domain']['openbasedirpath'] = 'Dossier "OpenBasedir"'; -$lng['domain']['docroot'] = 'Identique au dossier ci-dessus'; -$lng['domain']['homedir'] = 'Dossier Principal'; -$lng['admin']['valuemandatory'] = 'Cette valeur est obligatoire'; -$lng['admin']['valuemandatorycompany'] = 'Vous devez indiquer au moins l\'une des 3 valeurs suivantes : "nom" ou "prénom" ou "entreprise"'; -$lng['menue']['main']['username'] = 'Utilisateur : '; -$lng['panel']['urloverridespath'] = 'URL (supplante la valeur dossier)'; -$lng['panel']['pathorurl'] = 'Dossier ou URL'; -$lng['error']['sessiontimeoutiswrong'] = 'Seule une valeur numérique pour le temps d\'inactivité est autorisée.'; -$lng['error']['maxloginattemptsiswrong'] = 'Seule une valeur numérique pour "nombre maximum de tentative de connexion" est autorisée.'; -$lng['error']['deactivatetimiswrong'] = 'Seule une valeur numérique pour la durée de désactivation est autorisée.'; -$lng['error']['accountprefixiswrong'] = 'Le "Préfixe client" n\'est pas valide.'; -$lng['error']['mysqlprefixiswrong'] = 'Le "Préfixe SQL" n\'est pas valide.'; -$lng['error']['ftpprefixiswrong'] = 'Le "Préfixe FTP" n\'est pas valide.'; -$lng['error']['ipiswrong'] = 'L\'"Adresse IP" n\'est pas valide.'; -$lng['error']['vmailuidiswrong'] = 'L\'"UID e-mail" est incorrect. Seul un UID numérique est autorisé.'; -$lng['error']['vmailgidiswrong'] = 'Le "GID e-mail" est incorrect. Seul un GID numérique est autorisé.'; -$lng['error']['adminmailiswrong'] = 'L\'adresse e-mail de l\'administrateur est incorrect. Seulement une adresse e-mail valide est autorisé.'; -$lng['error']['pagingiswrong'] = 'La valeur "Nombre de résultats page" est incorrecte. Seul une valeur numérique est autorisée.'; -$lng['error']['phpmyadminiswrong'] = 'Le lien pour phpMyAdmin n\'est pas valide.'; -$lng['error']['webmailiswrong'] = 'Le lien pour le WebMail n\'est pas valide.'; -$lng['error']['webftpiswrong'] = 'Le lien pour le WebFTP n\'est pas valide.'; -$lng['domains']['hasaliasdomains'] = 'Le domaine possède un ou des alias.'; -$lng['serversettings']['defaultip']['title'] = 'IP / Port par défaut'; -$lng['serversettings']['defaultip']['description'] = 'Quel est l\'IP / Port par défaut ?'; -$lng['domains']['statstics'] = 'Fréquentation'; -$lng['panel']['ascending'] = 'ascendant'; -$lng['panel']['descending'] = 'descendant'; -$lng['panel']['search'] = 'Rechercher'; -$lng['panel']['used'] = 'utilisé'; - -// ADDED IN 1.2.14-rc3 - -$lng['panel']['translator'] = 'Traducteur(s)'; - -// ADDED IN 1.2.14-rc4 - -$lng['error']['stringformaterror'] = 'La valeur pour "%s" n\'est pas dans un format reconnu.'; - -// ADDED IN 1.2.15-rc1 - -$lng['admin']['serversoftware'] = 'Logiciel Serveur'; -$lng['admin']['phpversion'] = 'Version de PHP'; -$lng['admin']['phpmemorylimit'] = 'Limite mémoire de PHP'; -$lng['admin']['mysqlserverversion'] = 'Version du serveur MySQL'; -$lng['admin']['mysqlclientversion'] = 'Version du client MySQL'; -$lng['admin']['webserverinterface'] = 'Interface Web'; -$lng['domains']['isassigneddomain'] = 'Le domaine est attribué'; -$lng['serversettings']['phpappendopenbasedir']['title'] = 'Dossier(s) de l\'OpenBasedir'; -$lng['serversettings']['phpappendopenbasedir']['description'] = 'Liste de dossiers séparée par des virgules qui sera ajouté à la variable "OpenBasedir" des conteneurs vHosts.'; - -// CHANGED IN 1.2.15-rc1 - -$lng['error']['youcantdeleteyourself'] = 'Vous ne pouvez pas supprimer votre propre compte pour des raisons évidente de sécurité ...'; -$lng['error']['youcanteditallfieldsofyourself'] = 'Note : Vous ne pouvez pas éditer tous les champs de votre propre compte pour des raisons de sécurité.'; - -// ADDED IN 1.2.16-svn1 - -$lng['serversettings']['natsorting']['title'] = 'Utiliser un tri naturel dans les différentes vues'; -$lng['serversettings']['natsorting']['description'] = 'Trier les listes comme web1 -> web2 -> etc ... -> web11 au lieu de web1 -> web11 -> web2.'; - -// ADDED IN 1.2.16-svn2 - -$lng['serversettings']['deactivateddocroot']['title'] = 'Dossier "DocumentRoot" pour les utilisateurs désactivés'; -$lng['serversettings']['deactivateddocroot']['description'] = 'Quand un utilisateur est désactivé, ce dossier sera utilisé comme dossier racine pour le serveur Web. Laissez vide pour ne pas créer de vHost et ne rien afficher du tout lorsque l\'utilisateur est désactivé.'; - -// ADDED IN 1.2.16-svn4 - -$lng['panel']['reset'] = 'Ignorer les changements'; -$lng['admin']['accountsettings'] = 'Paramètres du compte'; -$lng['admin']['panelsettings'] = 'Paramètres du panel'; -$lng['admin']['systemsettings'] = 'Paramètres du système'; -$lng['admin']['webserversettings'] = 'Paramètres du serveur Web'; -$lng['admin']['mailserversettings'] = 'Paramètres du serveur de Mail'; -$lng['admin']['nameserversettings'] = 'Paramètres du serveur de Noms'; -$lng['admin']['updatecounters'] = 'Recalculer les ressources utilisées'; -$lng['question']['admin_counters_reallyupdate'] = 'Etes-vous sûr de vouloir recalculer les ressources utilisées ?'; -$lng['panel']['pathDescription'] = 'Si le dossier n\'existe pas, il sera créé automatiquement.'; - -// ADDED IN 1.2.16-svn6 -$lng['admin']['templates']['TRAFFIC'] = 'Sera remplacé par le taux de trafic qui a été attribué à l\'utilisateur.'; -$lng['admin']['templates']['TRAFFICUSED'] = 'Sera remplacé par le taux de trafic qui a été consommé par l\'utilisateur.'; - -// ADDED IN 1.2.16-svn7 - -$lng['admin']['subcanemaildomain']['never'] = 'Jamais'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'A choisir, par défaut : non'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'A choisir, par défaut : oui'; -$lng['admin']['subcanemaildomain']['always'] = 'Toujours'; -$lng['changepassword']['also_change_webalizer'] = 'Changer aussi le mot de passe des statistiques Webalizer ?'; - -// ADDED IN 1.2.16-svn8 - -$lng['serversettings']['mailpwcleartext']['title'] = 'Sauvegarder aussi les mots de passe des comptes e-mails de façon décrypter dans la base de données'; -$lng['serversettings']['mailpwcleartext']['description'] = 'Si cela est à Oui, tous les mots de passe seront aussi sauvegarder de façon décrypter dans la table mail_users (en texte clair pour toutes personnes qui auraient accès à la base de données). Activer cette option, uniquement si vous en avez vraiment besoin !'; -$lng['serversettings']['mailpwcleartext']['removelink'] = 'Cliquez ici pour retirer tous les mots de passe en texte clair de la base de données.'; -$lng['question']['admin_cleartextmailpws_reallywipe'] = 'Etes-vous sûr de vouloir retirer tous les mots de passe en clairs des comptes e-mails de la table mail_users ? Cette action ne peut être annulée !'; -$lng['admin']['configfiles']['overview'] = 'Aperçu'; -$lng['admin']['configfiles']['wizard'] = 'Assistant'; -$lng['admin']['configfiles']['distribution'] = 'Distribution'; -$lng['admin']['configfiles']['service'] = 'Service'; -$lng['admin']['configfiles']['daemon'] = 'Démon'; -$lng['admin']['configfiles']['http'] = 'Serveur Web (HTTP)'; -$lng['admin']['configfiles']['dns'] = 'Serveur de Noms (DNS)'; -$lng['admin']['configfiles']['mail'] = 'Serveur de Mails (IMAP/POP3)'; -$lng['admin']['configfiles']['smtp'] = 'Serveur de Mails (SMTP)'; -$lng['admin']['configfiles']['ftp'] = 'Serveur FTP'; -$lng['admin']['configfiles']['etc'] = 'Autres (Système)'; -$lng['admin']['configfiles']['choosedistribution'] = '-- Choisissez une distribution --'; -$lng['admin']['configfiles']['chooseservice'] = '-- Choisissez un service --'; -$lng['admin']['configfiles']['choosedaemon'] = '-- Choisissez un démon --'; - -// ADDED IN 1.2.16-svn10 - -$lng['serversettings']['ftpdomain']['title'] = 'Comptes FTP @domaine'; -$lng['serversettings']['ftpdomain']['description'] = 'Les utilisateurs peuvent-ils créer des comptes FTP de la forme utilisateur@domaine.com ?'; -$lng['panel']['back'] = 'Retour'; - -// ADDED IN 1.2.16-svn12 - -$lng['serversettings']['mod_fcgid']['title'] = 'Utiliser PHP par mod_fcgid / suexec'; -$lng['serversettings']['mod_fcgid']['description'] = 'Utiliser mod_fcgid / suexec / libnss_mysql pour lancer PHP avec le compte correspondant à l\'utilisateur ?
Cela à besoin d\'une configuration spécifique d\'Apache !'; -$lng['serversettings']['sendalternativemail']['title'] = 'Utiliser une adresse e-mail alternative'; -$lng['serversettings']['sendalternativemail']['description'] = 'Envoyer le mot de passe du compte e-mail à une adresse différents pour la création du compte e-mail ?'; -$lng['emails']['alternative_emailaddress'] = 'Adresse e-mail alternative'; -$lng['mails']['pop_success_alternative']['mailbody'] = 'Bonjour,\n\nVotre compte e-mail {EMAIL} a été correctement créé.\n\nVotre mot de passe est : {PASSWORD}.\n\nCeci est un message généré automatiquemenent, veuillez ne pas répondre à cet e-mail car il ne serait être consulter.\n\nCordialement,\nL\'équipe Froxlor.'; -$lng['mails']['pop_success_alternative']['subject'] = 'Compte e-mail correctement créé'; -$lng['admin']['templates']['pop_success_alternative'] = 'Message de bienvenue envoyé à l\'adresse e-mail alternative pour les nouveaux comptes e-mails'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Remplacer par le mot de passe du compte POP3 / IMAP.'; - -// ADDED IN 1.2.16-svn13 - -$lng['error']['documentrootexists'] = 'Le dossier "%s" existe déjà pour cet utilisateur. Veuillez le supprimer / déplacer avant de réessayer l\'ajout de cet utilisateur.'; - -// ADDED IN 1.2.16-svn14 - -$lng['serversettings']['apacheconf_vhost']['title'] = 'Dossier / fichier de configuration des vHosts pour Apache'; -$lng['serversettings']['apacheconf_vhost']['description'] = 'Oû doit être stocké le fichier de configuration des vHosts ? Vous pouvez soit entrer le nom d\'un fichier (tous les vHosts dans un seul fichier), soit le nom d\'un dossier (chacun des vHosts dans un fichier séparé du dossier).'; -$lng['serversettings']['apacheconf_diroptions']['title'] = 'Fichier / dossier de configuration des options des dossiers pour Apache'; -$lng['serversettings']['apacheconf_diroptions']['description'] = 'Oû doit être stocké le fichier de configuration des options de dossiers ? Vous pouvez soit entrer le nom d\'un fichier (toutes les options des dossiers dans un seul fichier), soit le nom d\'un dossier (chacune des options de dossier dans un fichier séparé du dossier).'; -$lng['serversettings']['apacheconf_htpasswddir']['title'] = 'Dossier du fichier htpasswd pour Apache'; -$lng['serversettings']['apacheconf_htpasswddir']['description'] = 'Oû doit être stocké le fichier de configuration de protection des dossiers "htpasswd" pour Apache ?'; - -// ADDED IN 1.2.16-svn15 - -$lng['error']['formtokencompromised'] = 'La requète semble compromise. Pour des raisons de sécurité, vous avez été déconnecté.'; -$lng['serversettings']['mysql_access_host']['title'] = 'Hôtes de connexion MySQL'; -$lng['serversettings']['mysql_access_host']['description'] = 'Une liste séparée par des virgules contenant la liste des hôtes depuis lesquels les utilisateurs sont autorisés à se connecter au serveur MySQL.'; - -// ADDED IN 1.2.18-svn1 - -$lng['admin']['ipsandports']['create_listen_statement'] = 'Déclaration des ports d\'écoute'; -$lng['admin']['ipsandports']['create_namevirtualhost_statement'] = 'Déclaration des hôtes virtuels "NameVirtualHost"'; -$lng['admin']['ipsandports']['create_vhostcontainer'] = 'Déclaration des conteneurs virtuels "vHost"'; -$lng['admin']['ipsandports']['create_vhostcontainer_servername_statement'] = 'Déclaration des noms d\'hôtes "ServerName" dans les conteneurs virtuels "vHost"'; - -// ADDED IN 1.2.18-svn2 - -$lng['admin']['webalizersettings'] = 'Paramètres pour Webalizer'; -$lng['admin']['webalizer']['normal'] = 'Normal'; -$lng['admin']['webalizer']['quiet'] = 'Silencieux'; -$lng['admin']['webalizer']['veryquiet'] = 'Aucune sortie'; -$lng['serversettings']['webalizer_quiet']['title'] = 'Sortie Webalizer'; -$lng['serversettings']['webalizer_quiet']['description'] = 'Verbosité du programme Webalizer'; - -// ADDED IN 1.2.18-svn4 - -$lng['admin']['domain_nocustomeraddingavailable'] = 'Il n\'est acutellement pas possible d\'ajouter de domaines. Vous devez d\'abord ajouter un client.'; - -// ADDED IN 1.2.19-svn1 - -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Dossier de configuration FCGI'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Oû doivent être stockés les fichiers de configuration pour FCGI ?'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Dossier temporaire pour FCGI'; - -// ADDED IN 1.2.19-svn4 - -$lng['menue']['traffic']['traffic'] = 'Trafic'; -$lng['menue']['traffic']['current'] = 'Mois actuel'; -$lng['traffic']['month'] = 'Mois'; -$lng['traffic']['day'] = 'Jour'; -$lng['traffic']['months'][1] = 'Janvier'; -$lng['traffic']['months'][2] = 'Février'; -$lng['traffic']['months'][3] = 'Mars'; -$lng['traffic']['months'][4] = 'Avril'; -$lng['traffic']['months'][5] = 'Mai'; -$lng['traffic']['months'][6] = 'Juin'; -$lng['traffic']['months'][7] = 'Juillet'; -$lng['traffic']['months'][8] = 'Août'; -$lng['traffic']['months'][9] = 'Septembre'; -$lng['traffic']['months'][10] = 'Octobre'; -$lng['traffic']['months'][11] = 'Novembre'; -$lng['traffic']['months'][12] = 'Décembre'; -$lng['traffic']['mb'] = 'Trafic (Mo)'; -$lng['traffic']['distribution'] = 'FTP | HTTP | E-mail'; -$lng['traffic']['sumhttp'] = 'Trafic HTTP total entrant'; -$lng['traffic']['sumftp'] = 'Trafic FTP total entrant'; -$lng['traffic']['summail'] = 'Trafic E-mail total entrant'; - -// ADDED IN 1.2.19-svn6 - -$lng['admin']['loggersettings'] = 'Paramètres des logs'; -$lng['serversettings']['logger']['enable'] = 'Activer / Désactiver les logs'; -$lng['serversettings']['logger']['severity'] = 'Niveau de log'; -$lng['admin']['logger']['normal'] = 'normal'; -$lng['admin']['logger']['paranoid'] = 'paranoïaque'; -$lng['serversettings']['logger']['types']['title'] = 'Type(s) de log'; -$lng['serversettings']['logger']['types']['description'] = 'Spécifiez les types de log séparés par des virgules.
Les types de log disponible sont : syslog, file, mysql'; -$lng['serversettings']['logger']['logfile'] = 'Nom du fichier de log, dossier + nom du fichier'; -$lng['error']['logerror'] = 'Erreur log : %s'; -$lng['serversettings']['logger']['logcron'] = 'Loguer les travaux de cron'; -$lng['serversettings']['logger']['logcronoption']['never'] = 'Jamais'; -$lng['serversettings']['logger']['logcronoption']['once'] = 'Une fois'; -$lng['serversettings']['logger']['logcronoption']['always'] = 'Toujours'; -$lng['question']['logger_reallytruncate'] = 'Etes-vous sûr de vouloir vider la table "%s" ?'; -$lng['admin']['loggersystem'] = 'Log système'; -$lng['logger']['date'] = 'Date'; -$lng['logger']['type'] = 'Type'; -$lng['logger']['action'] = 'Action'; -$lng['logger']['user'] = 'Utilisateur'; -$lng['logger']['truncate'] = 'Vider les logs'; - -// ADDED IN 1.2.19-svn7 -$lng['serversettings']['ssl']['openssl_cnf'] = 'Paramètres par défaut pour créer le certificat'; -$lng['panel']['reseller'] = 'revendeur'; -$lng['panel']['admin'] = 'administrateur'; -$lng['panel']['customer'] = 'client(s)'; -$lng['error']['nomessagetosend'] = 'Vous n\'avez pas entré de message.'; -$lng['error']['norecipientsgiven'] = 'Vous n\'avez pas spécifier de destinataire'; -$lng['admin']['emaildomain'] = 'Domaine e-mail'; -$lng['admin']['email_only'] = 'Seulement des e-mails ?'; -$lng['admin']['wwwserveralias'] = 'Ajouter un "www." à l\'alias du serveur "ServerAlias"'; -$lng['admin']['ipsandports']['enable_ssl'] = 'Est-ce un port SSL ?'; -$lng['admin']['ipsandports']['ssl_cert_file'] = 'Emplacement du certificat SSL'; -$lng['panel']['send'] = 'envoyé'; -$lng['admin']['subject'] = 'Sujet'; -$lng['admin']['recipient'] = 'Destinataire'; -$lng['admin']['message'] = 'Ecrire un message'; -$lng['admin']['text'] = 'Message'; -$lng['menu']['message'] = 'Messages'; -$lng['error']['errorsendingmail'] = 'Echec d\'envoi du message à "%s"'; -$lng['error']['cannotreaddir'] = 'Impossible de lire dossier "%s"'; -$lng['success']['messages_success'] = 'Le message a été envoyé aux destinataires "%s"'; -$lng['message']['norecipients'] = 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données'; -$lng['admin']['sslsettings'] = 'Paramètres SSL'; -$lng['cronjobs']['notyetrun'] = 'Pas encore lancé'; -$lng['serversettings']['default_vhostconf']['title'] = 'Paramètres par défaut pour les vHosts'; -$lng['emails']['quota'] = 'Quota'; -$lng['emails']['noquota'] = 'Pas de quota'; -$lng['emails']['updatequota'] = 'Mise à jour'; -$lng['serversettings']['mail_quota']['title'] = 'Quota de la boîte aux lettres'; -$lng['serversettings']['mail_quota']['description'] = 'Quota par défaut pour toutes nouvelles boîtes aux lettres créées.'; -$lng['serversettings']['mail_quota_enabled']['title'] = 'Utiliser les quotas de boîtes aux lettres pour les clients'; -$lng['serversettings']['mail_quota_enabled']['description'] = 'Activez cette option pour utiliser les quotas sur les boîtes aux lettres. Par défaut, cette option est à Non car cela requiert une configuration spécifique.'; -$lng['serversettings']['mail_quota_enabled']['removelink'] = 'Cliquez ici pour retirer tous les quotas de tous les comptes e-mails.'; -$lng['question']['admin_quotas_reallywipe'] = 'Etes-vous sûr de vouloir retirer tous les quotas de la table mail_users ? Cette action ne peut être annulée !'; -$lng['error']['vmailquotawrong'] = 'La taille du quota doit être entre 1 et 999'; -$lng['customer']['email_quota'] = 'Quota e-mail'; -$lng['customer']['email_imap'] = 'E-mail IMAP'; -$lng['customer']['email_pop3'] = 'E-mail POP3'; -$lng['customer']['mail_quota'] = 'Quota e-mail'; -$lng['error']['invalidip'] = 'Adresse IP invalide : %s'; -$lng['serversettings']['decimal_places'] = 'Nombre de décimales à afficher pour le trafic / espace web'; - -// ADDED IN 1.2.19-svn8 - -$lng['admin']['dkimsettings'] = 'Paramètres DKIM'; -$lng['dkim']['dkim_prefix']['title'] = 'Prefix DKIM'; -$lng['dkim']['dkim_prefix']['description'] = 'Veuillez entrer l\'emplacement des fichiers RSA pour DKIM ainsi que l\'emplacement du fichier de configuration pour le plugin Milter'; -$lng['dkim']['dkim_domains']['title'] = 'Nom du fichier DKIM'; -$lng['dkim']['dkim_domains']['description'] = 'Nom du fichier des paramètres DKIM pour les domaines tel que entré dans la configuration de DKIM-milter'; -$lng['dkim']['dkim_dkimkeys']['title'] = 'Nom du fichier des clefs DKIM'; -$lng['dkim']['dkim_dkimkeys']['description'] = 'Nom du fichier des paramètres des clefs DKIM tel que entré dans la configuration de DKIM-milter'; -$lng['dkim']['dkimrestart_command']['title'] = 'Commande de redémarrage de DKIM-milter'; -$lng['dkim']['dkimrestart_command']['description'] = 'Veuillez entrer la commande de redémarrage du service DKIM-milter'; - -// ADDED IN 1.2.19-svn9 - -$lng['admin']['caneditphpsettings'] = 'Peut changer les paramétres PHP du domaine ?'; - -// ADDED IN 1.2.19-svn12 - -$lng['admin']['allips'] = 'Toutes les adresses IP'; -$lng['panel']['nosslipsavailable'] = 'Il n\'y a actuellement aucune combinaison IP / Port configurer pour SSL'; -$lng['dkim']['use_dkim']['title'] = 'Activer le support DKIM ?'; -$lng['dkim']['use_dkim']['description'] = 'Voulez-vous utiliser le système DKIM (DomainKeys Identified Mail) ?'; -$lng['error']['invalidmysqlhost'] = 'Adresse hôte MySQL invalide : "%s"'; -$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'Vous ne pouvez pas activer AWStats et Webalizer en même temps. Veuillez n\'en choisir qu\'un seul.'; -$lng['serversettings']['webalizer_enabled'] = 'Activer les statistiques Webalizer'; -$lng['serversettings']['awstats_enabled'] = 'Activer les statistiques AWStats'; -$lng['admin']['awstatssettings'] = 'Paramètres Awstats'; - -// ADDED IN 1.2.19-svn16 - -$lng['admin']['domain_dns_settings'] = 'Paramètres DNS'; -$lng['dns']['destinationip'] = 'IP du domaine'; -$lng['dns']['standardip'] = 'IP standard du serveur'; -$lng['dns']['a_record'] = 'Enregistrement de type "A" (IPv6 optionnel)'; -$lng['dns']['cname_record'] = 'Enregistrement CNAME'; -$lng['dns']['mxrecords'] = 'Définition des enregistrements MX'; -$lng['dns']['standardmx'] = 'Enregistrements MX standard du serveur'; -$lng['dns']['mxconfig'] = 'Enregistrements MX personnalisé'; -$lng['dns']['priority10'] = 'Priorité 10'; -$lng['dns']['priority20'] = 'Priorité 20'; -$lng['dns']['txtrecords'] = 'Définir des enregistrement TXT'; -$lng['dns']['txtexample'] = 'Exemple (pour SPF) :
v=spf1 ip4:xxx.xxx.xx.0/23 -all'; -$lng['serversettings']['selfdns']['title'] = 'Paramètres manuel des DNS du domaine'; -$lng['serversettings']['selfdnscustomer']['title'] = 'Permettre aux clients de modifier les paramètes DNS du domaine'; -$lng['admin']['activated'] = 'Activé'; -$lng['admin']['statisticsettings'] = 'Paramètres des statistiques'; -$lng['admin']['or'] = 'ou'; - -// ADDED IN 1.2.19-svn17 - -$lng['serversettings']['unix_names']['title'] = 'Utiliser des noms d\'utilisateurs compatible UNIX'; -$lng['serversettings']['unix_names']['description'] = 'Vous permet d\'utiliser les - et _ dans les noms d\'utilisateurs si l\'option est à Non'; -$lng['error']['cannotwritetologfile'] = 'Ne peut ouvrir le fichier de log %s en écriture'; -$lng['admin']['sysload'] = 'Charge du système'; -$lng['admin']['noloadavailable'] = 'Non disponible'; -$lng['admin']['nouptimeavailable'] = 'Non disponible'; -$lng['panel']['backtooverview'] = 'Retour à l\'aperçu'; -$lng['admin']['nosubject'] = '(Aucun sujet)'; -$lng['admin']['configfiles']['statistics'] = 'Statistiques'; -$lng['login']['forgotpwd'] = 'Mot de passe oublié ?'; -$lng['login']['presend'] = 'Réinitialiser le mot de passe'; -$lng['login']['email'] = 'Adresse e-mail'; -$lng['login']['remind'] = 'Réinitialiser mon mot de passe'; -$lng['login']['usernotfound'] = 'Erreur : utilisateur inconnu !'; -$lng['mails']['password_reset']['subject'] = 'réinitialisation du mot de passe'; -$lng['mails']['password_reset']['mailbody'] = 'Bonjour {USERNAME},\n\nVotre mot de passe pour Froxlor a été réinitialiser !\nLe nouveau mot de passe est : {LINK}\n\nCordialement,\nL\'équipe Froxlor.'; -$lng['pwdreminder']['success'] = 'Mot de passe correctement réinitialiser.
Vous devriez recevoir un e-mail avec votre nouveau mot de passe d\'ici quelques minutes.'; - -// ADDED IN 1.2.19-svn18 - -$lng['serversettings']['allow_password_reset']['title'] = 'Permettre aux clients de réinitialiser leurs mots de passe'; -$lng['pwdreminder']['notallowed'] = 'La réinitialisation des mots de passe est désactivée.'; - -// ADDED IN 1.2.19-svn21 - -$lng['customer']['title'] = 'Titre'; -$lng['customer']['country'] = 'Pays'; -$lng['panel']['dateformat'] = 'YYYY-MM-DD'; -$lng['panel']['dateformat_function'] = 'Y-m-d'; - -// Y = Year, m = Month, d = Day - -$lng['panel']['timeformat_function'] = 'H:i:s'; - -// H = Hour, i = Minute, s = Second - -$lng['panel']['default'] = 'Par défaut'; -$lng['panel']['never'] = 'Jamais'; -$lng['panel']['active'] = 'Actif'; -$lng['panel']['please_choose'] = 'Veuillez choisir'; -$lng['domains']['add_date'] = 'Ajouter à Froxlor'; -$lng['domains']['registration_date'] = 'Ajouter à l\'enregistrement'; - -// ADDED IN 1.2.19-svn22 - -$lng['serversettings']['allow_password_reset']['description'] = 'Les clients peuvent réinitialiser leurs mots de passe et il sera envoyé à leurs propres adresses e-mails'; -$lng['serversettings']['allow_password_reset_admin']['title'] = 'Permettre la réinitialisation des mots de passe par les administrateurs'; -$lng['serversettings']['allow_password_reset_admin']['description'] = 'Les administrateurs / revendeurs peuvent réinitialiser leurs mots de passe et il sera envoyé à leurs propres adresses e-mails'; diff --git a/lng/german.lng.php b/lng/german.lng.php deleted file mode 100644 index 722ddc1e..00000000 --- a/lng/german.lng.php +++ /dev/null @@ -1,1810 +0,0 @@ - (2003-2009) - * @author Froxlor team (2010-) - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Global - */ -$lng['translator'] = ''; -$lng['panel']['edit'] = 'bearbeiten'; -$lng['panel']['delete'] = 'löschen'; -$lng['panel']['create'] = 'anlegen'; -$lng['panel']['save'] = 'Speichern'; -$lng['panel']['yes'] = 'Ja'; -$lng['panel']['no'] = 'Nein'; -$lng['panel']['emptyfornochanges'] = 'leer für keine Änderung'; -$lng['panel']['emptyfordefault'] = 'Leer für Standardeinstellung.'; -$lng['panel']['path'] = 'Pfad'; -$lng['panel']['toggle'] = 'Umschalten'; -$lng['panel']['next'] = 'Weiter'; -$lng['panel']['dirsmissing'] = 'Das angegebene Verzeichnis konnte nicht gefunden werden.'; - -/** - * Login - */ - -$lng['login']['username'] = 'Benutzername'; -$lng['login']['password'] = 'Passwort'; -$lng['login']['language'] = 'Sprache'; -$lng['login']['login'] = 'Anmelden'; -$lng['login']['logout'] = 'Abmelden'; -$lng['login']['profile_lng'] = 'Profilsprache'; -$lng['login']['welcomemsg'] = 'Bitte melden Sie sich an, um auf Ihr Konto zuzugreifen.'; - -/** - * Customer - */ - -$lng['customer']['documentroot'] = 'Heimatverzeichnis'; -$lng['customer']['name'] = 'Name'; -$lng['customer']['firstname'] = 'Vorname'; -$lng['customer']['company'] = 'Firma'; -$lng['customer']['street'] = 'Straße'; -$lng['customer']['zipcode'] = 'PLZ'; -$lng['customer']['city'] = 'Ort'; -$lng['customer']['phone'] = 'Telefon'; -$lng['customer']['fax'] = 'Fax'; -$lng['customer']['email'] = 'E-Mail-Adresse'; -$lng['customer']['customernumber'] = 'Kundennummer'; -$lng['customer']['diskspace'] = 'Webspace'; -$lng['customer']['traffic'] = 'Traffic'; -$lng['customer']['mysqls'] = 'MySQL-Datenbanken'; -$lng['customer']['emails'] = 'E-Mail-Adressen'; -$lng['customer']['accounts'] = 'E-Mail-Konten'; -$lng['customer']['forwarders'] = 'E-Mail-Weiterleitungen'; -$lng['customer']['ftps'] = 'FTP-Konten'; -$lng['customer']['subdomains'] = 'Subdomain(s)'; -$lng['customer']['domains'] = 'Domain(s)'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Allgemein'; -$lng['menue']['main']['changepassword'] = 'Passwort ändern'; -$lng['menue']['main']['changelanguage'] = 'Sprache ändern'; -$lng['menue']['email']['email'] = 'E-Mail'; -$lng['menue']['email']['emails'] = 'Adressen'; -$lng['menue']['email']['webmail'] = 'Webmail'; -$lng['menue']['mysql']['mysql'] = 'MySQL'; -$lng['menue']['mysql']['databases'] = 'Datenbanken'; -$lng['menue']['mysql']['phpmyadmin'] = 'phpMyAdmin'; -$lng['menue']['domains']['domains'] = 'Domains'; -$lng['menue']['domains']['settings'] = 'Einstellungen'; -$lng['menue']['ftp']['ftp'] = 'FTP'; -$lng['menue']['ftp']['accounts'] = 'Benutzerkonten'; -$lng['menue']['ftp']['webftp'] = 'WebFTP'; -$lng['menue']['extras']['extras'] = 'Extras'; -$lng['menue']['extras']['directoryprotection'] = 'Verzeichnisschutz'; -$lng['menue']['extras']['pathoptions'] = 'Pfadoptionen'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Kundendaten'; -$lng['index']['accountdetails'] = 'Kontodaten'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Altes Passwort'; -$lng['changepassword']['new_password'] = 'Neues Passwort'; -$lng['changepassword']['new_password_confirm'] = 'Neues Passwort bestätigen'; -$lng['changepassword']['new_password_ifnotempty'] = 'Neues Passwort (leer für keine Änderung)'; -$lng['changepassword']['also_change_ftp'] = 'Auch Passwort des Haupt-FTP-Zugangs ändern'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Hier können Sie (Sub-)Domains erstellen und deren Pfade ändern.
Nach jeder Änderung braucht das System etwas Zeit, um die Konfiguration neu einzulesen.'; -$lng['domains']['domainsettings'] = 'Domaineinstellungen'; -$lng['domains']['domainname'] = 'Domainname'; -$lng['domains']['subdomain_add'] = 'Subdomain anlegen'; -$lng['domains']['subdomain_edit'] = '(Sub-)Domain bearbeiten'; -$lng['domains']['wildcarddomain'] = 'Als Wildcarddomain eintragen?'; -$lng['domains']['aliasdomain'] = 'Alias für Domain'; -$lng['domains']['noaliasdomain'] = 'Keine Aliasdomain'; - -/** - * eMails - */ - -$lng['emails']['description'] = 'Hier können Sie Ihre E-Mail-Adressen einrichten.
Ein Konto ist wie Ihr Briefkasten vor der Haustür. Wenn jemand eine E-Mail an Sie schreibt, wird diese in dieses Konto gelegt.

Die Zugangsdaten lauten wie folgt: (Die Angaben in kursiver Schrift sind durch die jeweiligen Einträge zu ersetzen)

Hostname: Domainname
Benutzername: Kontoname / E-Mail-Adresse
Passwort: das gewählte Passwort'; -$lng['emails']['emailaddress'] = 'E-Mail-Adresse'; -$lng['emails']['emails_add'] = 'E-Mail-Adresse anlegen'; -$lng['emails']['emails_edit'] = 'E-Mail-Adresse ändern'; -$lng['emails']['catchall'] = 'Catchall'; -$lng['emails']['iscatchall'] = 'Als Catchall-Adresse definieren?'; -$lng['emails']['account'] = 'Konto'; -$lng['emails']['account_add'] = 'Konto anlegen'; -$lng['emails']['account_delete'] = 'Konto löschen'; -$lng['emails']['from'] = 'Von'; -$lng['emails']['to'] = 'Nach'; -$lng['emails']['forwarders'] = 'Weiterleitungen'; -$lng['emails']['forwarder_add'] = 'Weiterleitung hinzufügen'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Hier können Sie zusätzliche FTP-Konten einrichten.
Die Änderungen sind sofort wirksam und die FTP-Konten sofort benutzbar.'; -$lng['ftp']['account_add'] = 'Benutzerkonto anlegen'; - -/** - * MySQL - */ - -$lng['mysql']['databasename'] = 'Benutzer-/Datenbankname'; -$lng['mysql']['databasedescription'] = 'Datenbankbeschreibung'; -$lng['mysql']['database_create'] = 'Datenbank anlegen'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Hier können Sie zusätzliche Extras einrichten, wie zum Beispiel einen Verzeichnisschutz.
Die Änderungen sind erst nach einer kurzen Zeit wirksam.'; -$lng['extras']['directoryprotection_add'] = 'Verzeichnisschutz anlegen'; -$lng['extras']['view_directory'] = 'Verzeichnis anzeigen'; -$lng['extras']['pathoptions_add'] = 'Pfadoptionen hinzufügen'; -$lng['extras']['directory_browsing'] = 'Verzeichnisinhalt anzeigen'; -$lng['extras']['pathoptions_edit'] = 'Pfadoptionen bearbeiten'; -$lng['extras']['error404path'] = '404'; -$lng['extras']['error403path'] = '403'; -$lng['extras']['error500path'] = '500'; -$lng['extras']['error401path'] = '401'; -$lng['extras']['errordocument404path'] = 'Fehlerdokument 404'; -$lng['extras']['errordocument403path'] = 'Fehlerdokument 403'; -$lng['extras']['errordocument500path'] = 'Fehlerdokument 500'; -$lng['extras']['errordocument401path'] = 'Fehlerdokument 401'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Fehlermeldung'; -$lng['error']['directorymustexist'] = 'Das Verzeichnis "%s" muss existieren. Legen Sie es bitte mit Ihrem FTP-Programm an.'; -$lng['error']['filemustexist'] = 'Die Datei "%s" muss existieren.'; -$lng['error']['allresourcesused'] = 'Sie haben bereits alle Ihnen zur Verfügung stehenden Ressourcen verbraucht.'; -$lng['error']['domains_cantdeletemaindomain'] = 'Sie können keine Domain, die als E-Mail-Domain verwendet wird, löschen. '; -$lng['error']['domains_canteditdomain'] = 'Sie können diese Domain nicht bearbeiten. Dies wurde durch den Admin verweigert.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'Sie können keine Domain löschen, die noch als E-Mail-Domain verwendet wird. Löschen Sie zuerst alle E-Mail-Adressen dieser Domain.'; -$lng['error']['firstdeleteallsubdomains'] = 'Sie müssen zuerst alle Subdomains löschen, bevor Sie eine Wildcarddomain anlegen können.'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'Sie haben bereits eine E-Mail-Adresse als Catchall für diese Domain definiert.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'Sie können Ihren Hauptaccount nicht löschen.'; -$lng['error']['login'] = 'Die Kombination aus Benutzername und Passwort ist ungültig.'; -$lng['error']['login_blocked'] = 'Dieser Account wurde aufgrund zu vieler Fehlversuche vorübergehend geschlossen.
Bitte versuchen Sie es in "%s" Sekunden erneut.'; -$lng['error']['notallreqfieldsorerrors'] = 'Sie haben nicht alle Felder bzw. ein Feld mit fehlerhaften Angaben ausgefüllt.'; -$lng['error']['oldpasswordnotcorrect'] = 'Das alte Passwort ist nicht korrekt.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'Sie können nicht mehr Ressourcen verteilen als Ihnen noch zur Verfügung stehen.'; -$lng['error']['mustbeurl'] = 'Sie müssen eine vollständige URL angeben (z. B. http://domain.de/error404.htm).'; -$lng['error']['invalidpath'] = 'Sie haben keine gültige URL angegeben (evtl. Probleme beim Verzeichnislisting?).'; -$lng['error']['stringisempty'] = 'Fehlende Eingabe im Feld'; -$lng['error']['stringiswrong'] = 'Falsche Eingabe im Feld'; -$lng['error']['newpasswordconfirmerror'] = 'Das neue Passwort und dessen Bestätigung sind nicht identisch.'; -$lng['error']['mydomain'] = '\'Domain\''; -$lng['error']['mydocumentroot'] = '\'Documentroot\''; -$lng['error']['loginnameexists'] = 'Der Login-Name "%s" existiert bereits.'; -$lng['error']['emailiswrong'] = 'Die E-Mail-Adresse "%s" enthält ungültige Zeichen oder ist nicht vollständig.'; -$lng['error']['alternativeemailiswrong'] = 'Die angegebene alternative E-Mail Adresse "%s", an welche die Zugangsdaten geschickt werden soll, scheint ungültig zu sein.'; -$lng['error']['loginnameiswrong'] = 'Der Login-Name "%s" enthält ungültige Zeichen.'; -$lng['error']['loginnameiswrong2'] = 'Der Login-Name enthält zu viele Zeichen, es sind maximal %s Zeichen erlaubt.'; -$lng['error']['userpathcombinationdupe'] = 'Die Kombination aus Benutzername und Pfad existiert bereits.'; -$lng['error']['patherror'] = 'Allgemeiner Fehler! Pfad darf nicht leer sein.'; -$lng['error']['errordocpathdupe'] = 'Option für Pfad "%s" existiert bereits.'; -$lng['error']['adduserfirst'] = 'Sie müssen zuerst einen Kunden anlegen.'; -$lng['error']['domainalreadyexists'] = 'Die Domain "%s" wurde bereits einem Kunden zugeordnet.'; -$lng['error']['nolanguageselect'] = 'Es wurde keine Sprache ausgewählt.'; -$lng['error']['nosubjectcreate'] = 'Sie müssen einen Betreff angeben.'; -$lng['error']['nomailbodycreate'] = 'Sie müssen einen E-Mail-Text eingeben.'; -$lng['error']['templatenotfound'] = 'Vorlage wurde nicht gefunden.'; -$lng['error']['alltemplatesdefined'] = 'Sie können keine weiteren Vorlagen anlegen, da bereits für alle Sprachen eine Vorlage existiert.'; -$lng['error']['wwwnotallowed'] = 'Ihre Subdomain darf nicht \'www\' heißen.'; -$lng['error']['subdomainiswrong'] = 'Die Subdomain "%s" enthält ungültige Zeichen.'; -$lng['error']['domaincantbeempty'] = 'Der Domainname darf nicht leer sein.'; -$lng['error']['domainexistalready'] = 'Die Domain "%s" existiert bereits.'; -$lng['error']['domainisaliasorothercustomer'] = 'Die ausgewählte Aliasdomain ist entweder selbst eine Aliasdomain, hat nicht die gleiche IP/Port-Kombination oder gehört einem anderen Kunden.'; -$lng['error']['emailexistalready'] = 'Die E-Mail-Adresse "%s" existiert bereits.'; -$lng['error']['maindomainnonexist'] = 'Die Hauptdomain "%s" existiert nicht.'; -$lng['error']['destinationnonexist'] = 'Bitte geben Sie Ihre Weiterleitungsadresse im Feld \'Nach\' ein.'; -$lng['error']['destinationalreadyexistasmail'] = 'Die Weiterleitung zu "%s" existiert bereits als aktive E-Mail-Adresse.'; -$lng['error']['destinationalreadyexist'] = 'Es existiert bereits eine Weiterleitung nach "%s".'; -$lng['error']['destinationiswrong'] = 'Die Weiterleitungsadresse "%s" enthält ungültige Zeichen oder ist nicht vollständig.'; -$lng['error']['backupfoldercannotbedocroot'] = 'Der Ordner für Backups darf nicht das Heimatverzeichnis sein, wählen Sie einen Ordner unterhalb des Heimatverzeichnisses, z.B. /backups'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Sicherheitsabfrage'; -$lng['question']['admin_customer_reallydelete'] = 'Wollen Sie den Kunden "%s" wirklich löschen?
ACHTUNG! Alle Daten gehen unwiderruflich verloren! Nach dem Vorgang müssen die Daten manuell aus dem Dateisystem entfernt werden.'; -$lng['question']['admin_domain_reallydelete'] = 'Wollen Sie die Domain "%s" wirklich löschen?'; -$lng['question']['admin_domain_reallydisablesecuritysetting'] = 'Wollen Sie die wichtige Sicherheitseinstellung \'OpenBasedir\' wirklich deaktivieren?'; -$lng['question']['admin_admin_reallydelete'] = 'Wollen Sie den Admin "%s" wirklich löschen?
Alle Kunden und Domains dieses Admins werden Ihnen zugeteilt.'; -$lng['question']['admin_template_reallydelete'] = 'Wollen Sie die Vorlage "%s" wirklich löschen?'; -$lng['question']['domains_reallydelete'] = 'Wollen Sie die Domain "%s" wirklich löschen?'; -$lng['question']['email_reallydelete'] = 'Wollen Sie die E-Mail-Adresse "%s" wirklich löschen?'; -$lng['question']['email_reallydelete_account'] = 'Wollen Sie das Konto von "%s" wirklich löschen?'; -$lng['question']['email_reallydelete_forwarder'] = 'Wollen Sie die Weiterleitung "%s" wirklich löschen?'; -$lng['question']['extras_reallydelete'] = 'Wollen Sie den Verzeichnisschutz für "%s" wirklich löschen?'; -$lng['question']['extras_reallydelete_pathoptions'] = 'Wollen Sie die Optionen für den Pfad "%s" wirklich löschen?'; -$lng['question']['ftp_reallydelete'] = 'Wollen Sie das FTP-Benutzerkonto "%s" wirklich löschen?'; -$lng['question']['mysql_reallydelete'] = 'Wollen Sie die Datenbank "%s" wirklich löschen?
ACHTUNG! Alle Daten gehen unwiderruflich verloren!'; -$lng['question']['admin_configs_reallyrebuild'] = 'Wollen Sie wirklich alle Konfigurationsdateien neu erstellen lassen?'; -$lng['question']['admin_customer_alsoremovefiles'] = 'Kundendaten löschen?'; -$lng['question']['admin_customer_alsoremovemail'] = 'E-Mail-Daten auf dem Dateisystem löschen?'; -$lng['question']['admin_customer_alsoremoveftphomedir'] = 'Heimatverzeichnis des FTP-Benutzers löschen?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['mailbody'] = 'Hallo,\n\nIhr E-Mail-Konto {USERNAME}\nwurde erfolgreich eingerichtet.\n\nDies ist eine automatisch generierte\nE-Mail, bitte antworten Sie nicht auf\ndiese Mitteilung.\n\nIhr Administrator'; -$lng['mails']['pop_success']['subject'] = 'E-Mail-Konto erfolgreich eingerichtet'; -$lng['mails']['createcustomer']['mailbody'] = 'Hallo {FIRSTNAME} {NAME},\n\nhier Ihre Accountinformationen:\n\nBenutzername: {USERNAME}\nPasswort: {PASSWORD}\n\nVielen Dank,\nIhr Administrator'; -$lng['mails']['createcustomer']['subject'] = 'Kontoinformationen'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Übersicht'; -$lng['admin']['ressourcedetails'] = 'Verbrauchte Ressourcen'; -$lng['admin']['systemdetails'] = 'Systemdetails'; -$lng['admin']['froxlordetails'] = 'Froxlor-Details'; -$lng['admin']['installedversion'] = 'Installierte Version'; -$lng['admin']['latestversion'] = 'Neueste Version'; -$lng['admin']['lookfornewversion']['clickhere'] = 'per Webservice abfragen - Hier klicken'; -$lng['admin']['lookfornewversion']['error'] = 'Fehler bei Abfrage'; -$lng['admin']['resources'] = 'Ressourcen'; -$lng['admin']['customer'] = 'Kunde'; -$lng['admin']['customers'] = 'Kunden'; -$lng['admin']['customer_add'] = 'Kunden anlegen'; -$lng['admin']['customer_edit'] = 'Kunden bearbeiten'; -$lng['admin']['domains'] = 'Domains'; -$lng['admin']['domain_add'] = 'Domain anlegen'; -$lng['admin']['domain_edit'] = 'Domain bearbeiten'; -$lng['admin']['subdomainforemail'] = 'Subdomains als E-Mail-Domains erlauben'; -$lng['admin']['admin'] = 'Admin'; -$lng['admin']['admins'] = 'Admins'; -$lng['admin']['admin_add'] = 'Admin anlegen'; -$lng['admin']['admin_edit'] = 'Admin bearbeiten'; -$lng['admin']['customers_see_all'] = 'Kann alle Kunden sehen?'; -$lng['admin']['domains_see_all'] = 'Kann alle Domains sehen?'; -$lng['admin']['change_serversettings'] = 'Kann Servereinstellungen bearbeiten?'; -$lng['admin']['serversettings'] = 'Einstellungen'; -$lng['admin']['rebuildconf'] = 'Configs neu schreiben'; -$lng['admin']['stdsubdomain'] = 'Standardsubdomain'; -$lng['admin']['stdsubdomain_add'] = 'Standardsubdomain anlegen'; -$lng['admin']['phpenabled'] = 'PHP verfügbar'; -$lng['admin']['deactivated'] = 'Gesperrt'; -$lng['admin']['deactivated_user'] = 'Benutzer sperren'; -$lng['admin']['sendpassword'] = 'Passwort zusenden'; -$lng['admin']['ownvhostsettings'] = 'Eigene vHost-Einstellungen'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Konfiguration'; -$lng['admin']['templates']['templates'] = 'E-Mail-Vorlagen'; -$lng['admin']['templates']['template_add'] = 'Vorlage hinzufügen'; -$lng['admin']['templates']['template_fileadd'] = 'Dateivorlage hinzufügen'; -$lng['admin']['templates']['template_edit'] = 'Vorlage bearbeiten'; -$lng['admin']['templates']['action'] = 'Aktion'; -$lng['admin']['templates']['email'] = 'E-Mail- & Dateivorlagen'; -$lng['admin']['templates']['subject'] = 'Betreff'; -$lng['admin']['templates']['mailbody'] = 'Mailtext'; -$lng['admin']['templates']['createcustomer'] = 'Willkommensmail für neue Kunden'; -$lng['admin']['templates']['pop_success'] = 'Willkommensmail für neue E-Mail-Konten'; -$lng['admin']['templates']['template_replace_vars'] = 'Variablen, die in den Vorlagen ersetzt werden:'; -$lng['admin']['templates']['SALUTATION'] = 'Wird mit einer korrekten Anrede des Kunden ersetzt.'; -$lng['admin']['templates']['FIRSTNAME'] = 'Wird mit dem Vornamen des Kunden ersetzt.'; -$lng['admin']['templates']['NAME'] = 'Wird mit dem Namen des Kunden ersetzt.'; -$lng['admin']['templates']['COMPANY'] = 'Wird mit dem Firmennamen des Kunden ersetzt.'; -$lng['admin']['templates']['USERNAME'] = 'Wird mit dem Benutzernamen des neuen Kundenkontos ersetzt.'; -$lng['admin']['templates']['PASSWORD'] = 'Wird mit dem Passwort des neuen Kundenkontos ersetzt.'; -$lng['admin']['templates']['EMAIL'] = 'Wird mit der Adresse des neuen E-Mail-Kontos ersetzt.'; -$lng['admin']['templates']['CUSTOMER_NO'] = 'Wir mit der Kunden-Nummer ersetzt'; -$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '
WARNUNG: Bei der Verwendung einer Zonendatei müssen alle benötigten Records aller Subdomains ebenfalls manuell verwaltet werden.'; -$lng['error']['templatelanguagecombodefined'] = 'Die gewählte Kombination aus Sprache und Vorlage ist bereits definiert.'; - -/** - * Serversettings - */ - -$lng['serversettings']['session_timeout']['title'] = 'Session-Timeout'; -$lng['serversettings']['session_timeout']['description'] = 'Wie lange muss ein Benutzer inaktiv sein, damit die Session ungültig wird? (in Sekunden)'; -$lng['serversettings']['accountprefix']['title'] = 'Kundenpräfix'; -$lng['serversettings']['accountprefix']['description'] = 'Welchen Präfix sollen die Kundenaccounts haben?'; -$lng['serversettings']['mysqlprefix']['title'] = 'MySQL-Präfix'; -$lng['serversettings']['mysqlprefix']['description'] = 'Welchen Präfix sollen die MySQL-Benutzerkonten haben?
Mit "RANDOM" als Wert wird ein 3-stelliger Zufallswert als Präfix verwendet.
Mit "DBNAME" als Wert wird ein Feld Databankname zusammen mit dem Kundennamen als Präfix genutzt.'; -$lng['serversettings']['ftpprefix']['title'] = 'FTP-Präfix'; -$lng['serversettings']['ftpprefix']['description'] = 'Welchen Präfix sollen die FTP-Benutzerkonten haben?
Falls FTP-Quoatas verwendet werden, ist es notwendig das Quota-SQL-Query in der FTP-Server-Config ebenfalls zu ändern!'; -$lng['serversettings']['documentroot_prefix']['title'] = 'Heimatverzeichnis'; -$lng['serversettings']['documentroot_prefix']['description'] = 'Wo sollen die Heimatverzeichnisse der Kunden liegen?'; -$lng['serversettings']['logfiles_directory']['title'] = 'Webserver-Logdateien-Verzeichnis'; -$lng['serversettings']['logfiles_directory']['description'] = 'Wo sollen die Logdateien des Webservers liegen?'; -$lng['serversettings']['logfiles_script']['title'] = 'Eigenes Script zu dem Log-Files übergeben werden'; -$lng['serversettings']['logfiles_script']['description'] = 'Hier kann ein Script an das die Loginhalte übergeben werden hinterlegt und die Platzhalter {LOGFILE}, {DOMAIN} und {CUSTOMER} genutzt werden, sofern nötig. Falls ein Script angegeben wird, muss die Option Webserver Logdateien umleiten gesetzt werden'; -$lng['serversettings']['logfiles_format']['title'] = 'Access-Log Format'; -$lng['serversettings']['logfiles_format']['description'] = 'Hier kann ein angepasstes Log-format entsprechend der Webserver-Dokumentation angegeben werden, leer lassen für Standard. Abhängig vom LogFormat muss die Angabe unter Anführungszeichen stehen.
Wenn verwendet mit nginx, so kann es wie folgt aussehen: log_format frx_custom {EINGESTELLTES_FORMAT}.
Wenn verwendet mit Apache, so kann es wie folgt aussehen: LogFormat {EINGESTELLTES_FORMAT} frx_custom.
ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden auch übernommen und der Webserver könnte nicht mehr starten!'; -$lng['serversettings']['logfiles_type']['title'] = 'Access-Log Typ'; -$lng['serversettings']['logfiles_type']['description'] = 'Wähle zwischen combined oder vhost_combined.'; -$lng['serversettings']['logfiles_piped']['title'] = 'Webserver Logdateien zu eigenem Script umleiten (siehe oben)'; -$lng['serversettings']['logfiles_piped']['description'] = 'Wenn ein Script für die Logdateien verwendet wird, muss diese Option aktiviert werden, damit der Webserver die Ausgabe an das Script weitergibt.'; -$lng['serversettings']['ipaddress']['title'] = 'IP-Adresse'; -$lng['serversettings']['ipaddress']['description'] = 'Welche Haupt-IP-Adresse hat der Server?'; -$lng['serversettings']['hostname']['title'] = 'Hostname'; -$lng['serversettings']['hostname']['description'] = 'Welchen Hostnamen hat der Server?'; -$lng['serversettings']['apachereload_command']['title'] = 'Webserver-Reload-Befehl'; -$lng['serversettings']['apachereload_command']['description'] = 'Wie heißt das Skript zum Neuladen der Webserver-Konfigurationsdateien?'; -$lng['serversettings']['bindenable']['title'] = 'Nameserver aktivieren'; -$lng['serversettings']['bindenable']['description'] = 'Hier können Sie den Nameserver global aktivieren bzw. deaktivieren.'; -$lng['serversettings']['bindconf_directory']['title'] = 'DNS-Server Konfigurationsordner'; -$lng['serversettings']['bindconf_directory']['description'] = 'Wo liegen die DNS-Server Konfigurationsdateien?'; -$lng['serversettings']['bindreload_command']['title'] = 'DNS-Server Reload-Befehl'; -$lng['serversettings']['bindreload_command']['description'] = 'Wie heißt das Skript zum Neuladen der DNS-Server Konfigurationsdateien?'; -$lng['serversettings']['vmail_uid']['title'] = 'Mail-UID'; -$lng['serversettings']['vmail_uid']['description'] = 'Welche UID sollen die E-Mails haben?'; -$lng['serversettings']['vmail_gid']['title'] = 'Mail-GID'; -$lng['serversettings']['vmail_gid']['description'] = 'Welche GID sollen die E-Mails haben?'; -$lng['serversettings']['vmail_homedir']['title'] = 'Mail-Homedir'; -$lng['serversettings']['vmail_homedir']['description'] = 'Wo sollen die E-Mails liegen?'; -$lng['serversettings']['adminmail']['title'] = 'Absenderadresse'; -$lng['serversettings']['adminmail']['description'] = 'Wie lautet die Absenderadresse für E-Mails aus dem Panel?'; -$lng['serversettings']['phpmyadmin_url']['title'] = 'phpMyAdmin-URL'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'Wo liegt phpMyAdmin? (muss mit http(s):// beginnen)'; -$lng['serversettings']['webmail_url']['title'] = 'Webmail-URL'; -$lng['serversettings']['webmail_url']['description'] = 'Wo liegt der Webmail-Client? (muss mit http(s):// beginnen)'; -$lng['serversettings']['webftp_url']['title'] = 'WebFTP-URL'; -$lng['serversettings']['webftp_url']['description'] = 'Wo liegt der WebFTP-Client? (muss mit http(s):// beginnen)'; -$lng['serversettings']['language']['description'] = 'Welche Sprache ist Ihre Standardsprache?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Maximale Loginversuche'; -$lng['serversettings']['maxloginattempts']['description'] = 'Maximale Anzahl an Loginversuchen bis der Account deaktiviert wird.'; -$lng['serversettings']['deactivatetime']['title'] = 'Länge der Deaktivierung'; -$lng['serversettings']['deactivatetime']['description'] = 'Zeitraum (in Sekunden) für den der Account deaktiviert ist.'; -$lng['serversettings']['pathedit']['title'] = 'Pfad-Eingabemethode'; -$lng['serversettings']['pathedit']['description'] = 'Soll ein Pfad via Auswahlliste ausgewählt oder manuell eingegeben werden können?'; -$lng['serversettings']['nameservers']['title'] = 'Nameserver'; -$lng['serversettings']['nameservers']['description'] = 'Eine durch Komma getrennte Liste mit den Hostnamen aller Nameserver. Der Erste ist der Primäre.'; -$lng['serversettings']['mxservers']['title'] = 'MX-Server'; -$lng['serversettings']['mxservers']['description'] = 'Eine durch Komma getrenne Liste, die ein Paar mit einer Nummer und den Hostnamen einen MX-Servers, getrennt durch ein Leerzeichen, enthält (z. B. \'10 mx.example.tld\').'; - -/** - * CHANGED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['mysql']['description'] = 'Hier können Sie MySQL-Datenbanken anlegen und löschen.
Die Änderungen werden sofort wirksam und die Datenbanken sind sofort benutzbar.
Im Menü finden Sie einen Link zu phpMyAdmin, mit dem Sie Ihre Datenbankinhalte komfortabel bearbeiten können.

Die Zugangsdaten sind wie folgt: (Die Angaben in kursiver Schrift sind durch die jeweiligen Einträge zu ersetzen)
Hostname:
Benutzername: Datenbankname
Passwort: das gewählte Passwort
Datenbank: Datenbankname'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['serversettings']['paging']['title'] = 'Einträge pro Seite'; -$lng['serversettings']['paging']['description'] = 'Wie viele Einträge sollen auf einer Seite angezeigt werden? (0 = Paging deaktivieren)'; -$lng['error']['ipstillhasdomains'] = 'Die IP/Port-Kombination, die Sie löschen wollen, ist noch bei einer oder mehreren Domains eingetragen. Bitte ändern Sie die Domains vorher auf eine andere IP/Port-Kombination, um diese löschen zu können.'; -$lng['error']['cantdeletedefaultip'] = 'Sie können die Standard-IP/Port-Kombination für Reseller nicht löschen. Bitte setzen Sie eine andere IP/Port-Kombination als Standard, um diese löschen zu können.'; -$lng['error']['cantdeletesystemip'] = 'Sie können die letzte System-IP-Adresse nicht löschen. Entweder legen Sie eine neue IP/Port-Kombination an oder Sie ändern die System-IP-Adresse.'; -$lng['error']['myipaddress'] = '\'IP-Adresse\''; -$lng['error']['myport'] = '\'Port\''; -$lng['error']['myipdefault'] = 'Sie müssen eine IP/Port-Kombination auswählen, die den Standard definieren soll.'; -$lng['error']['myipnotdouble'] = 'Diese Kombination aus IP-Adresse und Port existiert bereits.'; -$lng['question']['admin_ip_reallydelete'] = 'Wollen Sie wirklich die IP-Adresse "%s" löschen?'; -$lng['admin']['ipsandports']['ipsandports'] = 'IPs und Ports'; -$lng['admin']['ipsandports']['add'] = 'IP-Adresse/Port hinzufügen'; -$lng['admin']['ipsandports']['edit'] = 'IP-Adresse/Port bearbeiten'; -$lng['admin']['ipsandports']['ipandport'] = 'IP-Adresse/Port'; -$lng['admin']['ipsandports']['ip'] = 'IP-Adresse'; -$lng['admin']['ipsandports']['ipnote'] = '
Hinweis: Obwohl private IP Adressen erlaubt sind, kann es bei manchen Features wie DNS zu ungewolltem Verhalten kommen.
Verwende private Adressen nur wenn du sicher bist.
'; -$lng['admin']['ipsandports']['port'] = 'Port'; - -// ADDED IN 1.2.13-rc3 - -$lng['error']['cantchangesystemip'] = 'Sie können die letzte System-IP-Adresse nicht löschen. Entweder legen Sie eine neue IP/Port-Kombination an oder Sie ändern die System-IP-Adresse.'; -$lng['question']['admin_domain_reallydocrootoutofcustomerroot'] = 'Sind Sie sicher, dass der DocumentRoot dieser Domain außerhalb des Heimatverzeichnisses des Kunden liegen soll?'; - -// ADDED IN 1.2.14-rc1 - -$lng['admin']['memorylimitdisabled'] = 'Deaktiviert'; -$lng['domain']['openbasedirpath'] = 'OpenBasedir-Pfad'; -$lng['domain']['docroot'] = 'Oben angegebener Pfad'; -$lng['domain']['homedir'] = 'Heimverzeichnis'; -$lng['admin']['valuemandatory'] = 'Dieses Feld muss ausgefüllt werden.'; -$lng['admin']['valuemandatorycompany'] = 'Entweder "Name" und "Vorname" oder "Firma" muss ausgefüllt werden.'; -$lng['menue']['main']['username'] = 'Angemeldet als '; -$lng['panel']['urloverridespath'] = 'URL (überschreibt Pfad)'; -$lng['panel']['pathorurl'] = 'Pfad oder URL'; -$lng['error']['sessiontimeoutiswrong'] = '"Session-Timeout" muss ein numerischer Wert sein.'; -$lng['error']['maxloginattemptsiswrong'] = '"Maximale Loginversuche" muss ein numerischer Wert sein.'; -$lng['error']['deactivatetimiswrong'] = '"Länge der Deaktivierung" muss numerisch sein.'; -$lng['error']['accountprefixiswrong'] = 'Das "Kundenpräfix" ist falsch.'; -$lng['error']['mysqlprefixiswrong'] = 'Das "MySQL-Präfix" ist falsch.'; -$lng['error']['ftpprefixiswrong'] = 'Das "FTP-Präfix" ist falsch.'; -$lng['error']['ipiswrong'] = 'Die "IP-Adresse" ist falsch. Bitte geben Sie eine gültige IP-Adresse an.'; -$lng['error']['vmailuidiswrong'] = 'Die "Mail-UID" ist falsch. Es ist nur eine numerische UID erlaubt.'; -$lng['error']['vmailgidiswrong'] = 'Die "Mail-GID" ist falsch. Es ist nur eine numerische GID erlaubt.'; -$lng['error']['adminmailiswrong'] = 'Die "Absenderadresse" ist fehlerhaft. Bitte geben Sie eine gültige E-Mail-Adresse an.'; -$lng['error']['pagingiswrong'] = 'Die "Einträge pro Seite"-Einstellung ist falsch. Es sind nur numerische Zeichen erlaubt.'; -$lng['error']['phpmyadminiswrong'] = 'Die "phpMyAdmin-URL" ist keine gültige URL.'; -$lng['error']['webmailiswrong'] = 'Die "Webmail-URL" ist keine gültige URL.'; -$lng['error']['webftpiswrong'] = 'Die "WebFTP-URL" ist keine gültige URL.'; -$lng['domains']['hasaliasdomains'] = 'Hat Aliasdomain(s)'; -$lng['serversettings']['defaultip']['title'] = 'Standard-IP/Port-Kombination'; -$lng['serversettings']['defaultip']['description'] = 'Welche IP/Port-Kombination sollen standardmäßig verwendet werden?'; -$lng['serversettings']['defaultsslip']['title'] = 'Standard SSL IP/Port-Kombination'; -$lng['serversettings']['defaultsslip']['description'] = 'Welche ssl-fähigen IP/Port-Kombination sollen standardmäßig verwendet werden?'; -$lng['domains']['statstics'] = 'Statistiken'; -$lng['panel']['ascending'] = 'aufsteigend'; -$lng['panel']['descending'] = 'absteigend'; -$lng['panel']['search'] = 'Suche'; -$lng['panel']['used'] = 'genutzt'; - -// ADDED IN 1.2.14-rc3 - -$lng['panel']['translator'] = 'Übersetzung'; - -// ADDED IN 1.2.14-rc4 - -$lng['error']['stringformaterror'] = 'Der Wert des Feldes "%s" hat nicht das erwartete Format.'; - -// ADDED IN 1.2.15-rc1 - -$lng['admin']['serversoftware'] = 'Webserver'; -$lng['admin']['phpversion'] = 'PHP-Version'; -$lng['admin']['mysqlserverversion'] = 'MySQL-Server-Version'; -$lng['admin']['webserverinterface'] = 'Webserver-Interface'; -$lng['domains']['isassigneddomain'] = 'zugewiesene Domain'; -$lng['serversettings']['phpappendopenbasedir']['title'] = 'Anzuhängende Pfade bei OpenBasedir'; -$lng['serversettings']['phpappendopenbasedir']['description'] = 'Diese (durch Doppelpunkte getrennten) Pfade werden dem OpenBasedir-Statement in jedem vHost-Container angehängt.'; - -// CHANGED IN 1.2.15-rc1 - -$lng['error']['loginnameissystemaccount'] = 'Sie können keinen Account anlegen, der wie ein Systemaccount aussieht (also zum Beispiel mit "%s" anfängt). Bitte wählen Sie einen anderen Accountnamen.'; -$lng['error']['youcantdeleteyourself'] = 'Aus Sicherheitsgründen können Sie sich nicht selbst löschen.'; -$lng['error']['youcanteditallfieldsofyourself'] = 'Hinweis: Aus Sicherheitsgründen können Sie nicht alle Felder Ihres eigenen Accounts bearbeiten.'; - -// ADDED IN 1.2.16-svn1 - -$lng['serversettings']['natsorting']['title'] = 'Natürliche Sortierung in der Listenansicht nutzen'; -$lng['serversettings']['natsorting']['description'] = 'Sortiert die Liste in der Reihenfolge web1 -> web2 -> web11 statt web1 -> web11 -> web2.'; - -// ADDED IN 1.2.16-svn2 - -$lng['serversettings']['deactivateddocroot']['title'] = 'Docroot für deaktivierte Benutzer'; -$lng['serversettings']['deactivateddocroot']['description'] = 'Dieser Pfad wird als Docroot für deaktivierte Benutzer verwendet. Ist das Feld leer, wird kein vHost erstellt.'; - -// ADDED IN 1.2.16-svn4 - -$lng['panel']['reset'] = 'Änderungen verwerfen'; -$lng['admin']['accountsettings'] = 'Konteneinstellungen'; -$lng['admin']['panelsettings'] = 'Panel-Einstellungen'; -$lng['admin']['systemsettings'] = 'Systemeinstellungen'; -$lng['admin']['webserversettings'] = 'Webserver-Einstellungen'; -$lng['admin']['mailserversettings'] = 'Mailserver-Einstellungen'; -$lng['admin']['nameserversettings'] = 'Nameserver-Einstellungen'; -$lng['admin']['updatecounters'] = 'Ressourcenverbrauch'; -$lng['question']['admin_counters_reallyupdate'] = 'Wollen Sie den Ressourcenverbrauch neu berechnen?'; -$lng['panel']['pathDescription'] = 'Sollte das Verzeichnis nicht existieren, wird es automatisch erstellt.'; -$lng['panel']['pathDescriptionEx'] = '
Sollte eine Weiterleitung auf eine andere Domain gewünscht sein, muss der Eintrag mit http:// oder https:// beginnen.'; -$lng['panel']['pathDescriptionSubdomain'] = $lng['panel']['pathDescription'] . $lng['panel']['pathDescriptionEx'] . "
Endet die URL mit einem / (Slash) geht Froxlor von einem Ordner aus, wenn nicht, wird es wie eine Datei behandelt."; - -// ADDED IN 1.2.16-svn6 - -$lng['admin']['templates']['TRAFFIC'] = 'Wird mit Traffic, der dem Kunden zugewiesen wurde, ersetzt (in MB).'; -$lng['admin']['templates']['TRAFFICUSED'] = 'Wird mit Traffic, der vom Kunden bereits verbraucht wurde, ersetzt (in MB).'; - -// ADDED IN 1.2.16-svn7 - -$lng['admin']['subcanemaildomain']['never'] = 'Nie'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'Wählbar, Standardwert: Nein'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'Wählbar, Standardwert: Ja'; -$lng['admin']['subcanemaildomain']['always'] = 'Immer'; -$lng['changepassword']['also_change_stats'] = ' Auch Passwort der Statistikseite ändern'; - -// ADDED IN 1.2.16-svn8 - -$lng['serversettings']['mailpwcleartext']['title'] = 'Passwörter der Mail-Konten auch im Klartext in der Datenbank speichern'; -$lng['serversettings']['mailpwcleartext']['description'] = 'Wenn diese Einstellung auf Ja gesetzt wird, werden alle Passwörter auch unverschlüsselt (also im Klartext, für jeden mit Zugriff auf die Froxlor-Datenbank sofort lesbar) in der mail_users-Tabelle gespeichert. Aktivieren Sie diese Option nur dann, wenn Sie SASL nutzen!'; -$lng['admin']['wipecleartextmailpwd'] = 'Klartext-Passwörter leeren'; -$lng['question']['admin_cleartextmailpws_reallywipe'] = 'Wollen Sie wirklich alle unverschlüsselten Passwörter aus der Tabelle mail_users entfernen? Dieser Schritt kann nicht rückgängig gemacht werden! Die Einstellung für das Speichern der E-Mail-Konten-Passwörter in Klartext wird hierbei ebenfalls deaktiviert.'; -$lng['admin']['configfiles']['overview'] = 'Übersicht'; -$lng['admin']['configfiles']['wizard'] = 'Assistent'; -$lng['admin']['configfiles']['distribution'] = 'Distribution'; -$lng['admin']['configfiles']['service'] = 'Service'; -$lng['admin']['configfiles']['daemon'] = 'Daemon'; -$lng['admin']['configfiles']['http'] = 'Webserver (HTTP)'; -$lng['admin']['configfiles']['dns'] = 'Nameserver (DNS)'; -$lng['admin']['configfiles']['mail'] = 'Mailserver (IMAP/POP3)'; -$lng['admin']['configfiles']['smtp'] = 'Mailserver (SMTP)'; -$lng['admin']['configfiles']['ftp'] = 'FTP-Server'; -$lng['admin']['configfiles']['etc'] = 'Sonstige (System)'; -$lng['admin']['configfiles']['choosedistribution'] = '-- Distribution wählen --'; -$lng['admin']['configfiles']['chooseservice'] = '-- Service wählen --'; -$lng['admin']['configfiles']['choosedaemon'] = '-- Daemon wählen --'; - -// ADDED IN 1.2.16-svn10 - -$lng['serversettings']['ftpdomain']['title'] = 'FTP-Benutzerkonten @domain'; -$lng['serversettings']['ftpdomain']['description'] = 'Können Kunden FTP-Benutzerkonten user@domain anlegen?'; -$lng['panel']['back'] = 'Zurück'; - -// ADDED IN 1.2.16-svn12 - -$lng['serversettings']['mod_fcgid']['title'] = 'PHP über mod_fcgid/suexec einbinden'; -$lng['serversettings']['mod_fcgid']['description'] = 'PHP wird unter dem Benutzer des Kunden ausgeführt.

Dies benötigt eine spezielle Webserver-Konfiguration für Apache, siehe FCGID-Handbuch.'; -$lng['serversettings']['sendalternativemail']['title'] = 'Alternative E-Mail-Adresse benutzen'; -$lng['serversettings']['sendalternativemail']['description'] = 'Während des Erstellens eines Accounts das Passwort an eine andere E-Mail-Adresse senden'; -$lng['emails']['alternative_emailaddress'] = 'Alternative E-Mail-Adresse'; -$lng['mails']['pop_success_alternative']['mailbody'] = 'Hallo,\n\nihr E-Mail-Konto {USERNAME}\nwurde erfolgreich eingerichtet.\nIhr Passwort lautet {PASSWORD}.\n\nDies ist eine automatisch generierte\neMail, bitte antworten Sie nicht auf\ndiese Mitteilung.\n\nIhr Administrator'; -$lng['mails']['pop_success_alternative']['subject'] = 'E-Mail-Konto erfolgreich eingerichtet'; -$lng['admin']['templates']['pop_success_alternative'] = 'Willkommensmail für neue E-Mail-Konten für die alternative E-Mail-Adresse'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Wird mit dem Passwort des neuen POP3/IMAP Kontos ersetzt.'; - -// ADDED IN 1.2.16-svn13 - -$lng['error']['documentrootexists'] = 'Es existiert noch ein Verzeichnis "%s" für diesen Kunden. Bitte löschen Sie dieses vorher.'; - -// ADDED IN 1.2.16-svn14 - -$lng['serversettings']['apacheconf_vhost']['title'] = 'Webserver vHost-Konfigurations-Datei/Verzeichnis-Name'; -$lng['serversettings']['apacheconf_vhost']['description'] = 'Wo sollen die vHost-Konfigurationen abgelegt werden? Sie können entweder eine Datei (also mit allen vHosts) oder einen Ordner (mit einer Datei pro vHost) angeben.'; -$lng['serversettings']['apacheconf_diroptions']['title'] = 'Webserver Verzeichnisoption-Konfigurations-Datei/Verzeichnis-Name'; -$lng['serversettings']['apacheconf_diroptions']['description'] = 'Wo sollen die Verzeichnisoption-Konfigurationen abgelegt werden? Sie können entweder eine Datei (also mit allen vHosts) oder einen Ordner (mit einer Datei pro vHost) angeben.'; -$lng['serversettings']['apacheconf_htpasswddir']['title'] = 'Webserver htpasswd Verzeichnisname'; -$lng['serversettings']['apacheconf_htpasswddir']['description'] = 'Wo sollen die htpasswd-Dateien für den Verzeichnisschutz abgelegt werden?'; - -// ADDED IN 1.2.16-svn15 - -$lng['error']['formtokencompromised'] = 'Das Formular scheint manipuliert worden zu sein. Aus Sicherheitsgründen wurden Sie ausgelogged.'; -$lng['serversettings']['mysql_access_host']['title'] = 'MySQL-Access-Hosts'; -$lng['serversettings']['mysql_access_host']['description'] = 'Eine durch Komma getrennte Liste mit den Hostnamen aller Hostnames/IP-Adressen, von denen sich die Benutzer einloggen dürfen. Um ein Subnetz zu erlauben ist die Netzmaske oder CIDR Syntax erlaubt.'; - -// ADDED IN 1.2.18-svn1 - -$lng['admin']['ipsandports']['create_listen_statement'] = 'Erstelle Listen-Eintrag'; -$lng['admin']['ipsandports']['create_namevirtualhost_statement'] = 'Erstelle NameVirtualHost-Eintrag'; -$lng['admin']['ipsandports']['create_vhostcontainer'] = 'Erstelle vHost-Container'; -$lng['admin']['ipsandports']['create_vhostcontainer_servername_statement'] = 'Erstelle ServerName-Eintrag im vHost-Container'; - -// ADDED IN 1.2.18-svn2 - -$lng['admin']['webalizersettings'] = 'Webalizereinstellungen'; -$lng['admin']['webalizer']['normal'] = 'Normal'; -$lng['admin']['webalizer']['quiet'] = 'Leise'; -$lng['admin']['webalizer']['veryquiet'] = 'Keine Ausgaben'; -$lng['serversettings']['webalizer_quiet']['title'] = 'Webalizerausgabe'; -$lng['serversettings']['webalizer_quiet']['description'] = 'Ausgabefreudigkeit des Webalizer-Programms'; - -// ADDED IN 1.2.18-svn4 - -$lng['admin']['domain_nocustomeraddingavailable'] = 'Es können derzeit keine Domains angelegt werden. Sie müssen zuerst einen Kunden anlegen'; - -// ADDED IN 1.2.19-svn - -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Konfigurations-Verzeichnis'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Wo sollen alle Konfigurationsdateien von fcgid liegen? Wenn Sie keine selbst kompilierte suexec Binary benutzen, was in der Regel der Fall ist, muss dieser Pfad unter /var/www/ liegen.

ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.
'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Temporäres Verzeichnis'; - -// ADDED IN 1.2.19-svn4 - -$lng['menue']['traffic']['traffic'] = 'Traffic'; -$lng['menue']['traffic']['current'] = 'Aktueller Monat'; -$lng['traffic']['month'] = "Monat"; -$lng['traffic']['months'][1] = "Januar"; -$lng['traffic']['months'][2] = "Februar"; -$lng['traffic']['months'][3] = "März"; -$lng['traffic']['months'][4] = "April"; -$lng['traffic']['months'][5] = "Mai"; -$lng['traffic']['months'][6] = "Juni"; -$lng['traffic']['months'][7] = "Juli"; -$lng['traffic']['months'][8] = "August"; -$lng['traffic']['months'][9] = "September"; -$lng['traffic']['months'][10] = "Oktober"; -$lng['traffic']['months'][11] = "November"; -$lng['traffic']['months'][12] = "Dezember"; -$lng['traffic']['mb'] = "Traffic"; -$lng['traffic']['day'] = "Tag"; -$lng['traffic']['distribution'] = 'FTP | HTTP | Mail'; -$lng['traffic']['sumhttp'] = 'Gesamt HTTP-Traffic'; -$lng['traffic']['sumftp'] = 'Gesamt FTP-Traffic'; -$lng['traffic']['summail'] = 'Gesamt Mail-Traffic'; - -// ADDED IN 1.2.19-svn6 - -$lng['admin']['loggersettings'] = 'Log-Einstellungen'; -$lng['serversettings']['logger']['enable'] = 'Logging ja/nein'; -$lng['serversettings']['logger']['severity'] = 'Logging Level'; -$lng['admin']['logger']['normal'] = 'Normal'; -$lng['admin']['logger']['paranoid'] = 'Paranoid'; -$lng['serversettings']['logger']['types']['title'] = 'Log-Art(en)'; -$lng['serversettings']['logger']['types']['description'] = 'Wählen Sie hier die gewünschten Logtypen. Für Mehrfachauswahl, halten Sie während der Auswahl STRG gedrückt
Mögliche Logtypen sind: syslog, file, mysql'; -$lng['serversettings']['logger']['logfile'] = 'Log-Datei Pfad inklusive Dateinamen'; -$lng['error']['logerror'] = 'Log-Fehler: "%s"'; -$lng['serversettings']['logger']['logcron'] = 'Logge Cronjobs'; -$lng['serversettings']['logger']['logcronoption']['never'] = 'Nie'; -$lng['serversettings']['logger']['logcronoption']['once'] = 'Einmalig'; -$lng['serversettings']['logger']['logcronoption']['always'] = 'Immer'; -$lng['question']['logger_reallytruncate'] = 'Wollen Sie die Tabelle "%s" wirklich leeren?'; -$lng['admin']['loggersystem'] = 'System-Log'; -$lng['logger']['date'] = 'Datum'; -$lng['logger']['type'] = 'Typ'; -$lng['logger']['action'] = 'Aktion'; -$lng['logger']['user'] = 'Benutzer'; -$lng['logger']['truncate'] = 'Log leeren'; - -// ADDED IN 1.2.19-svn7 - -$lng['serversettings']['ssl']['use_ssl']['title'] = 'Aktiviere SSL'; -$lng['serversettings']['ssl']['use_ssl']['description'] = 'Erlaubt die Nutzung von SSL für den Webserver'; -$lng['serversettings']['ssl']['ssl_cert_file']['title'] = 'Pfad zum SSL-Zertifikat'; -$lng['serversettings']['ssl']['ssl_cert_file']['description'] = 'Geben Sie den Pfad inklusive Dateinamen des Zertifikats an (meist .crt or .pem).'; -$lng['serversettings']['ssl']['openssl_cnf'] = 'Standardwerte zum Erstellen eines Zertifikats'; -$lng['panel']['reseller'] = 'Reseller'; -$lng['panel']['admin'] = 'Administrator'; -$lng['panel']['customer'] = 'Kunde/n'; -$lng['error']['nomessagetosend'] = 'Keine Nachricht angegeben'; -$lng['error']['norecipientsgiven'] = 'Keine Empfänger angegeben'; -$lng['admin']['emaildomain'] = 'E-Mail-Domain'; -$lng['admin']['email_only'] = 'Nur als E-Mail-Domain verwenden?'; -$lng['admin']['wwwserveralias'] = 'Einen "www." ServerAlias hinzufügen'; -$lng['admin']['ipsandports']['enable_ssl'] = 'Ist dies ein SSL-Port?'; -$lng['admin']['ipsandports']['ssl_cert_file'] = 'Pfad zum Zertifikat'; -$lng['panel']['send'] = 'Versenden'; -$lng['admin']['subject'] = 'Betreff'; -$lng['admin']['recipient'] = 'Empfänger'; -$lng['admin']['message'] = 'Rundmail senden'; -$lng['admin']['text'] = 'Nachricht'; -$lng['menu']['message'] = 'Nachrichten'; -$lng['error']['errorsendingmail'] = 'Das Versenden der Nachricht an "%s" schlug fehl.'; -$lng['error']['cannotreaddir'] = 'Der Ordner "%s" kann nicht gelesen werden'; -$lng['success']['messages_success'] = 'Nachricht erfolgreich an "%s" Empfänger gesendet'; -$lng['message']['norecipients'] = 'Es wurde keine E-Mail versendet, da sich keine Empfänger in der Datenbank befinden'; -$lng['admin']['sslsettings'] = 'SSL-Einstellungen'; -$lng['cronjobs']['notyetrun'] = 'Bisher nicht gestartet'; -$lng['serversettings']['default_vhostconf']['title'] = 'Standard vHost-Einstellungen'; -$lng['admin']['specialsettings_replacements'] = "Die folgenden Variablen können verwendet werden:
{DOMAIN}, {DOCROOT}, {CUSTOMER}, {IP}, {PORT}, {SCHEME}, {FPMSOCKET} (wenn zutreffend)
"; -$lng['serversettings']['default_vhostconf']['description'] = 'Der Inhalt dieses Feldes wird direkt in den IP/Port-vHost-Container übernommen. ' . $lng['admin']['specialsettings_replacements'] . '
ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Der Webserver könnte nicht mehr starten!'; -$lng['serversettings']['default_vhostconf_domain']['description'] = 'Der Inhalt dieses Feldes wird direkt in jeden Domain-vHost-Container übernommen. ' . $lng['admin']['specialsettings_replacements'] . 'ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Der Webserver könnte nicht mehr starten!'; -$lng['serversettings']['apache_globaldiropt']['title'] = 'Kunden-Prefix Ordner-Optionen'; -$lng['serversettings']['apache_globaldiropt']['description'] = 'Der Inhalt dieses Feldes wird in die 05_froxlor_dirfix_nofcgid.conf Apache Konfigurationsdatei eingefügt. Wenn leer werden folgende Standardwerte verwendet:

apache >=2.4
Require all granted
AllowOverride All

apache <=2.2
Order allow,deny
allow from all'; -$lng['error']['invalidip'] = 'Ungültige IP-Adresse: "%s"'; -$lng['serversettings']['decimal_places'] = 'Nachkommastellen bei der Ausgabe von Traffic/Webspace'; - -// ADDED IN 1.2.19-svn8 - -$lng['admin']['dkimsettings'] = 'DomainKey-Einstellungen'; -$lng['dkim']['dkim_prefix']['title'] = 'Prefix'; -$lng['dkim']['dkim_prefix']['description'] = 'Wie lautet der Pfad zu den DKIM-RSA-Dateien sowie den Einstellungsdateien des Milter-Plugins?'; -$lng['dkim']['dkim_domains']['title'] = 'Domains-Dateiname'; -$lng['dkim']['dkim_domains']['description'] = 'Dateiname der DKIM-Domains-Angabe aus der DKIM-Milter-Konfigurationsdatei.'; -$lng['dkim']['dkim_dkimkeys']['title'] = 'KeyList Dateiname'; -$lng['dkim']['dkim_dkimkeys']['description'] = 'Dateiname der DKIM-KeyList-Angabe aus der DKIM-Milter-Konfigurationsdatei.'; -$lng['dkim']['dkimrestart_command']['title'] = 'Milter-Restart-Kommando'; -$lng['dkim']['dkimrestart_command']['description'] = 'Wie lautet das Kommando zum Neustarten des DKIM-Milter-Dienstes?'; -$lng['dkim']['privkeysuffix']['title'] = 'Suffix für Private Keys'; -$lng['dkim']['privkeysuffix']['description'] = 'Hier kann eine (optionale) Dateiendung für die generierten Private Keys angegeben werden. Manche Dienste, wie dkim-filter, erwarten, dass die Schlüssel keine Dateiendung haben (leer).'; - -// ADDED IN 1.2.19-svn9 - -$lng['admin']['caneditphpsettings'] = 'Kann PHP-bezogene Domaineinstellungen vornehmen?'; - -// ADDED IN 1.2.19-svn12 - -$lng['admin']['allips'] = 'Alle IP-Adressen'; -$lng['panel']['nosslipsavailable'] = 'Für diesen Server wurden noch keine SSL IP/Port Kombinationen eingetragen'; -$lng['dkim']['use_dkim']['title'] = 'DKIM-Support aktivieren?'; -$lng['dkim']['use_dkim']['description'] = 'Wollen Sie das Domain-Keys-System (DKIM) benutzen?
Hinweis: Derzeit wird DKIM nur via dkim-filter unterstützt, nicht opendkim.'; -$lng['error']['invalidmysqlhost'] = 'Ungültige MySQL-Host-Adresse: "%s"'; -$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'Webalizer und AWstats können nicht zur gleichen Zeit aktiviert werden, bitte wählen Sie eines aus.'; -$lng['serversettings']['webalizer_enabled'] = 'Nutze Webalizer-Statistiken'; -$lng['serversettings']['awstats_enabled'] = 'Nutze AWStats-Statistiken'; -$lng['admin']['awstatssettings'] = 'AWstats-Einstellungen'; - -// ADDED IN 1.2.19-svn16 - -$lng['admin']['domain_dns_settings'] = 'Domain-DNS-Einstellungen'; -$lng['dns']['destinationip'] = 'Domain-IP-Adresse(n)'; -$lng['dns']['standardip'] = 'Server-Standard-IP-Adresse'; -$lng['dns']['a_record'] = 'A-Eintrag (IPv6 optional)'; -$lng['dns']['cname_record'] = 'CNAME-Eintrag'; -$lng['dns']['mxrecords'] = 'MX Einträge definieren'; -$lng['dns']['standardmx'] = 'Server Standard MX Eintrag'; -$lng['dns']['mxconfig'] = 'Eigene MX Einträge'; -$lng['dns']['priority10'] = 'Priorität 10'; -$lng['dns']['priority20'] = 'Priorität 20'; -$lng['dns']['txtrecords'] = 'TXT-Einträge definieren'; -$lng['dns']['txtexample'] = 'Beispiel (SPF-Eintrag):
v=spf1 ip4:xxx.xxx.xx.0/23 -all'; -$lng['serversettings']['selfdns']['title'] = 'Manuelle DNS-Einstellungen für Domains'; -$lng['serversettings']['selfdnscustomer']['title'] = 'Erlaube Kunden eigene DNS-Einstellungen vorzunehmen.'; -$lng['admin']['activated'] = 'Aktiviert'; -$lng['admin']['statisticsettings'] = 'Statistik-Einstellungen'; -$lng['admin']['or'] = 'oder'; - -// ADDED IN 1.2.19-svn17 - -$lng['serversettings']['unix_names']['title'] = 'Benutze UNIX-kompatible Benutzernamen.'; -$lng['serversettings']['unix_names']['description'] = 'Erlaubt die Nutzung von - und _ in Benutzernamen wenn Nein.'; -$lng['error']['cannotwritetologfile'] = 'Logdatei "%s" konnte nicht für Schreiboperationen geöffnet werden.'; -$lng['admin']['sysload'] = 'System-Auslastung'; -$lng['admin']['noloadavailable'] = 'nicht verfügbar'; -$lng['admin']['nouptimeavailable'] = 'nicht verfügbar'; -$lng['panel']['backtooverview'] = 'Zurück zur Übersicht'; -$lng['admin']['nosubject'] = '(Kein Betreff)'; -$lng['admin']['configfiles']['statistics'] = 'Statistik'; -$lng['login']['forgotpwd'] = 'Passwort vergessen?'; -$lng['login']['presend'] = 'Passwort zurücksetzen'; -$lng['login']['email'] = 'E-Mail-Adresse'; -$lng['login']['remind'] = 'Passwort zurücksetzen'; -$lng['login']['usernotfound'] = 'Fehler: Unbekannter Benutzer!'; -$lng['mails']['password_reset']['subject'] = 'Passwort zurückgesetzt'; -$lng['mails']['password_reset']['mailbody'] = 'Hallo {SALUTATION},\n\nhiermit erhalten Sie den Link, um ein neues Passwort zu setzen. Dieser Link ist für die nächsten 24 Stunden gültig.\n\n{LINK}\n\nVielen Dank,\nIhr Administrator'; -$lng['pwdreminder']['success'] = 'Das Zurücksetzen des Passworts wurde erfolgreich angefordert. Sie sollten nun eine E-Mail mit weiteren Anweisungen erhalten.'; - -// ADDED IN 1.2.19-svn18 - -$lng['serversettings']['allow_password_reset']['title'] = 'Erlaube das Zurücksetzen des Kundenpassworts.'; -$lng['pwdreminder']['notallowed'] = 'Das Zurücksetzen des Passworts ist deaktiviert.'; - -// ADDED IN 1.2.19-svn21 - -$lng['customer']['title'] = 'Titel'; -$lng['customer']['country'] = 'Land'; -$lng['panel']['dateformat'] = 'JJJJ-MM-TT'; -$lng['panel']['dateformat_function'] = 'd.m.Y'; - -// Y = Year, m = Month, d = Day - -$lng['panel']['timeformat_function'] = 'H:i:s'; - -// H = Hour, i = Minute, s = Second - -$lng['panel']['default'] = 'Standard'; -$lng['panel']['never'] = 'Nie'; -$lng['panel']['active'] = 'Aktiv'; -$lng['panel']['please_choose'] = 'Bitte auswählen'; -$lng['panel']['allow_modifications'] = 'Änderungen zulassen'; -$lng['domains']['add_date'] = 'Zu Froxlor hinzugefügt'; -$lng['domains']['registration_date'] = 'Registriert am'; -$lng['domains']['topleveldomain'] = 'Top-Level-Domain'; - -// ADDED IN 1.2.19-svn22 - -$lng['serversettings']['allow_password_reset']['description'] = 'Kunden können ihr Passwort zurücksetzen und bekommen einen Aktivierungs-Link per E-Mail zugesandt'; -$lng['serversettings']['allow_password_reset_admin']['title'] = 'Erlaube das Zurücksetzen von Admin-/Reseller-Passwörtern.'; -$lng['serversettings']['allow_password_reset_admin']['description'] = 'Admins/Reseller können ihr Passwort zurücksetzen und bekommen einen Aktivierungs-Link per E-Mail zugesandt'; - -// ADDED IN 1.2.19-svn25 -// Mailquota - -$lng['emails']['quota'] = 'Kontingent'; -$lng['emails']['noquota'] = 'Kein Kontingent'; -$lng['emails']['updatequota'] = 'Update Kontingent'; -$lng['serversettings']['mail_quota']['title'] = 'Mailbox-Kontingent'; -$lng['serversettings']['mail_quota']['description'] = 'Standard-Kontingent für neu erstellte E-Mail-Benutzerkonten (Megabyte).'; -$lng['serversettings']['mail_quota_enabled']['title'] = 'Nutze E-Mail-Kontingent für Kunden'; -$lng['serversettings']['mail_quota_enabled']['description'] = 'Aktiviere Kontingent für E-Mail-Konten. Standard ist Nein, da dies eine spezielle Konfiguration voraussetzt.'; -$lng['serversettings']['mail_quota_enabled']['removelink'] = 'Hier klicken, um alle E-Mail-Kontingente zu entfernen'; -$lng['serversettings']['mail_quota_enabled']['enforcelink'] = 'Hier klicken, um allen Benutzern das Standard-Kontingent zu zuweisen.'; -$lng['question']['admin_quotas_reallywipe'] = 'Sind Sie sicher, dass alle E-Mail-Kontingente aus der Tabelle mail_users entfernt werden sollen? Dieser Schritt kann nicht rückgängig gemacht werden!'; -$lng['question']['admin_quotas_reallyenforce'] = 'Sind Sie sicher, dass Sie allen Benutzern das Default-Quota zuweisen wollen? Dies kann nicht rückgängig gemacht werden!'; -$lng['error']['vmailquotawrong'] = 'Die Kontingent-Größe muss positiv sein.'; -$lng['customer']['email_quota'] = 'E-Mail-Kontingent'; -$lng['customer']['email_imap'] = 'IMAP'; -$lng['customer']['email_pop3'] = 'POP3'; -$lng['customer']['mail_quota'] = 'E-Mail-Kontingent'; -$lng['panel']['megabyte'] = 'Megabyte'; -$lng['emails']['quota_edit'] = 'E-Mail-Kontingent ändern'; -$lng['panel']['not_supported'] = 'Nicht unterstützt in: '; -$lng['error']['allocatetoomuchquota'] = 'Sie versuchen "%s" MB Kontingent zu zuweisen, haben aber nicht genug übrig.'; - -$lng['error']['missingfields'] = 'Es wurden nicht alle Felder augefüllt.'; -$lng['error']['accountnotexisting'] = 'Der angegebene E-Mail-Account existiert nicht.'; -$lng['admin']['show_version_login']['title'] = 'Zeige Froxlor Version beim Login'; -$lng['admin']['show_version_login']['description'] = 'Zeige Froxlor Version in der Fußzeile der Loginseite'; -$lng['admin']['show_version_footer']['title'] = 'Zeige Froxlor Version in Fußzeile'; -$lng['admin']['show_version_footer']['description'] = 'Zeige Froxlor Version in der Fußzeile aller anderen Seiten'; -$lng['admin']['froxlor_graphic']['title'] = 'Grafik im Kopfbereich des Panels'; -$lng['admin']['froxlor_graphic']['description'] = 'Welche Grafik soll im Kopfbereich des Panels anstatt des Froxlor Logos angezeigt werden?'; - -// improved froxlor - -$lng['menue']['phpsettings']['maintitle'] = 'PHP-Konfigurationen'; -$lng['admin']['phpsettings']['title'] = 'PHP-Konfiguration'; -$lng['admin']['phpsettings']['description'] = 'Kurzbeschreibung'; -$lng['admin']['phpsettings']['actions'] = 'Aktionen'; -$lng['admin']['phpsettings']['activedomains'] = 'In Verwendung für Domain(s)'; -$lng['admin']['phpsettings']['notused'] = 'Konfiguration wird nicht verwendet'; -$lng['admin']['misc'] = 'Sonstiges'; -$lng['admin']['phpsettings']['editsettings'] = 'PHP-Konfiguration bearbeiten'; -$lng['admin']['phpsettings']['addsettings'] = 'PHP-Konfiguration erstellen'; -$lng['admin']['phpsettings']['viewsettings'] = 'PHP-Konfiguration ansehen'; -$lng['admin']['phpsettings']['phpinisettings'] = 'php.ini-Einstellungen'; -$lng['error']['nopermissionsorinvalidid'] = 'Entweder fehlen Ihnen die nötigen Rechte diese Einstellung zu ändern oder es wurde eine ungültige ID übergeben'; -$lng['panel']['view'] = 'ansehen'; -$lng['question']['phpsetting_reallydelete'] = 'Wollen Sie diese PHP-Einstellungen wirklich löschen? Alle Domains die diese Einstellungen bis jetzt verwendet haben, werden dann auf die Standardeinstellungen umgestellt.'; -$lng['question']['fpmsetting_reallydelete'] = 'Wollen Sie diese PHP-FPM Einstellungen wirklich löschen? Alle PHP Konfigurationen die diese Einstellungen bis jetzt verwendet haben, werden dann auf die Standardeinstellungen umgestellt.'; -$lng['admin']['phpsettings']['addnew'] = 'Neue PHP Konfiguration erstellen'; -$lng['admin']['fpmsettings']['addnew'] = 'Neue PHP Version erstellen'; -$lng['error']['phpsettingidwrong'] = 'Eine PHP-Konfiguration mit dieser ID existiert nicht'; -$lng['error']['descriptioninvalid'] = 'Der Beschreibungstext ist zu kurz, zu lang oder enthält ungültige Zeichen'; -$lng['error']['info'] = 'Info'; -$lng['admin']['phpconfig']['template_replace_vars'] = 'Variablen, die in den Konfigurationen ersetzt werden'; -$lng['admin']['phpconfig']['pear_dir'] = 'Wird mit dem globalen Wert für das Include Verzeichnis ersetzt.'; -$lng['admin']['phpconfig']['open_basedir_c'] = 'Wird mit einem ; (Semikolon) ersetzt, um open_basedir auszukommentieren/deaktivieren, wenn eingestellt.'; -$lng['admin']['phpconfig']['open_basedir'] = 'Wird mit der open_basedir-Einstellung der Domain ersetzt.'; -$lng['admin']['phpconfig']['tmp_dir'] = 'Wird mit der Einstellung für das temporäre Verzeichnis der Domain ersetzt.'; -$lng['admin']['phpconfig']['open_basedir_global'] = 'Wird mit der globalen Einstellung des Pfades ersetzt, der dem open_basedir hinzugefügt wird (siehe Webserver Einstellungen).'; -$lng['admin']['phpconfig']['customer_email'] = 'Wird mit der E-Mail-Adresse des Kunden ersetzt, dem die Domain gehört.'; -$lng['admin']['phpconfig']['admin_email'] = 'Wird mit der E-Mail-Adresse des Admins ersetzt, dem die Domain gehört.'; -$lng['admin']['phpconfig']['domain'] = 'Wird mit der Domain ersetzt.'; -$lng['admin']['phpconfig']['customer'] = 'Wird mit dem Loginnamen des Kunden ersetzt, dem die Domain gehört.'; -$lng['admin']['phpconfig']['admin'] = 'Wird mit dem Loginnamen des Admins ersetzt, dem die Domain gehört.'; -$lng['admin']['phpconfig']['docroot'] = 'Wird mit dem Heimatverzeichnis der Domain ersetzt.'; -$lng['admin']['phpconfig']['homedir'] = 'Wird mit dem Heimatverzeichnis des Kunden ersetzt.'; -$lng['login']['backtologin'] = 'Zurück zum Login'; -$lng['serversettings']['mod_fcgid']['starter']['title'] = 'Prozesse je Domain'; -$lng['serversettings']['mod_fcgid']['starter']['description'] = 'Wieviele PHP-Prozesse pro Domain sollen gestartet/erlaubt werden. Der Wert 0 wird empfohlen, da PHP die Anzahl dann selbst effizient verwaltet.'; -$lng['serversettings']['mod_fcgid']['wrapper']['title'] = 'Wrappereinbindung in Vhosts'; -$lng['serversettings']['mod_fcgid']['wrapper']['description'] = 'Wie sollen die Wrapper in den Vhosts eingebunden werden'; -$lng['serversettings']['mod_fcgid']['tmpdir']['description'] = 'Wo sollen die temporären Verzeichnisse erstellt werden'; -$lng['admin']['know_what_youre_doing'] = 'Ändern Sie diese Einstellungen nur, wenn Sie wissen was Sie tun!'; -$lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Globale PEAR Verzeichnisse'; -$lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Welche globalen PEAR Verzeichnisse sollen in den php.ini-Einstellungen ersetzt werden? Einzelne Verzeichnisse sind mit einem Doppelpunkt zu trennen.'; - -// improved Froxlor 2 - -$lng['admin']['templates']['index_html'] = 'index.html Datei für neu erzeugte Kundenverzeichnisse'; -$lng['admin']['templates']['SERVERNAME'] = 'Wird mit dem Servernamen ersetzt.'; -$lng['admin']['templates']['CUSTOMER'] = 'Wird mit dem Loginnamen des Kunden ersetzt.'; -$lng['admin']['templates']['ADMIN'] = 'Wird mit dem Loginnamen des Admins ersetzt.'; -$lng['admin']['templates']['CUSTOMER_EMAIL'] = 'Wird mit der E-Mail-Adresse des Kunden ersetzt.'; -$lng['admin']['templates']['ADMIN_EMAIL'] = 'Wird mit der E-Mail-Adresse des Admin ersetzt.'; -$lng['admin']['templates']['filetemplates'] = 'Dateivorlagen'; -$lng['admin']['templates']['filecontent'] = 'Dateiinhalt'; -$lng['error']['filecontentnotset'] = 'Diese Datei darf nicht leer sein!'; -$lng['serversettings']['index_file_extension']['description'] = 'Welche Dateiendung soll die index Datei in neu erstellten Kundenverzeichnissen haben? Diese Dateiendung wird dann verwendet, wenn Sie bzw. einer Ihrer Admins eigene index Dateivorlagen erstellt haben.'; -$lng['serversettings']['index_file_extension']['title'] = 'Dateiendung für index Datei in neu erstellen Kundenverzeichnissen'; -$lng['error']['index_file_extension'] = 'Die Dateiendung für die index Datei muss zwischen 1 und 6 Zeichen lang sein und darf nur aus den Zeichen a-z, A-Z und 0-9 bestehen'; -$lng['admin']['security_settings'] = 'Sicherheitseinstellungen'; -$lng['admin']['expert_settings'] = 'Experteneinstellungen!'; -$lng['admin']['mod_fcgid_starter']['title'] = 'PHP-Prozesse für diese Domain (leer für Standardwert)'; - -$lng['error']['customerdoesntexist'] = 'Der ausgewählte Kunde existiert nicht.'; -$lng['error']['admindoesntexist'] = 'Der ausgewählte Admin existiert nicht.'; - -// ADDED IN 1.2.19-svn37 - -$lng['serversettings']['session_allow_multiple_login']['title'] = 'Erlaube gleichzeitigen Login'; -$lng['serversettings']['session_allow_multiple_login']['description'] = 'Wenn diese Option aktiviert ist, können sich Nutzer mehrmals gleichzeitig anmelden.'; -$lng['serversettings']['panel_allow_domain_change_admin']['title'] = 'Erlaube Verschieben von Domains unter Admins'; -$lng['serversettings']['panel_allow_domain_change_admin']['description'] = 'Wenn diese Option aktiviert ist, kann unter Domaineinstellungen die Domain einem anderen Admin zugewiesen werden.
Achtung: Wenn der Kunde einer Domain nicht dem gleichen Admin zugeordnet ist wie die Domain selbst, kann dieser Admin alle anderen Domains des Kunden sehen!'; -$lng['serversettings']['panel_allow_domain_change_customer']['title'] = 'Erlaube Verschieben von Domains unter Kunden'; -$lng['serversettings']['panel_allow_domain_change_customer']['description'] = 'Wenn diese Option aktiviert ist, kann unter Domaineinstellungen die Domain einem anderen Kunden zugewiesen werden.
Achtung: Der Dokumenten-Pfad der Domain wird auf den Heimatpfad (+ Domain-Ordner, sofern aktiviert) des neuen Kunden gesetzt.'; -$lng['domains']['associated_with_domain'] = 'Verbunden mit'; -$lng['domains']['aliasdomains'] = 'Aliasdomains'; -$lng['error']['ipportdoesntexist'] = 'Die gewählte IP/Port-Kombination existiert nicht.'; - -// ADDED IN 1.2.19-svn38 - -$lng['admin']['phpserversettings'] = 'PHP-Einstellungen'; -$lng['admin']['phpsettings']['binary'] = 'PHP-Binary'; -$lng['admin']['phpsettings']['fpmdesc'] = 'PHP-FPM Config'; -$lng['admin']['phpsettings']['file_extensions'] = 'Dateiendungen'; -$lng['admin']['phpsettings']['file_extensions_note'] = '(ohne Punkt, durch Leerzeichen getrennt)'; -$lng['admin']['mod_fcgid_maxrequests']['title'] = 'Maximale PHP-Requests für diese Domain (leer für Standardwert)'; -$lng['serversettings']['mod_fcgid']['maxrequests']['title'] = 'Maximale Requests pro Domain'; -$lng['serversettings']['mod_fcgid']['maxrequests']['description'] = 'Wieviele PHP-Requests pro Domain sollen erlaubt werden?'; - -// fix bug #1124 -$lng['admin']['webserver'] = 'Webserver'; - -// ADDED IN FROXLOR 0.9 - -$lng['admin']['spfsettings'] = 'Domain-SPF-Einstellungen'; -$lng['spf']['use_spf'] = 'Aktiviere SPF für Domains?'; -$lng['spf']['spf_entry'] = 'SPF-Eintrag für alle Domains'; -$lng['panel']['toomanydirs'] = 'Zu viele Unterverzeichnisse. Weiche auf manuelle Verzeichniseingabe aus.'; -$lng['panel']['abort'] = 'Abbrechen'; -$lng['serversettings']['cron']['debug']['title'] = 'Debuggen des Cronscripts'; -$lng['serversettings']['cron']['debug']['description'] = 'Wenn aktiviert, wird die Lockdatei nach dem Cronlauf zum Debuggen nicht gelöscht
Achtung: Eine alte Lockdatei kann weitere Cronjobs behindern und dafür sorgen, dass diese nicht vollständig ausgeführt werden.'; -$lng['panel']['not_activated'] = 'Nicht aktiviert'; -$lng['panel']['off'] = 'aus'; -$lng['update']['updateinprogress_onlyadmincanlogin'] = 'Eine neuere Version von Froxlor wurde installiert, aber noch nicht eingerichtet.
Nur der Administrator kann sich anmelden und die Aktualisierung abschließen.'; -$lng['update']['update'] = 'Froxlor Aktualisierung'; -$lng['update']['proceed'] = 'Ausführen'; -$lng['update']['update_information']['part_a'] = 'Die Froxlor-Dateien wurden aktualisiert. Neue Version ist %newversion. Die bisher installierte Version ist %curversion'; -$lng['update']['update_information']['part_b'] = '

Ein Kunden-Login ist vor Abschluss des Aktualisierungsvorganges nicht möglich.
Aktualisierung ausführen?'; -$lng['update']['noupdatesavail'] = 'Ihre Froxlor-Version ist aktuell.'; -$lng['admin']['specialsettingsforsubdomains'] = 'Übernehme Einstellungen für alle Subdomains (*.beispiel.de)'; -$lng['serversettings']['specialsettingsforsubdomains']['description'] = 'Wenn ja, werden die individuellen Einstellungen für alle Subdomains übernommen.
Wenn nein, werden Subdomain-Specialsettings entfernt.'; -$lng['tasks']['outstanding_tasks'] = 'Ausstehende Cron-Aufgaben'; -$lng['tasks']['REBUILD_VHOST'] = 'Neuerstellung der Webserver-Konfiguration'; -$lng['tasks']['CREATE_HOME'] = 'Erstelle neuen Kunden %loginname%'; -$lng['tasks']['REBUILD_DNS'] = 'Neuerstellung der Bind-Konfiguration'; -$lng['tasks']['CREATE_FTP'] = 'Erstelle Verzeichnis für neuen FTP-Benutzer'; -$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Löschen von Kunden-Dateien %loginname%'; -$lng['tasks']['noneoutstanding'] = 'Zur Zeit gibt es keine ausstehenden Aufgaben für Froxlor'; - -// ADDED IN FROXLOR 0.9.1 - -$lng['admin']['accountdata'] = 'Benutzerdaten'; -$lng['admin']['contactdata'] = 'Kontaktdaten'; -$lng['admin']['servicedata'] = 'Dienstleistungsdaten'; - -// ADDED IN FROXLOR 0.9.2 - -$lng['admin']['newerversionavailable'] = 'Eine neuere Version von Froxlor wurde veröffentlicht'; - -// ADDED IN FROXLOR 0.9.3 - -$lng['emails']['noemaildomainaddedyet'] = 'Sie haben bisher noch keine (E-Mail-)Domain in Ihrem Konto.'; -$lng['error']['hiddenfieldvaluechanged'] = 'Der Wert des verborgenen Feldes "%s" hat sich während dem Ändern der Einstellungen geändert.

Dies ist im Grunde kein schwerwiegendes Problem, allerdings konnten so die Einstellungen nicht gespeichert werden.'; - -// ADDED IN FROXLOR 0.9.3-svn1 - -$lng['serversettings']['panel_password_min_length']['title'] = 'Mindestlänge von Passwörtern'; -$lng['serversettings']['panel_password_min_length']['description'] = 'Hier können Sie die Mindestlänge für Passwörter festlegen. \'0\' bedeutet: Keine Mindestlänge'; -$lng['error']['notrequiredpasswordlength'] = 'Das Passwort ist zu kurz. Bitte geben Sie mindestens "%s" Zeichen an.'; -$lng['serversettings']['system_store_index_file_subs']['title'] = 'Erstelle Index-Datei auch in neuen Unterordnern'; -$lng['serversettings']['system_store_index_file_subs']['description'] = 'Wenn aktiviert, wird für jede Subdomain mit neuem Unterordner die Standard-Index Datei angelegt.'; - -// ADDED IN FROXLOR 0.9.3-svn2 - -$lng['serversettings']['adminmail_return']['title'] = 'Antwort-Adresse'; -$lng['serversettings']['adminmail_return']['description'] = 'Standard-Antwort-Adresse für E-Mails aus dem Panel.'; -$lng['serversettings']['adminmail_defname'] = 'Panel-Absender-Name'; - -// ADDED IN FROXLOR 0.9.3-svn3 -$lng['dkim']['dkim_algorithm']['title'] = 'Gültige Hash-Algorithmen'; -$lng['dkim']['dkim_algorithm']['description'] = 'Wählen Sie einen Algorithmus, "All" für alle Algorithmen oder einen oder mehrere von den verfügbaren Algorithmen.'; -$lng['dkim']['dkim_servicetype'] = 'Service Typen'; -$lng['dkim']['dkim_keylength']['title'] = 'Schlüssel-Länge'; -$lng['dkim']['dkim_keylength']['description'] = 'Achtung: Bei Änderung dieser Einstellung müssen alle private/public Schlüssel in "%s" gelöscht werden.'; -$lng['dkim']['dkim_notes']['title'] = 'DKIM Notiz'; -$lng['dkim']['dkim_notes']['description'] = 'Eine Notiz, welche für Menschen interessant sein könnte, z.B. eine URL wie http://www.dnswatch.info. Es gibt keine programmgesteuerte Interpretation für dieses Feld. Gehen Sie sparsam mit der Anzahl der Zeichen um, da es Einschränkungen seitens des DNS-Dienstes gibt. Dieses Feld ist für Administratoren gedacht, nicht für Benutzer.'; - -$lng['admin']['cron']['cronsettings'] = 'Cronjob-Einstellungen'; -$lng['cron']['cronname'] = 'Cronjob-Name'; -$lng['cron']['lastrun'] = 'Zuletzt gestartet'; -$lng['cron']['interval'] = 'Intervall'; -$lng['cron']['isactive'] = 'Aktiv'; -$lng['cron']['description'] = 'Beschreibung'; -$lng['crondesc']['cron_unknown_desc'] = 'Keine Beschreibung angegeben'; -$lng['admin']['cron']['add'] = 'Cronjob hinzufügen'; -$lng['crondesc']['cron_tasks'] = 'Erstellen von Konfigurationsdateien'; -$lng['crondesc']['cron_legacy'] = 'Legacy (alter) Cronjob'; -$lng['crondesc']['cron_traffic'] = 'Traffic-Berechnung'; -$lng['cronmgmt']['minutes'] = 'Minuten'; -$lng['cronmgmt']['hours'] = 'Stunden'; -$lng['cronmgmt']['days'] = 'Tage'; -$lng['cronmgmt']['weeks'] = 'Wochen'; -$lng['cronmgmt']['months'] = 'Monate'; -$lng['admin']['cronjob_edit'] = 'Cronjob bearbeiten'; -$lng['cronjob']['cronjobsettings'] = 'Cronjob-Einstellungen'; -$lng['cronjob']['cronjobintervalv'] = 'Laufzeit-Intervall Wert'; -$lng['cronjob']['cronjobinterval'] = 'Laufzeit-Intervall'; -$lng['panel']['options'] = 'Optionen'; -$lng['admin']['warning'] = 'ACHTUNG - Wichtiger Hinweis!'; -$lng['cron']['changewarning'] = 'Änderungen an diesen Werten können einen negativen Effekt auf das Verhalten von Froxlor und seinen automatisierten Aufgaben haben.
Ändern Sie hier bitte nur etwas, wenn Sie sich über die Folgen im Klaren sind.'; - -$lng['serversettings']['stdsubdomainhost']['title'] = 'Kunden Standard-Subdomain'; -$lng['serversettings']['stdsubdomainhost']['description'] = 'Welcher Hostname soll für das Erstellen der Kunden-Standard-Subdomain verwendet werden? Falls leer wird der System-Hostname verwendet.'; - -// ADDED IN FROXLOR 0.9.4-svn1 -$lng['ftp']['account_edit'] = 'FTP-Konto bearbeiten'; -$lng['ftp']['editpassdescription'] = 'Neues Passwort setzen oder leer für keine Änderung.'; -$lng['customer']['sendinfomail'] = 'Daten per E-Mail an mich senden'; -$lng['mails']['new_database_by_customer']['subject'] = '[Froxlor] Neue Datenbank erstellt'; -$lng['mails']['new_database_by_customer']['mailbody'] = "Hallo {CUST_NAME},\n\ndu hast gerade eine neue Datenbank angelegt. Hier die angegebenen Informationen:\n\nDatenbankname: {DB_NAME}\nPasswort: {DB_PASS}\nBeschreibung: {DB_DESC}\nDatenbank-Server: {DB_SRV}\nphpMyAdmin: {PMA_URI}\nVielen Dank, Ihr Administrator"; -$lng['serversettings']['awstats_path'] = 'Pfad zu AWStats \'awstats_buildstaticpages.pl\''; -$lng['serversettings']['awstats_conf'] = 'AWStats Konfigurations-Pfad'; -$lng['error']['overviewsettingoptionisnotavalidfield'] = 'Hoppla, ein Feld, das als Option in der Konfigurationsübersicht angezeigt werden soll, hat nicht den erwarteten Wert. Sie können den Entwicklern die Schuld geben. Dies sollte nicht passieren!'; -$lng['admin']['configfiles']['compactoverview'] = 'Kompakt-Übersicht'; - -$lng['mysql']['mysql_server'] = 'MySQL-Server'; -$lng['admin']['ipsandports']['webserverdefaultconfig'] = 'Webserver-Standard-Konfiguration'; -$lng['admin']['ipsandports']['webserverdomainconfig'] = 'Webserver-Domain-Konfiguration'; -$lng['admin']['ipsandports']['webserverssldomainconfig'] = 'Webserver-SSL-Konfiguration'; -$lng['admin']['ipsandports']['ssl_key_file'] = 'Pfad zum SSL-Private-Key'; -$lng['admin']['ipsandports']['ssl_ca_file'] = 'Pfad zum SSL-CA-Zertifikat (optional)'; -$lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Standard vHost-Einstellungen für jeden Domain-Container'; -$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Pfad zum SSL Private-Key'; -$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Geben Sie den Pfad inklusive Dateinamen der Schlüssel-Datei an (der private-key, meist .key).'; -$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Pfad zum SSL-CA-Zertifikat (optional)'; -$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client Authentifizierung, dieses Feld sollte nur gesetzt werden, wenn es wirklich gebraucht wird.'; -$lng['error']['usernamealreadyexists'] = 'Der Benutzername "%s" existiert bereits.'; -$lng['error']['plausibilitychecknotunderstood'] = 'Die Antwort des Plausibilitätschecks wurde nicht verstanden'; -$lng['error']['errorwhensaving'] = 'Bei dem Speichern des Feldes "%s" trat ein Fehler auf'; -$lng['success']['success'] = 'Information'; -$lng['success']['clickheretocontinue'] = 'Hier klicken, um fortzufahren'; -$lng['success']['settingssaved'] = 'Die Einstellungen wurden erfolgreich gespeichert.'; -$lng['admin']['lastlogin_succ'] = 'Letzte Anmeldung'; -$lng['panel']['neverloggedin'] = 'Keine Anmeldung bisher'; - -// ADDED IN FROXLOR 0.9.6-svn1 -$lng['serversettings']['defaultttl'] = 'Domain TTL für Bind in Sekunden (default \'604800\' = 1 Woche)'; - -// ADDED IN FROXLOR 0.9.6-svn3 -$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Verwende Standard-Fehlerdokumente für alle Kunden'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'Datei/URL für Fehler 401'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '
Nicht unterstützt in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'Datei/URL für Fehler 403'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '
Nicht unterstützt in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'Datei/URL für Fehler 404'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'Datei/URL für Fehler 500'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '
Nicht unterstützt in: lighttpd
'; - -// ADDED IN FROXLOR 0.9.6-svn5 -$lng['serversettings']['mod_fcgid']['defaultini'] = 'Voreingestellte PHP-Konfiguration für neue Domains'; - -// ADDED IN FROXLOR 0.9.6-svn5 -$lng['admin']['ftpserver'] = 'FTP-Server'; -$lng['admin']['ftpserversettings'] = 'FTP-Server-Einstellungen'; -$lng['serversettings']['ftpserver']['desc'] = 'Wenn pureftpd ausgewählt ist, werden die .ftpquota Dateien für das Quota erstellt und täglich aktualisiert.'; - -// ADDED IN FROXLOR 0.9.7-svn1 -$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'Neuer FTP-Benutzer erstellt'; -$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hallo {CUST_NAME},\n\ndu hast gerade einen neuen FTP-Benutzer angelegt. Hier die angegebenen Informationen:\n\nBenutzername: {USR_NAME}\nPasswort: {USR_PASS}\nPfad: {USR_PATH}\n\nVielen Dank, Ihr Administrator"; -$lng['domains']['redirectifpathisurl'] = 'Redirect-Code (Standard: leer)'; -$lng['domains']['redirectifpathisurlinfo'] = 'Der Redirect-Code kann gewählt werden, wenn der eingegebene Pfad eine URL ist.
HINWEIS:Änderungen werden nur wirksam wenn der Pfad eine URL ist.'; -$lng['serversettings']['customredirect_enabled']['title'] = 'Erlaube Kunden-Redirect'; -$lng['serversettings']['customredirect_enabled']['description'] = 'Erlaubt es Kunden den HTTP-Status Code für einen Redirect zu wählen'; -$lng['serversettings']['customredirect_default']['title'] = 'Standard-Redirect'; -$lng['serversettings']['customredirect_default']['description'] = 'Dieser Redirect wird immer genutzt, sofern der Kunde keinen anderen auswählt.'; - -// ADDED IN FROXLOR 0.9.7-svn2 -$lng['error']['pathmaynotcontaincolon'] = 'Der eingegebene Pfad sollte keinen Doppelpunkt (":") enthalten. Bitte geben Sie einen korrekten Wert für den Pfad ein.'; - -// ADDED IN FROXLOR 0.9.9-svn1 -$lng['serversettings']['mail_also_with_mxservers'] = 'Erstelle mail-, imap-, pop3- and smtp-"A Record" auch wenn MX-Server angegeben sind'; - -// ADDED IN FROXLOR 0.9.10-svn1 -$lng['admin']['webserver_user'] = 'Benutzername Webserver'; -$lng['admin']['webserver_group'] = 'Gruppenname Webserver'; - -// ADDED IN FROXLOR 0.9.10 -$lng['serversettings']['froxlordirectlyviahostname'] = 'Froxlor direkt über den Hostnamen erreichbar machen'; - -// ADDED IN FROXLOR 0.9.11-svn1 -$lng['serversettings']['panel_password_regex']['title'] = 'Regulärer Ausdruck für Passwörter'; -$lng['serversettings']['panel_password_regex']['description'] = 'Hier können Sie einen regulären Ausdruck für Passwort-Komplexität festlegen.
Leer = keine bestimmten Anforderungen'; -$lng['error']['notrequiredpasswordcomplexity'] = 'Die vorgegebene Passwort-Komplexität wurde nicht erfüllt.
Bitte kontaktieren Sie Ihren Administrator, wenn Sie Fragen zur Komplexitäts-Vorgabe haben.'; - -// ADDED IN FROXLOR 0.9.11-svn2 -$lng['extras']['execute_perl'] = 'Perl/CGI ausführen'; -$lng['admin']['perlenabled'] = 'Perl verfügbar'; - -// ADDED IN FROXLOR 0.9.11-svn3 -$lng['serversettings']['perl_path']['title'] = 'Pfad zu Perl'; -$lng['serversettings']['perl_path']['description'] = 'Standard ist /usr/bin/perl'; - -// ADDED IN FROXLOR 0.9.12-svn1 -$lng['admin']['fcgid_settings'] = 'FCGID'; -$lng['serversettings']['mod_fcgid_ownvhost']['title'] = 'Verwende FCGID im Froxlor-Vhost'; -$lng['serversettings']['mod_fcgid_ownvhost']['description'] = 'Wenn verwendet, wird Froxlor selbst unter einem lokalen Benutzer ausgeführt'; -$lng['admin']['mod_fcgid_user'] = 'Lokaler Benutzer für FCGID (Froxlor Vhost)'; -$lng['admin']['mod_fcgid_group'] = 'Lokale Gruppe für FCGID (Froxlor Vhost)'; - -// ADDED IN FROXLOR 0.9.12-svn2 -$lng['admin']['perl_settings'] = 'Perl/CGI'; -$lng['serversettings']['perl']['suexecworkaround']['title'] = 'Aktiviere SuExec-Workaround'; -$lng['serversettings']['perl']['suexecworkaround']['description'] = 'Aktivieren Sie den Workaround nur, wenn die Kunden-Heimatverzeichnisse sich nicht unterhalb des suexec-Pfades liegen.
Wenn aktiviert erstellt Froxlor eine Verknüpfung des vom Kunden für Perl aktiviertem Pfad + /cgi-bin/ im angegebenen suexec-Pfad.
Bitte beachten Sie, dass Perl dann nur im Unterordner /cgi-bin/ des Kunden-Ordners funktioniert und nicht direkt in diesem Ordner (wie es ohne den Workaround wäre!)'; -$lng['serversettings']['perl']['suexeccgipath']['title'] = 'Pfad für Verknüpfungen zu Kunden-Perl-Verzeichnis'; -$lng['serversettings']['perl']['suexeccgipath']['description'] = 'Diese Einstellung wird nur benötigt, wenn der SuExec-Workaround aktiviert ist.
ACHTUNG: Stellen Sie sicher, dass sich der angegebene Pfad innerhalb des Suexec-Pfades befindet ansonsten ist der Workaround nutzlos'; -$lng['panel']['descriptionerrordocument'] = 'Mögliche Werte sind: URL, Pfad zu einer Datei oder ein Text, umgeben von Anführungszeichen (" ").
Leer für Server-Standardwert.'; -$lng['error']['stringerrordocumentnotvalidforlighty'] = 'Ein Text als Fehlerdokument funktioniert leider in LigHTTPd nicht, bitte geben Sie einen Pfad zu einer Datei an'; -$lng['error']['urlerrordocumentnotvalidforlighty'] = 'Eine URL als Fehlerdokument funktioniert leider in LigHTTPd nicht, bitte geben Sie einen Pfad zu einer Datei an'; - -// ADDED IN FROXLOR 0.9.12-svn3 -$lng['question']['remove_subbutmain_domains'] = 'Auch Domains entfernen, welche als volle Domains hinzugefügt wurden, aber Subdomains von dieser Domain sind?'; -$lng['domains']['issubof'] = 'Diese Domain ist eine Subdomain von der Domain'; -$lng['domains']['issubofinfo'] = 'Diese Einstellung muss gesetzt werden, wenn Sie eine Subdomain einer Hauptdomain als Hauptdomain anlegen (z. B. soll "www.domain.tld" hinzugefügt werden, somit muss hier "domain.tld" ausgewählt werden).'; -$lng['domains']['nosubtomaindomain'] = 'Keine Subdomain einer Hauptdomain'; -$lng['admin']['templates']['new_database_by_customer'] = 'Kunden-Benachrichtigungs nach Erstellung einer neuen Datenbank'; -$lng['admin']['templates']['new_ftpaccount_by_customer'] = 'Kunden-Benachrichtigung nach Erstellung eines neuen FTP-Benutzers'; -$lng['admin']['templates']['newdatabase'] = 'Benachrichtigungs-Mails für neue Datenbank'; -$lng['admin']['templates']['newftpuser'] = 'Benachrichtigungs-Mails für neuen FTP-Benutzer'; -$lng['admin']['templates']['CUST_NAME'] = 'Kundenname'; -$lng['admin']['templates']['DB_NAME'] = 'Datenbankname'; -$lng['admin']['templates']['DB_PASS'] = 'Datenbankpasswort'; -$lng['admin']['templates']['DB_DESC'] = 'Datenbankbeschreibung'; -$lng['admin']['templates']['DB_SRV'] = 'Datenbankserver'; -$lng['admin']['templates']['PMA_URI'] = 'URL zu phpMyAdmin (wenn angegeben)'; -$lng['admin']['notgiven'] = '[nicht angegeben]'; -$lng['admin']['templates']['USR_NAME'] = 'FTP-Benutzername'; -$lng['admin']['templates']['USR_PASS'] = 'FTP-Passwort'; -$lng['admin']['templates']['USR_PATH'] = 'FTP-Heimatverzeichnis (relativ zum Kunden-Heimatverzeichnis)'; - -// ADDED IN FROXLOR 0.9.12-svn4 -$lng['serversettings']['awstats_awstatspath'] = 'Pfad zu AWStats \'awstats.pl\''; - -// ADDED IN FROXLOR 0.9.12-svn6 -$lng['extras']['htpasswdauthname'] = 'Grund der Authentifizierung (AuthName)'; -$lng['extras']['directoryprotection_edit'] = 'Verzeichnisschutz bearbeiten'; -$lng['admin']['templates']['forgotpwd'] = 'Benachrichtigungs-Mails bei Zurücksetzen des Passworts'; -$lng['admin']['templates']['password_reset'] = 'Kunden-Benachrichtigung nach Zurücksetzen des Passworts'; -$lng['admin']['store_defaultindex'] = 'Standard-Index-Datei im Kundenordner erstellen'; - -// ADDED IN FROXLOR 0.9.14 -$lng['serversettings']['mod_fcgid']['defaultini_ownvhost'] = 'Voreingestellte PHP-Konfiguration für den Froxlor-Vhost'; -$lng['serversettings']['awstats_icons']['title'] = 'Pfad zum AWstats-Icon-Ordner'; -$lng['serversettings']['awstats_icons']['description'] = 'z. B. /usr/share/awstats/htdocs/icon/'; -$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Pfad zu dem SSL-CertificateChainFile (optional)'; -$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Meist CA_Bundle, o. Ä. Dies ist das Feld, das gesetzt werden sollte, wenn ein gekauftes SSL-Zertifikat vorliegt.'; -$lng['admin']['ipsandports']['docroot']['title'] = 'Benutzerdefinierter Docroot (wenn leer, zeige auf Froxlor)'; -$lng['admin']['ipsandports']['docroot']['description'] = 'Hier kann ein benutzerdefinierter Document-Root (der Zielordner für einen Zugriff) für diese IP/Port Kombination gesetzt werden.
ACHTUNG: Bitte überlege vorher, welchen Pfad du hier angibst!'; -$lng['serversettings']['login_domain_login'] = 'Erlaube Anmeldung mit Domains'; -$lng['panel']['unlock'] = 'entsperren'; -$lng['question']['customer_reallyunlock'] = 'Wollen Sie den Kunden "%s" wirklich entsperren?'; - -// ADDED IN FROXLOR 0.9.15 -$lng['serversettings']['perl_server']['title'] = 'Perl Server-Socket'; -$lng['serversettings']['perl_server']['description'] = 'Eine einfache Anleitung hier zu findet man unter nginx.com'; -$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx-PHP-Backend'; -$lng['serversettings']['nginx_php_backend']['description'] = 'Dies ist das Backend, auf dem PHP auf Anfragen von Nginx hört. Kann ein UNIX Socket oder eine IP:Port Kombination sein
*NICHT relevant bei php-fpm'; -$lng['serversettings']['phpreload_command']['title'] = 'PHP-Reload-Befehl'; -$lng['serversettings']['phpreload_command']['description'] = 'Dieser wird benötigt, um das PHP-Backend bei Bedarf durch den Cronjob neu zu laden. (Standard: leer)
*NICHT relevant bei php-fpm'; - -// ADDED IN FROXLOR 0.9.16 -$lng['error']['intvaluetoolow'] = 'Die angegebene Zahl ist zu klein (Feld "%s")'; -$lng['error']['intvaluetoohigh'] = 'Die angegebene Zahl ist zu groß (Feld "%s")'; -$lng['admin']['phpfpm_settings'] = 'PHP-FPM'; -$lng['serversettings']['phpfpm']['title'] = 'Aktiviere PHP-FPM'; -$lng['serversettings']['phpfpm']['description'] = 'Dies benötigt eine spezielle Webserver-Konfiguration, siehe PHP-FPM Handbuch'; -$lng['serversettings']['phpfpm_settings']['configdir'] = 'Pfad zu php-fpm-Konfigurationen'; -$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Alias-Ordner der php-fpm Konfiguration'; -$lng['serversettings']['phpfpm_settings']['reload'] = 'Kommando zum Neustarten von php-fpm'; -$lng['serversettings']['phpfpm_settings']['pm'] = 'Prozess Manager Control (PM)'; -$lng['serversettings']['phpfpm_settings']['max_children']['title'] = 'Anzahl der Kind-Prozesse'; -$lng['serversettings']['phpfpm_settings']['max_children']['description'] = 'Die Anzahl der zu startenden Kind-Prozesse wenn PM auf \'static\' steht und die maximale Anzahl der Prozesse wenn PM auf \'dynamic/ondemand\' steht.
Equivalent zu PHP_FCGI_CHILDREN'; -$lng['serversettings']['phpfpm_settings']['start_servers']['title'] = 'Anzahl der beim Starten zu erstellenden Kind-Prozesse'; -$lng['serversettings']['phpfpm_settings']['start_servers']['description'] = 'Hinweis: Nur wenn PM auf \'dynamic\' steht'; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['title'] = 'Mindestanzahl der Idle-Prozesse'; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['description'] = 'Hinweis: Nur wenn PM auf \'dynamic\' steht
Wichtig: Pflichtangabe wenn PM auf \'dynamic\' steht'; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['title'] = 'Maximale Anzahl der Idle-Prozesse'; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['description'] = 'Hinweis: Nur wenn PM auf \'dynamic\' steht
Wichtig: Pflichtangabe wenn PM auf \'dynamic\' steht'; -$lng['serversettings']['phpfpm_settings']['max_requests']['title'] = 'Requests pro Kindprozess bevor Neuerstellung (respawning)'; -$lng['serversettings']['phpfpm_settings']['max_requests']['description'] = 'Für keine Begrenzung \'0\' angeben. Equivalent zu PHP_FCGI_MAX_REQUESTS.'; -$lng['error']['phpfpmstillenabled'] = 'PHP-FPM ist derzeit aktiviert. Bitte deaktivieren Sie es, um FCGID zu aktivieren'; -$lng['error']['fcgidstillenabled'] = 'FCGID ist derzeit aktiviert. Bitte deaktivieren Sie es, um PHP-FPM zu aktivieren'; -$lng['phpfpm']['vhost_httpuser'] = 'Lokaler Benutzer für PHP-FPM (Froxlor-Vhost)'; -$lng['phpfpm']['vhost_httpgroup'] = 'Lokale Gruppe für PHP-FPM (Froxlor-Vhost)'; -$lng['phpfpm']['ownvhost']['title'] = 'Verwende PHP-FPM im Froxlor-Vhost'; -$lng['phpfpm']['ownvhost']['description'] = 'Wenn verwendet, wird Froxlor selbst unter einem lokalen Benutzer ausgeführt'; - -// ADDED IN FROXLOR 0.9.17 -$lng['crondesc']['cron_usage_report'] = 'Webspace- und Trafficreport'; -$lng['serversettings']['report']['report'] = 'Aktiviere das Senden von Reports über Webspace- und Trafficverbrauch'; -$lng['serversettings']['report']['webmax']['title'] = 'Warn-Level in Prozent für Webspace'; -$lng['serversettings']['report']['webmax']['description'] = 'Gültige Werte sind von 0 bis 150. Der Wert 0 deaktiviert diesen Report.'; -$lng['serversettings']['report']['trafficmax']['title'] = 'Warn-Level in Prozent für Traffic'; -$lng['serversettings']['report']['trafficmax']['description'] = 'Gültige Werte sind von 0 bis 150. Der Wert 0 deaktiviert diesen Report.'; -$lng['mails']['trafficmaxpercent']['mailbody'] = 'Sehr geehrte(r) {NAME},\n\nSie haben bereits {TRAFFICUSED} MB von Ihren insgesamt {TRAFFIC} MB Traffic verbraucht.\nDies sind mehr als {MAX_PERCENT}%.\n\nVielen Dank,\nIhr Administrator'; -$lng['mails']['trafficmaxpercent']['subject'] = 'Sie erreichen bald Ihr Traffic-Limit'; -$lng['admin']['templates']['trafficmaxpercent'] = 'Hinweismail für Kunden, wenn sie die angegebenen Prozent des Traffics verbraucht haben'; -$lng['admin']['templates']['MAX_PERCENT'] = 'Wird mit dem Webspace/Traffic-Limit, welches dem Kunden zugewiesen wurde, ersetzt.'; -$lng['admin']['templates']['USAGE_PERCENT'] = 'Wird mit dem Webspace/Traffic, welcher vom Kunden bereits verbraucht wurde, ersetzt.'; -$lng['admin']['templates']['diskmaxpercent'] = 'Hinweismail für Kunden, wenn sie die angegebenen Prozent des Webspaces verbraucht haben'; -$lng['admin']['templates']['DISKAVAILABLE'] = 'Wird mit dem Webspace, der dem Kunden zugewiesen wurde, ersetzt (in MB).'; -$lng['admin']['templates']['DISKUSED'] = 'Wird mit dem Webspace, welcher vom Kunden bereits verbraucht wurde, ersetzt (in MB).'; -$lng['serversettings']['dropdown'] = 'Auswahlliste'; -$lng['serversettings']['manual'] = 'Manuelle Eingabe'; -$lng['mails']['diskmaxpercent']['mailbody'] = 'Sehr geehrte(r) {NAME},\n\nSie haben bereits {DISKUSED} MB von Ihren insgesamt {DISKAVAILABLE} MB Speicherplatz verbraucht.\nDies sind mehr als {MAX_PERCENT}%.\n\nVielen Dank,\nIhr Administrator'; -$lng['mails']['diskmaxpercent']['subject'] = 'Sie erreichen bald Ihr Speicherplatz-Limit'; -$lng['mysql']['database_edit'] = 'Datenbank bearbeiten'; - -// ADDED IN FROXLOR 0.9.18 -$lng['error']['domains_cantdeletedomainwithaliases'] = 'Sie können keine Domain löschen, die noch von Alias-Domains verwendet wird. Löschen Sie zuerst alle Alias-Domains dieser Domain.'; -$lng['serversettings']['default_theme'] = 'Standard-Theme'; -$lng['menue']['main']['changetheme'] = 'Theme wechseln'; -$lng['panel']['theme'] = 'Theme'; -$lng['success']['rebuildingconfigs'] = 'Task für Neuerstellung der Konfigurationen wurde erfolgreich eingetragen'; -$lng['panel']['variable'] = 'Variable'; -$lng['panel']['description'] = 'Beschreibung'; -$lng['emails']['back_to_overview'] = 'Zurück zur Übersicht'; - -// ADDED IN FROXLOR 0.9.20 -$lng['error']['user_banned'] = 'Ihr Benutzerkonto wurde gesperrt. Bitte kontaktieren Sie Ihren Administrator für weitere Informationen.'; -$lng['serversettings']['validate_domain'] = 'Validiere Domainnamen'; -$lng['login']['combination_not_found'] = 'Kombination aus Benutzername und E-Mail Adresse stimmen nicht überein.'; -$lng['customer']['generated_pwd'] = 'Passwortvorschlag'; -$lng['customer']['usedmax'] = 'Benutzt / Max.'; -$lng['admin']['traffic'] = 'Traffic'; -$lng['admin']['customertraffic'] = 'Kunden'; -$lng['traffic']['customer'] = 'Kunde'; -$lng['traffic']['trafficoverview'] = 'Übersicht Traffic je'; -$lng['traffic']['months']['jan'] = 'Jan'; -$lng['traffic']['months']['feb'] = 'Feb'; -$lng['traffic']['months']['mar'] = 'Mär'; -$lng['traffic']['months']['apr'] = 'Apr'; -$lng['traffic']['months']['may'] = 'Mai'; -$lng['traffic']['months']['jun'] = 'Jun'; -$lng['traffic']['months']['jul'] = 'Jul'; -$lng['traffic']['months']['aug'] = 'Aug'; -$lng['traffic']['months']['sep'] = 'Sep'; -$lng['traffic']['months']['oct'] = 'Okt'; -$lng['traffic']['months']['nov'] = 'Nov'; -$lng['traffic']['months']['dec'] = 'Dez'; -$lng['traffic']['months']['total'] = 'Gesamt'; -$lng['traffic']['details'] = 'Details'; -$lng['menue']['traffic']['table'] = 'Übersicht'; -$lng['error']['admin_domain_emailsystemhostname'] = 'Der System-Hostname kann nicht als Kundendomain verwendet werden.'; - -// ADDED IN FROXLOR 0.9.21 -$lng['gender']['title'] = 'Geschlecht'; -$lng['gender']['male'] = 'Herr'; -$lng['gender']['female'] = 'Frau'; -$lng['gender']['undef'] = ''; - -// ADDED IN FROXLOR 0.9.22-svn1 -$lng['diskquota'] = 'Quota'; -$lng['serversettings']['diskquota_enabled'] = 'Quota aktiviert?'; -$lng['serversettings']['diskquota_repquota_path']['description'] = 'Pfad zu repquota'; -$lng['serversettings']['diskquota_quotatool_path']['description'] = 'Pfad zu quotatool'; -$lng['serversettings']['diskquota_customer_partition']['description'] = 'Partition, auf welcher die Kundendaten liegen'; -$lng['tasks']['CREATE_QUOTA'] = 'Quota auf dem Dateisystem setzen'; -$lng['error']['session_timeout'] = 'Wert zu niedrig'; -$lng['error']['session_timeout_desc'] = 'Der Wert der Session-Timeout sollte nicht unter einer Minute liegen.'; - -// ADDED IN FROXLOR 0.9.24-svn1 -$lng['admin']['assignedmax'] = 'Zugewiesen / Max.'; -$lng['admin']['usedmax'] = 'Benutzt / Max.'; -$lng['admin']['used'] = 'Benutzt'; -$lng['mysql']['size'] = 'Datenbankgröße'; - -$lng['error']['invalidhostname'] = 'Hostname muss eine gültige Domain sein. Er darf weder leer sein noch nur aus Leerzeichen bestehen'; - -$lng['traffic']['http'] = 'HTTP'; -$lng['traffic']['ftp'] = 'FTP'; -$lng['traffic']['mail'] = 'Mail'; - -// ADDED IN 0.9.27-svn1 -$lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Idle-Timeout'; -$lng['serversettings']['mod_fcgid']['idle_timeout']['description'] = 'Timeout-Einstellung für mod_FastCGI.'; -$lng['serversettings']['phpfpm_settings']['idle_timeout']['title'] = 'Idle-Timeout'; -$lng['serversettings']['phpfpm_settings']['idle_timeout']['description'] = 'Timeout-Einstellung für PHP-FPM FastCGI.'; - -// ADDED IN 0.9.27-svn2 -$lng['admin']['speciallogwarning'] = '
ACHTUNG: Durch diese Einstellungen werden Sie alle bisherige Statistiken dieser Domain verlieren.
'; - -// ADDED IN 0.9.28-svn2 -$lng['serversettings']['vmail_maildirname']['title'] = 'Maildir-(Unter-)Ordner'; -$lng['serversettings']['vmail_maildirname']['description'] = 'Der Maildir-Ordner innerhalb des Kontos des Benutzers (normalerweise \'Maildir\', in manchen Fällen auch \'.maildir\'). Sollen die E-Mails direkt in das Verzeichnis, diese Option leer lassen.'; -$lng['tasks']['DELETE_EMAIL_DATA'] = 'E-Mail-Dateien des Kunden löschen'; - -// ADDED IN 0.9.28-svn5 -$lng['error']['operationnotpermitted'] = 'Diese Aktion ist nicht erlaubt!'; -$lng['error']['featureisdisabled'] = 'Die Funktion "%s" wurde deaktiviert. Kontaktieren Sie bitte Ihren Dienstleister.'; -$lng['serversettings']['catchall_enabled']['title'] = 'Catchall verwenden'; -$lng['serversettings']['catchall_enabled']['description'] = 'Möchten Sie Ihren Kunden die Funktion Catchall zur Verfügung stellen?'; - -// ADDED IN 0.9.28.svn6 -$lng['serversettings']['apache_24']['title'] = 'Anpassungen für Apache 2.4 verwenden'; -$lng['serversettings']['apache_24']['description'] = '
Achtung: Bitte nur verwenden, wenn wirklich Apache mit Version 2.4 oder höher installiert ist, ansonsten wird der Webserver nicht starten.
'; -$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Pfad zur fastcgi_params Datei'; -$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Geben Sie den Pfad zu nginx\'s fastcgi_params Datei an. Inklusive Dateiname!'; - -// Added in Froxlor 0.9.28-rc2 -$lng['serversettings']['documentroot_use_default_value']['title'] = 'Verwende Domainnamen im Documentroot'; -$lng['serversettings']['documentroot_use_default_value']['description'] = 'Wenn aktiviert wird dem standard Documentroot zusätzlich der Domain-Name angehängt.

Beispiel:
/var/customers/customer_name/example.tld/
/var/customers/customer_name/subdomain.example.tld/'; - -$lng['error']['usercurrentlydeactivated'] = 'Der Benutzer "%s" ist derzeit deaktiviert'; -$lng['admin']['speciallogfile']['title'] = 'Eigene Log-Datei'; -$lng['admin']['speciallogfile']['description'] = 'Aktivieren Sie diese Option, um für diese Domain eine eigene Access-Log Datei zu erhalten'; -$lng['error']['setlessthanalreadyused'] = 'Es können nicht weniger Resourcen von "%s" gesetzt werden, als der Benutzer bereits vergeben hat
'; -$lng['error']['stringmustntbeempty'] = 'Der Wert für das Feld "%s" darf nicht leer sein'; -$lng['admin']['domain_editable']['title'] = 'Erlaube Bearbeiten der Domain'; -$lng['admin']['domain_editable']['desc'] = 'Wenn ja, darf der Kunde verschiedene Einstellungen anpassen.
Wenn nein, darf nichts durch den Kunden geändert werden.'; -$lng['admin']['writeaccesslog']['title'] = 'Zugriffslog schreiben'; -$lng['admin']['writeaccesslog']['description'] = 'Aktiviere diese Option, um für diese Domain eine Access-Log Datei zu erhalten'; -$lng['admin']['writeerrorlog']['title'] = 'Fehlerlog schreiben'; -$lng['admin']['writeerrorlog']['description'] = 'Aktiviere diese Option, um für diese Domain eine Error-Log Datei zu erhalten'; - -// Added in Froxlor 0.9.29-dev -$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['title'] = 'Verstecke Standard-Subdomains in PHP-Konfigurations-Übersicht'; -$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['description'] = 'Wenn aktiviert, werden die Standard-Subdomains der Kunden nicht mehr in der PHP-Konfigurations-Übersicht angezeigt.

Hinweis: Nur relevant, wenn FCGID oder PHP-FPM aktiviert ist.'; -$lng['serversettings']['passwordcryptfunc']['title'] = 'Wählen Sie die zu verwendende Passwort-Verschlüsselungsmethode'; -$lng['serversettings']['systemdefault'] = 'Systemstandard'; -$lng['serversettings']['panel_allow_theme_change_admin'] = 'Erlaube Admins das Theme zu wechseln'; -$lng['serversettings']['panel_allow_theme_change_customer'] = 'Erlaube Kunden das Theme zu wechseln'; -$lng['serversettings']['axfrservers']['title'] = 'AXFR Server'; -$lng['serversettings']['axfrservers']['description'] = 'Eine durch Kommas getrennte Liste von IP Adressen, die DNS-Zonen transferieren dürfen (AXFR).'; -$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode'; -$lng['serversettings']['powerdns_mode']['description'] = 'Wählen Sie den PowerDNS-Modus: Native für keine DNS-Replikation (Standard) / Master wenn eine DNS-Replikation benötigt wird.'; -$lng['panel']['ssleditor'] = 'SSL-Einstellungen für diese Domain'; -$lng['admin']['ipsandports']['ssl_paste_description'] = 'Bitte den Inhalt der Zertifikatsdatei in das Textfeld kopieren.'; -$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Inhalt des SSL-Zertifikats (Certificate)'; -$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Inhalt der Key-Datei (Private-Key)'; -$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Inhalt der SSL-CA-Datei (optional)'; -$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '

Client Authentifizierung, dieses Feld sollte nur gesetzt werden, wenn es wirklich gebraucht wird.'; -$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Inhalt des SSL-CertificateChainFile (optional)'; -$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '

Meist CA_Bundle, o. Ä. Dies ist das Feld, das gesetzt werden sollte, wenn ein gekauftes SSL-Zertifikat vorliegt.'; -$lng['error']['sslcertificateismissingprivatekey'] = 'Für das Zertifikat muss eine Key-Datei (Private-Key) angegeben werden.'; -$lng['error']['sslcertificatewrongdomain'] = 'Das angegebene Zertifikat gilt nicht für die gewählte Domain.'; -$lng['error']['sslcertificateinvalidcert'] = 'Der angegebene Zertifikatsinhalt scheint kein gültiges Zertifikat zu sein.'; -$lng['error']['sslcertificateinvalidcertkeypair'] = 'Der angegebene Key (Private-Key) gehört nicht zum angegebenen Zertifikat.'; -$lng['error']['sslcertificateinvalidca'] = 'Das angegebene CA-Zertifikat scheint nicht gültig zu sein.'; -$lng['error']['sslcertificateinvalidchain'] = 'Das angegebene CertificateChainFile scheint nicht gültig zu sein.'; -$lng['serversettings']['customerssl_directory']['title'] = 'Webserver-Kunden-SSL-Zertifikatsverzeichnis'; -$lng['serversettings']['customerssl_directory']['description'] = 'Wo sollen kundenspezifizierte SSL-Zertifikate erstellt werden?

ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.
'; -$lng['admin']['phpfpm.ininote'] = 'Nicht alle gewünschten Werte können in der php-fpm-pool-Konfiguration verwendet werden.'; - -// Added in Froxlor 0.9.30 -$lng['crondesc']['cron_mailboxsize'] = 'Berechnung der Mailbox-Größen'; -$lng['domains']['ipandport_multi']['title'] = 'IP-Adresse(n)'; -$lng['domains']['ipandport_multi']['description'] = 'Definieren Sie eine oder mehrere IP-Adresse(n) für diese Domain.

Hinweis: Die IP-Adressen können nicht geändert werden, sollte die Domain als Alias-Domain für eine andere Domain konfiguriert worden sein.
'; -$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL-IP-Adresse(n)'; -$lng['domains']['ssl_redirect']['title'] = 'SSL-Weiterleitung'; -$lng['domains']['ssl_redirect']['description'] = 'Diese Option erstellt für alle Nicht-SSL-vHosts eine Weiterleitung (Redirect), so dass alle Anfragen an den SSL-vHost übermittelt werden (z. B. würde eine Anfrage an http://domain.tld/ weitergeleitet werden zu https://domain.tld/).'; -$lng['admin']['selectserveralias'] = 'ServerAlias-Angabe für Domain'; -$lng['admin']['selectserveralias_desc'] = 'Wählen Sie hier, ob für diese Domain ein Wildcard-Eintrag (*.domain.tld), ein www-Alias (www.domain.tld) oder gar kein Alias angelegt werden soll.'; -$lng['domains']['serveraliasoption_wildcard'] = 'Wildcard (*.domain.tld)'; -$lng['domains']['serveraliasoption_www'] = 'www (www.domain.tld)'; -$lng['domains']['serveraliasoption_none'] = 'Kein Alias'; -$lng['error']['givendirnotallowed'] = 'Das angegebene Verzeichnis im Feld %s ist nicht erlaubt.'; -$lng['serversettings']['ssl']['ssl_cipher_list']['title'] = 'Erlaubte SSL Ciphers festlegen'; -$lng['serversettings']['ssl']['ssl_cipher_list']['description'] = 'Dies ist eine Liste von Ciphers, die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn eine SSL Verbindung besteht. Eine Liste aller Ciphers und wie diese hinzugefügt/ausgeschlossen werden ist in den Abschnitten "CIPHER LIST FORMAT" und "CIPHER STRINGS" in der man-page für Ciphers zu finden.

Standard-Wert ist:
ECDH+AESGCM:ECDH+AES256:!aNULL:!MD5:!DSS:!DH:!AES128
'; - -// Added in Froxlor 0.9.31 -$lng['panel']['dashboard'] = 'Dashboard'; -$lng['panel']['assigned'] = 'zugewiesen'; -$lng['panel']['available'] = 'verfügbar'; -$lng['customer']['services'] = 'Dienste'; -$lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'FastCGI IPC Verzeichnis'; -$lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'In dieses Verzeichnis werden die php-fpm Sockets vom Webserver abgelegt.
Das Verzeichnis muss für den Webserver lesbar sein.'; -$lng['panel']['news'] = 'Neuigkeiten'; -$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Eine SSL-Weiterleitung ist nur möglich, wenn der Domain mindestens eine IP/Port Kombination zugewiesen wurde, bei der SSL aktiviert ist.'; -$lng['error']['fcgidstillenableddeadlock'] = 'FCGID ist derzeit aktiviert.
Bitte deaktiviere es, um einen anderen Webserver als Apache2 oder lighttpd auswählen zu können.'; -$lng['error']['send_report_title'] = 'Fehler melden'; -$lng['error']['send_report_desc'] = 'Danke, dass Sie uns diesen Fehler melden und damit helfen Froxlor zu verbessern.
Folgender Bericht wird per Mail an das Froxlor Entwickler Team gesendet.'; -$lng['error']['send_report'] = 'Fehlerbericht senden'; -$lng['error']['send_report_error'] = 'Fehler beim Senden des Berichts:
%s'; -$lng['error']['notallowedtouseaccounts'] = 'Ihrem Konto ist die Nutzung von IMAP/POP3 nicht erlaubt, daher können keine E-Mail-Konten angelegt werden'; -$lng['pwdreminder']['changed'] = 'Ihr Passwort wurde erfolgreich geändert. Sie können sich nun damit anmelden.'; -$lng['pwdreminder']['wrongcode'] = 'Der verwendete Aktivierungscode ist entweder nicht gültig oder bereits abgelaufen.'; -$lng['admin']['templates']['LINK'] = 'Wird mit dem Link zum Zurücksetzen des Passworts ersetzt.'; -$lng['pwdreminder']['choosenew'] = 'Neues Passwort auswählen'; -$lng['serversettings']['allow_error_report_admin']['title'] = 'Erlaube Administrator/Reseller das Melden von Datenbankfehlern an Froxlor'; -$lng['serversettings']['allow_error_report_admin']['description'] = 'Bitte beachten: Senden Sie zu keiner Zeit irgendwelche datenschutzrelevanten/persönlichen (Kunden-)Daten an uns!'; -$lng['serversettings']['allow_error_report_customer']['title'] = 'Erlaube Kunden das Melden von Datenbankfehlern an Froxlor'; -$lng['serversettings']['allow_error_report_customer']['description'] = 'Bitte beachten: Senden Sie zu keiner Zeit irgendwelche datenschutzrelevanten/persönlichen (Kunden-)Daten an uns!'; -$lng['admin']['phpsettings']['enable_slowlog'] = 'FPM-slowlog pro Domain aktivieren'; -$lng['admin']['phpsettings']['request_terminate_timeout'] = 'request_terminate_timeout'; -$lng['admin']['phpsettings']['request_slowlog_timeout'] = 'request_slowlog_timeout'; -$lng['admin']['templates']['SERVER_HOSTNAME'] = 'Wird mit dem System-Hostname (URL zu froxlor) ersetzt'; -$lng['admin']['templates']['SERVER_IP'] = 'Wird mit der Standard-System-IP-Adresse ersetzt'; -$lng['admin']['templates']['SERVER_PORT'] = 'Wird mit dem Standard-Port ersetzt'; -$lng['admin']['templates']['DOMAINNAME'] = 'Wird mit der Standardsubdomain des Kunden ersetzt (kann leer sein, wenn keine erstellt werden soll)'; -$lng['admin']['show_news_feed']['title'] = 'Zeige Newsfeed im Admin-Dashboard'; -$lng['admin']['show_news_feed']['description'] = 'Aktivieren Sie diese Option, um das offizielle Froxlor newsfeed (https://inside.froxlor.org/news/) auf deinem Dashboard anzuzeigen und verpasse keine wichtigen Informationen oder Release-Announcements.'; -$lng['panel']['newsfeed_disabled'] = 'Das Newsfeed ist deaktiviert. Klicken Sie auf das Editier-Icon, um zu den Einstellungen zu gelangen.'; - -// Added in Froxlfor 0.9.32 -$lng['logger']['reseller'] = "Reseller"; -$lng['logger']['admin'] = "Administrator"; -$lng['logger']['cron'] = "Cronjob"; -$lng['logger']['login'] = "Login"; -$lng['logger']['intern'] = "Intern"; -$lng['logger']['unknown'] = "Unbekannt"; -$lng['serversettings']['mailtraffic_enabled']['title'] = "Analysiere Mailtraffic"; -$lng['serversettings']['mailtraffic_enabled']['description'] = "Aktiviere das Analysieren der Logdateien des Mailsystems, um den verbrauchten Traffic zu berechnen."; -$lng['serversettings']['mdaserver']['title'] = "Typ des MDA"; -$lng['serversettings']['mdaserver']['description'] = "Der eingesetzte Mail Delivery Server"; -$lng['serversettings']['mdalog']['title'] = "Logdatei des MDA"; -$lng['serversettings']['mdalog']['description'] = "Die Logdatei des Mail Delivery Server"; -$lng['serversettings']['mtaserver']['title'] = "Typ des MTA"; -$lng['serversettings']['mtaserver']['description'] = "Der eingesetzte Mail Transfer Agent"; -$lng['serversettings']['mtalog']['title'] = "Logdatei des MTA"; -$lng['serversettings']['mtalog']['description'] = "Die Logdatei des Mail Transfer Agent"; -$lng['panel']['ftpdesc'] = 'FTP-Beschreibung'; -$lng['admin']['cronsettings'] = 'Cronjob-Einstellungen'; -$lng['serversettings']['system_cronconfig']['title'] = 'Cron-Konfigurationsdatei'; -$lng['serversettings']['system_cronconfig']['description'] = 'Pfad zur Konfigurationsdatei des Cron-Dienstes. Diese Datei wird von Froxlor automatisch aktualisiert.
Hinweis: Bitte verwenden Sie exakt die gleiche Datei wie für den Froxlor-Haupt-Cronjob (Standard: /etc/cron.d/froxlor)!

Wird FreeBSD verwendet, sollte hier /etc/crontab angegeben werden!'; -$lng['tasks']['DELETE_FTP_DATA'] = 'Kunden FTP-Konto Dateien löschen'; -$lng['tasks']['REBUILD_CRON'] = 'Neuerstellung der cron.d-Datei'; -$lng['serversettings']['system_crondreload']['title'] = 'Cron-Daemon reload Befehl'; -$lng['serversettings']['system_crondreload']['description'] = 'Geben Sie hier den Befehl zum Neuladen des Cron-Daemons an'; -$lng['admin']['integritycheck'] = 'Datenbankprüfung'; -$lng['admin']['integrityid'] = '#'; -$lng['admin']['integrityname'] = 'Name'; -$lng['admin']['integrityresult'] = 'Ergebnis'; -$lng['admin']['integrityfix'] = 'Probleme automatisch beheben'; -$lng['question']['admin_integritycheck_reallyfix'] = 'Möchten Sie wirklich versuchen sämtliche Datenbank-Integritätsprobleme automatisch zu beheben?'; -$lng['serversettings']['system_croncmdline']['title'] = 'Cron Startbefehl (php Programm)'; -$lng['serversettings']['system_croncmdline']['description'] = 'Befehl zum Ausführen des Cronjobs. Ändern dieser Einstellung nur wenn nötig (Standard: "/usr/bin/nice -n 5 /usr/bin/php -q")!'; -$lng['error']['cannotdeletehostnamephpconfig'] = 'Diese PHP-Konfiguration ist dem Froxlor-Vhost zugewiesen und kann daher nicht gelöscht werden.'; -$lng['error']['cannotdeletedefaultphpconfig'] = 'Diese PHP-Konfiguration ist als Standard hinterlegt und kann daher nicht gelöscht werden.'; -$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Erlaube automatische Datenbank-Aktualisierungen'; -$lng['serversettings']['system_cron_allowautoupdate']['description'] = 'WARNUNG: Diese Einstellung erlaubt es dem Cronjob die Prüfung der Dateien- und Datenbank-Version zu umgehen und bei einem Versions-Unterschied die Datenbank-Aktualisierungen automatisiert auszuführen.

Das automatische Update setzt für neue Einstellungen und Änderungen immer die default-Werte. Diese müssen nicht zwingend zu dem genutzten System passen. Bitte zwei mal nachdenken, bevor diese Option aktiviert wird.
'; -$lng['error']['passwordshouldnotbeusername'] = 'Das Passwort sollte nicht mit dem Benutzernamen übereinstimmen.'; - -// Added in Froxlor 0.9.33 -$lng['admin']['customer_show_news_feed'] = "Zeige Newsfeed im Kunden-Dashboard"; -$lng['admin']['customer_news_feed_url']['title'] = "Benutzerdefiniertes RSS-Feed"; -$lng['admin']['customer_news_feed_url']['description'] = "Hier kann ein eigenes RSS-Feed angegeben werden, welches den Kunden auf dem Dashboard angezeigt wird.
Leerlassen um das offizielle Froxlor Newsfeed (https://inside.froxlor.org/news/) zu verwenden."; -$lng['serversettings']['dns_createhostnameentry'] = "Erstelle bind-Zone/Konfiguration für den System-Hostnamen"; -$lng['serversettings']['panel_password_alpha_lower']['title'] = 'Kleinbuchstaben'; -$lng['serversettings']['panel_password_alpha_lower']['description'] = 'Das Passwort muss mindestens einen Kleinbuchstaben (a-z) enthalten.'; -$lng['serversettings']['panel_password_alpha_upper']['title'] = 'Großbuchstaben'; -$lng['serversettings']['panel_password_alpha_upper']['description'] = 'Das Passwort muss mindestens einen Großbuchstaben (A-Z) enthalten.'; -$lng['serversettings']['panel_password_numeric']['title'] = 'Zahlen'; -$lng['serversettings']['panel_password_numeric']['description'] = 'Das Passwort muss mindestens eine Zahl (0-9) enhalten.'; -$lng['serversettings']['panel_password_special_char_required']['title'] = 'Sonderzeichen'; -$lng['serversettings']['panel_password_special_char_required']['description'] = 'Das Passwort muss mindestens eines der untenstehenden Sonderzeichen enthalten'; -$lng['serversettings']['panel_password_special_char']['title'] = 'Sonderzeichen-Liste'; -$lng['serversettings']['panel_password_special_char']['description'] = 'Mindestens eines dieser Sonderzeichen muss in dem Passwort vorkommen, sofern die Sonderzeichen-Option aktiviert ist.'; -$lng['phpfpm']['use_mod_proxy']['title'] = 'Verwende mod_proxy / mod_proxy_fcgi'; -$lng['phpfpm']['use_mod_proxy']['description'] = 'Muss gesetzt sein bei Debian 9.x (Stretch) oder neuer. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus'; -$lng['error']['no_phpinfo'] = 'Entschuldigung, es ist nicht möglich die phpinfo() auszulesen.'; - -$lng['admin']['movetoadmin'] = 'Kunde verschieben'; -$lng['admin']['movecustomertoadmin'] = 'Verschiebe den Kunden zum angegebenen Admin/Reseller
Leerlassen für keine Änderung.
Wird der gewünschte Admin/Reseller hier nicht aufgelistet, hat er sein Kunden-Kontigent erreicht.'; -$lng['error']['moveofcustomerfailed'] = 'Das Verschieben des Kunden ist fehlgeschlagen. Alle übrigen Änderungen wurden durchgeführt und gespeichert.

Fehlermeldung: %s'; - -$lng['domains']['domain_import'] = 'Domains importieren'; -$lng['domains']['import_separator'] = 'Trennzeichen'; -$lng['domains']['import_offset'] = 'Versatz (offset)'; -$lng['domains']['import_file'] = 'CSV-Datei'; -$lng['success']['domain_import_successfully'] = 'Erfolgreich %s Domains importiert.'; -$lng['error']['domain_import_error'] = 'Der folgende Fehler trat beim Importieren der Domains auf: %s'; -$lng['admin']['note'] = 'Hinweis'; -$lng['domains']['import_description'] = 'Detaillierte Informationen über den Aufbau der Importdatei und einen erfolgreichen Import gibt es hier: https://docs.froxlor.org/adminguide/domainimport.html (englisch)'; -$lng['usersettings']['custom_notes']['title'] = 'Eigene Notizen'; -$lng['usersettings']['custom_notes']['description'] = 'Hier können Notizen je nach Lust und Laune eingetragen werden. Diese werden in der Administrator/Kunden-Übersicht bei dem jeweiligen Benutzer angezeigt.'; -$lng['usersettings']['custom_notes']['show'] = 'Zeige die Notizen auf dem Dashboard des Benutzers'; -$lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID und PHP-FPM können nicht gleichzeitig aktiviert werden.'; - -// Added in Froxlor 0.9.34 -$lng['admin']['configfiles']['legend'] = '

Sie konfigurieren nun einen Service/Daemon.

'; -$lng['admin']['configfiles']['commands'] = 'Kommandos: Die angezeigten Befehle müssen als Benutzer root in einer Shell ausgeführt werden. Es kann auch problemlos der ganze Block kopiert und in die Shell eingefügt werden.'; -$lng['admin']['configfiles']['files'] = 'Konfigurationsdateien: Der Befehl direkt vor dem Textfeld sollte einen Editor mit der Zieldatei öffnen. Der Inhalt kann nun einfach kopiert und in den Editor eingefügt und die Datei gespeichert werden.
Bitte beachten: Das MySQL-Passwort wurde aus Sicherheitsgründen nicht ersetzt. Bitte ersetzen Sie "FROXLOR_MYSQL_PASSWORD" manuell oder nutzen Sie das folgende Formular, um es temporär auf dieser Seite zu setzen. Falls das Passwort vergessen wurde, findet es sich in der Datei "lib/userdata.inc.php".'; -$lng['serversettings']['apache_itksupport']['title'] = 'Anpassungen für Apache ITK-MPM verwenden'; -$lng['serversettings']['apache_itksupport']['description'] = '
Achtung: Bitte nur verwenden, wenn wirklich Apache itk-mpm verwendet wird, ansonsten wird der Webserver nicht starten.
'; -$lng['integrity_check']['databaseCharset'] = 'Characterset der Datenbank (sollte UTF-8 sein)'; -$lng['integrity_check']['domainIpTable'] = 'IP <‐> Domain Verknüpfung'; -$lng['integrity_check']['subdomainSslRedirect'] = 'Falsches SSL-redirect Flag bei nicht-SSL Domains'; -$lng['integrity_check']['froxlorLocalGroupMemberForFcgidPhpFpm'] = 'froxlor-Benutzer in Kunden-Gruppen (für FCGID/php-fpm)'; -$lng['integrity_check']['webserverGroupMemberForFcgidPhpFpm'] = 'Webserver-Benutzer in Kunden-Gruppen (für FCGID/php-fpm)'; -$lng['integrity_check']['subdomainLetsencrypt'] = 'Hauptdomains ohne zugewiesenen SSL-Port haben keine Subdomain mit aktiviertem SSL-Redirect'; -$lng['admin']['mod_fcgid_umask']['title'] = 'Umask (Standard: 022)'; - -// Added for let's encrypt -$lng['admin']['letsencrypt']['title'] = 'SSL Zertifikat erstellen (Let\'s Encrypt)'; -$lng['admin']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von Let\'s Encrypt. Das Zertifikat wird automatisch erstellt und verlängert.
ACHTUNG: Wenn Wildcards aktiviert sind, wird diese Option automatisch deaktiviert.'; -$lng['customer']['letsencrypt']['title'] = 'SSL Zertifikat erstellen (Let\'s Encrypt)'; -$lng['customer']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von Let\'s Encrypt. Das Zertifikat wird automatisch erstellt und verlängert.'; -$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Die Nutzung von Let\'s Encrypt ist nur möglich, wenn die Domain mindestens eine IP/Port - Kombination mit aktiviertem SSL zugewiesen hat.'; -$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt kann mittels ACME Wildcard-Domains nur via DNS validieren, sorry. Bitte den ServerAlias auf WWW setzen oder deaktivieren'; -$lng['panel']['letsencrypt'] = 'Benutzt Let\'s encrypt'; -$lng['crondesc']['cron_letsencrypt'] = 'Aktualisierung der Let\'s Encrypt Zertifikate'; -$lng['serversettings']['letsencryptca']['title'] = "ACME Umgebung"; -$lng['serversettings']['letsencryptca']['description'] = "Umgebung, welche genutzt wird um Zertifikate zu bestellen."; -$lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt Ländercode"; -$lng['serversettings']['letsencryptcountrycode']['description'] = "2 - stelliger Ländercode, welcher benutzt wird um Let's Encrypt - Zertifikate zu bestellen."; -$lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt Bundesland"; -$lng['serversettings']['letsencryptstate']['description'] = "Bundesland, welches benutzt wird, um Let's Encrypt - Zertifikate zu bestellen."; -$lng['serversettings']['letsencryptchallengepath']['title'] = "Verzeichnis für Let's Encrypt challenges"; -$lng['serversettings']['letsencryptchallengepath']['description'] = "Let's Encrypt challenges werden aus diesem Verzeichnis über einen globalen Alias ausgeliefert."; -$lng['serversettings']['letsencryptkeysize']['title'] = "Schlüsselgröße für neue Let's Encrypt Zertifikate"; -$lng['serversettings']['letsencryptkeysize']['description'] = "Größe des Schlüssels in Bit für neue Let's Encrypt Zertifikate."; -$lng['serversettings']['letsencryptreuseold']['title'] = "Let's Encrypt Schlüssel wiederverwenden"; -$lng['serversettings']['letsencryptreuseold']['description'] = "Wenn dies aktiviert ist, wird der alte Schlüssel bei jeder Verlängerung verwendet, andernfalls wird ein neues Paar generiert."; -$lng['serversettings']['leenabled']['title'] = "Let's Encrypt verwenden"; -$lng['serversettings']['leenabled']['description'] = "Wenn dies aktiviert ist, können Kunden durch Froxlor automatisch generierte und verlängerbare Let's Encrypt SSL-Zertifikate für Domains mit SSL IP/Port nutzen.

Bitte die Webserver-Konfiguration beachten wenn aktiviert, da dieses Feature eine spezielle Konfiguration benötigt."; -$lng['domains']['ssl_redirect_temporarilydisabled'] = "
Die SSL-Umleitung ist, während ein neues Let's Encrypt - Zertifikat erstellt wird, temporär deaktiviert. Die Umleitung wird nach der Zertifikatserstellung wieder aktiviert."; - -// Added for CAA record support -$lng['serversettings']['caa_entry']['title'] = 'CAA DNS Einträge generieren'; -$lng['serversettings']['caa_entry']['description'] = 'Generiert CAA Einträge automatisch für alle Domains mit aktiviertem SSL und Let\'s Encrypt'; -$lng['serversettings']['caa_entry_custom']['title'] = 'Zusätzliche CAA DNS Einträge'; -$lng['serversettings']['caa_entry_custom']['description'] = 'DNS Certification Authority Authorization (CAA) verwendet das Domain Name System, um dem Besitzer einer Domain die Möglichkeit zu bieten, gewisse Zertifizierungsstellen (CAs) dazu zu berechtigen,
ein Zertifikat für die betroffene Domain auszustellen. CAA Records sollen verhindern, dass Zertifikate fälschlicherweise für eine Domain ausgestellt werden.

Der Inhalt dieses Feldes wird direkt in die DNS Zone übernommen (eine Zeile pro CAA Record). Wenn Let\'s Encrypt für eine Domain aktiviert wurde und die obige Option aktiviert wurde, wird immer automatisch dieser Eintrag angefügt und muss nicht selber angegeben werden:
0 issue "letsencrypt.org" (Wenn wildcard aktiviert ist, wird statdessen issuewild benutzt).
Um Incident Reporting per Mail zu aktivieren, muss eine iodef Zeile angefügt werden. Ein Beispiel für einen Report an me@example.com wäre:
0 iodef "mailto:me@example.com"

ACHTUNG: Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Die CAA finalen Einträge könnten daher falsch sein!'; - -// Autoupdate -$lng['admin']['autoupdate'] = 'Auto-Update'; -$lng['error']['customized_version'] = 'Es scheint als wäre die Froxlor Installation angepasst worden. Kein Support, sorry.'; -$lng['error']['autoupdate_0'] = 'Unbekannter Fehler'; -$lng['error']['autoupdate_1'] = 'PHP Einstellung allow_url_fopen ist deaktiviert. Autoupdate benötigt diese Option, bitte in der php.ini aktivieren.'; -$lng['error']['autoupdate_2'] = 'PHP zip Erweiterung nicht gefunden, bitte prüfen, ob diese installiert und aktiviert ist.'; -$lng['error']['autoupdate_4'] = 'Das froxlor Archiv konnte nicht auf der Festplatte gespeichert werden :('; -$lng['error']['autoupdate_5'] = 'version.froxlor.org gab ungültige Werte zurück :('; -$lng['error']['autoupdate_6'] = 'Woops, keine (gültige) Version angegeben für den Download :('; -$lng['error']['autoupdate_7'] = 'Das heruntergeladene Archiv konnte nicht gefunden werden :('; -$lng['error']['autoupdate_8'] = 'Das Archiv konnte nicht entpackt werden :('; -$lng['error']['autoupdate_9'] = 'Die heruntergeladene Datei konnte nicht verifiziert werden. Bitte erneut versuchen zu aktualisieren.'; -$lng['error']['autoupdate_10'] = 'Minimum unterstützte Version von PHP ist 7.4.0'; -$lng['error']['autoupdate_11'] = 'Webupdate ist deaktiviert'; - -$lng['domains']['termination_date'] = 'Kündigungsdatum'; -$lng['domains']['termination_date_overview'] = 'gekündigt zum '; -$lng['panel']['set'] = 'Setzen'; -$lng['customer']['selectserveralias_addinfo'] = 'Diese Option steht beim Bearbeiten der Domain zur Verfügung. Als Initial-Wert wird die Einstellung der Hauptdomain vererbt.'; -$lng['error']['mailaccistobedeleted'] = "Ein vorheriges Konto mit dem gleichen Namen (%s) wird aktuell noch gelöscht und kann daher derzeit nicht angelegt werden"; - -$lng['menue']['extras']['backup'] = 'Sicherung'; -$lng['extras']['backup'] = 'Sicherung erstellen'; -$lng['extras']['backup_web'] = 'Web-Daten sichern'; -$lng['extras']['backup_mail'] = 'E-Mail Daten sichern'; -$lng['extras']['backup_dbs'] = 'Datenbanken sichern'; -$lng['error']['customerhasongoingbackupjob'] = 'Es gibt noch einen austehenden Backup-Job. Bitte haben Sie etwas Geduld.'; -$lng['success']['backupscheduled'] = 'Ihre Sicherung wurde erfolgreich geplant. Bitte warten Sie nun, bis diese abgearbeitet wurde.'; -$lng['success']['backupaborted'] = 'Die geplante Sicherung wurde abgebrochen'; -$lng['crondesc']['cron_backup'] = 'Ausstehende Sicherungen erstellen'; -$lng['error']['backupfunctionnotenabled'] = 'Die Sicherungs-Funktion is nicht aktiviert'; -$lng['serversettings']['backupenabled']['title'] = "Backup für Kunden aktivieren"; -$lng['serversettings']['backupenabled']['description'] = "Wenn dies aktiviert ist, kann der Kunde Sicherungen planen (cron-backup) welche ein Archiv in sein Heimatverzeichnis ablegt (Unterordner vom Kunden wählbar)"; -$lng['extras']['path_protection_label'] = 'Wichtig'; -$lng['extras']['path_protection_info'] = 'Wir raten dringend dazu den angegebenen Pfad zu schützen, siehe "Extras" -> "Verzeichnisschutz"'; -$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Datensicherung für Kunde %loginname%'; - -$lng['error']['dns_domain_nodns'] = 'DNS ist für diese Domain nicht aktiviert'; -$lng['error']['dns_content_empty'] = 'Keinen Inhalt angegeben'; -$lng['error']['dns_content_invalid'] = 'DNS Eintrag ungültig'; -$lng['error']['dns_arec_noipv4'] = 'Keine gültige IP-Adresse für A-Eintrag angegeben'; -$lng['error']['dns_aaaarec_noipv6'] = 'Keine gültige IP-Adresse für AAAA-Eintrag angegeben'; -$lng['error']['dns_mx_prioempty'] = 'Ungültige MX Priorität angegeben'; -$lng['error']['dns_mx_needdom'] = 'Der Wert des MX Eintrags muss ein gültiger Domainname sein'; -$lng['error']['dns_mx_noalias'] = 'Der MX Eintrag darf kein CNAME Eintrag sein.'; -$lng['error']['dns_cname_invaliddom'] = 'Ungültiger Domain-Name für CNAME Eintrag'; -$lng['error']['dns_cname_nomorerr'] = 'Es existiert bereits ein Eintrag mit dem gleichen Namen. Dieser Eintrag kann daher nicht für CNAME genutzt werden.'; -$lng['error']['dns_other_nomorerr'] = 'Es existiert bereits ein CNAME Eintrag mit dem gleichen Namen. Dieser Eintrag kann daher nicht für einen anderen genutzt werden.'; -$lng['error']['dns_ns_invaliddom'] = 'Ungültiger Domain-Name für NS Eintrag'; -$lng['error']['dns_srv_prioempty'] = 'Ungültige SRV Priorität angegeben'; -$lng['error']['dns_srv_invalidcontent'] = 'Ungültiger Wert des SRV Eintrags, dieser muss aus den Feldern weight, port und target, bestehen. Bsp.: 5 5060 sipserver.example.com.'; -$lng['error']['dns_srv_needdom'] = 'Der Wert des SRV Eintrags muss ein gültiger Domainname sein'; -$lng['error']['dns_srv_noalias'] = 'Der SRV Eintrag darf kein CNAME Eintrag sein.'; -$lng['error']['dns_duplicate_entry'] = 'Eintrag existiert bereits'; -$lng['success']['dns_record_added'] = 'Eintrag erfolgreich hinzugefügt'; -$lng['success']['dns_record_deleted'] = 'Eintrag erfolgreich entfernt'; -$lng['dnseditor']['edit'] = 'DNS editieren'; -$lng['dnseditor']['records'] = 'Einträge'; -$lng['error']['dns_notfoundorallowed'] = 'Domain nicht gefunden oder keine Berechtigung'; -$lng['serversettings']['dnseditorenable']['title'] = 'DNS Editor aktivieren'; -$lng['serversettings']['dnseditorenable']['description'] = 'Erlaubt es Admins und Kunden die DNS Einträge ihrer Domains zu verwalten.'; -$lng['dns']['howitworks'] = 'Hier können DNS Einträge für die Domain verwaltet werden. Beachten Sie, dass Froxlor automatisch NS/MX/A/AAAA Einträge generiert. Die benutzerdefinierten Einträge werden bevorzugt, nur fehlende Einträge werden automatisch generiert.'; -$lng['serversettings']['dns_server']['title'] = 'DNS Server Dienst'; -$lng['serversettings']['dns_server']['description'] = 'Dienste müssen mit den froxlor Konfigurationstemplates konfiguriert werden'; - -$lng['error']['domain_nopunycode'] = 'Die Eingabe von Punycode (IDNA) ist nicht notwendig. Die Domain wird automatisch konvertiert.'; -$lng['admin']['dnsenabled'] = 'Zugriff auf DNS Editor'; -$lng['error']['dns_record_toolong'] = 'Records/Labels können maximal 63 Zeichen lang sein'; - -// Added in froxlor 0.9.37-rc1 -$lng['serversettings']['panel_customer_hide_options']['title'] = 'Menüpunkte und Traffic-Charts im Kundenbereich ausblenden'; -$lng['serversettings']['panel_customer_hide_options']['description'] = 'Wählen Sie hier die gewünschten Menüpunkte und Traffic-Charts aus, welche im Kundenbereich ausgeblendet werden sollen. Für Mehrfachauswahl, halten Sie während der Auswahl STRG gedrückt.'; - -// Added in froxlor 0.9.38-rc1 -$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Erlaube Kunden für FTP Benutzer eine Shell auszuwählen'; -$lng['serversettings']['allow_allow_customer_shell']['description'] = 'Bitte beachten: Shell Zugriff gestattet dem Benutzer verschiedene Programme auf Ihrem System auszuführen. Mit großer Vorsicht verwenden. Bitte aktiviere dies nur wenn WIRKLICH bekannt ist, was das bedeutet!!!'; -$lng['serversettings']['available_shells']['title'] = 'Liste der verfügbaren Shells'; -$lng['serversettings']['available_shells']['description'] = 'Komma-getrennte Liste von Shells, die der Kunde für seine FTP-Konten wählen kann.

Hinweis: Die Standard-Shell /bin/false wird immer eine Auswahlmöglichkeit sein (wenn aktiviert), auch wenn diese Einstellung leer ist. Sie ist in jedem Fall der Standardwert für alle FTP-Konten'; -$lng['serversettings']['le_froxlor_enabled']['title'] = "Let's Encrypt für den froxlor Vhost verwenden"; -$lng['serversettings']['le_froxlor_enabled']['description'] = "Wenn dies aktiviert ist, erstellt froxlor für seinen vhost automatisch ein Let's Encrypt Zertifikat."; -$lng['serversettings']['le_froxlor_redirect']['title'] = "SSL-Weiterleitung für den froxlor Vhost aktivieren"; -$lng['serversettings']['le_froxlor_redirect']['description'] = "Wenn dies aktiviert ist, werden alle HTTP Anfragen an die entsprechende SSL Seite weitergeleitet."; -$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost Einstellungen'; -$lng['serversettings']['option_unavailable_websrv'] = '
Nur verfügbar für: %s'; -$lng['serversettings']['option_unavailable'] = '
Option aufgrund anderer Einstellungen nicht verfügbar.'; -$lng['serversettings']['letsencryptacmeconf']['title'] = "Pfad zu acme.conf"; -$lng['serversettings']['letsencryptacmeconf']['description'] = "Dateiname der Konfiguration, die dem Webserver erlaubt, die ACME-Challenges zu bedienen."; -$lng['admin']['hostname'] = 'Hostname'; -$lng['admin']['memory'] = 'Speicherauslastung'; -$lng['serversettings']['mail_use_smtp'] = 'Nutze SMTP für das Senden von E-Mails'; -$lng['serversettings']['mail_smtp_host'] = 'SMTP Server'; -$lng['serversettings']['mail_smtp_usetls'] = 'Aktiviere TLS Verschlüsselung'; -$lng['serversettings']['mail_smtp_auth'] = 'Nutze SMTP Authentifizierung'; -$lng['serversettings']['mail_smtp_port'] = 'TCP Port für SMTP'; -$lng['serversettings']['mail_smtp_user'] = 'SMTP Benutzer'; -$lng['serversettings']['mail_smtp_passwd'] = 'SMTP Passwort'; -$lng['domains']['ssl_certificates'] = 'SSL Zertifikate'; -$lng['domains']['ssl_certificate_removed'] = 'Das Zertifikat mit der ID #%s wurde erfolgreich gelöscht.'; -$lng['domains']['ssl_certificate_error'] = "Fehler beim Lesen des Zertifikats für die Domain: %s"; -$lng['domains']['no_ssl_certificates'] = "Es wurden keine SSL-Zertifikate gefunden"; -$lng['admin']['webserversettings_ssl'] = 'Webserver SSL-Einstellungen'; -$lng['admin']['domain_hsts_maxage']['title'] = 'HTTP Strict Transport Security (HSTS)'; -$lng['admin']['domain_hsts_maxage']['description'] = '"max-age" Wert für den Strict-Transport-Security Header
Der Wert 0 deaktiviert HSTS für diese Domain. Meist wird der Wert 31536000 gerne genutzt (ein Jahr).'; -$lng['admin']['domain_hsts_incsub']['title'] = 'Inkludiere HSTS für jede Subdomain'; -$lng['admin']['domain_hsts_incsub']['description'] = 'Die optionale "includeSubDomains" Direktive, wenn vorhanden, signalisiert dem UA, dass die HSTS Regel für diese Domain und auch jede Subdomain dieser gilt.'; -$lng['admin']['domain_hsts_preload']['title'] = 'Füge Domain in die HSTS preload Liste hinzu'; -$lng['admin']['domain_hsts_preload']['description'] = 'Wenn die Domain in die HSTS preload Liste, verwaltet von Chrome (und genutzt von Firefox und Safari), hinzugefügt werden soll, dann aktivieren Sie diese Einstellung.
Die preload-Direktive zu senden kann PERMANTENTE KONSEQUENZEN haben und dazu führen, dass Benutzer auf diese Domain und auch Subdomains nicht zugreifen können.
Beachten Sie die Details unter hstspreload.appspot.com/#removal bevor ein Header mit "preload" gesendet wird.'; - -$lng['serversettings']['http2_support']['title'] = 'HTTP2 Unterstützung'; -$lng['serversettings']['http2_support']['description'] = 'Aktiviere HTTP2 Unterstützung für SSL.
NUR AKTIVIEREN, WENN DER WEBSERVER DIESE FUNKTION UNTERSTÜTZT (nginx version 1.9.5+, apache2 version 2.4.17+)'; - -$lng['error']['noipportgiven'] = 'Keine IP/Port angegeben'; - -// Added in froxlor 0.9.38.8 -$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling'; -$lng['admin']['domain_ocsp_stapling']['description'] = 'Siehe Wikipedia für eine ausführliche Beschreibung von OCSP-Stapling'; -$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '
WARNUNG: Nginx unterstützt OCSP-Stapling erst ab Version 1.3.7. Wenn Ihre Version älter ist, wird der Webserver bei aktiviertem OCSP-Stapling NICHT korrekt starten.'; -$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: Pfad zum OCSP-Stapling-Cache'; -$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Konfiguriert den Cache-Pfad zum Zwischenspeichern der OCSP-Antworten,
die an TLS-Handshakes angehängt werden.'; -$lng['serversettings']['nssextrausers']['title'] = 'Verwende libnss-extrausers anstatt libnss-mysql'; -$lng['serversettings']['nssextrausers']['description'] = 'Lese Benutzer nicht direkt aus der Datenbank sondern über Dateien. Bitte nur aktivieren, wenn die entsprechende Konfiguration vorgenommen wurde (System -> libnss-extrausers).
Nur für Debian/Ubuntu (oder wenn libnss-extrausers manuell kompiliert wurde!)'; -$lng['admin']['domain_http2']['title'] = 'HTTP2 Unterstützung'; -$lng['admin']['domain_http2']['description'] = 'Siehe Wikipedia für eine ausführliche Beschreibung von HTTP2'; -$lng['admin']['testmail'] = 'SMTP Test'; -$lng['success']['testmailsent'] = 'Test E-Mail erfolgreich gesendet'; -$lng['serversettings']['le_domain_dnscheck']['title'] = "Validiere DNS der Domains wenn Let's Encrypt genutzt wird"; -$lng['serversettings']['le_domain_dnscheck']['description'] = "Wenn aktiviert wird froxlor überprüfen ob die DNS Einträge der Domains, welche ein Let's Encrypt Zertifikat beantragt, mindestens auf eine der System IP Adressen auflöst."; -$lng['menue']['phpsettings']['fpmdaemons'] = 'PHP-FPM Versionen'; -$lng['admin']['phpsettings']['activephpconfigs'] = 'In Verwendung für PHP-Konfiguration(en)'; -$lng['admin']['phpsettingsforsubdomains'] = 'PHP-Config für alle Subdomains übernehmen:'; -$lng['serversettings']['phpsettingsforsubdomains']['description'] = 'Wenn ja, wird die gewählte PHP-Config für alle Subdomains übernommen'; -$lng['serversettings']['leapiversion']['title'] = "Wählen Sie die Let's Encrypt ACME Implementierung"; -$lng['serversettings']['leapiversion']['description'] = "Aktuell unterstützt froxlor lediglich die ACME v2 Implementierung von Let's Encrypt."; -$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Füge "-pass-header Authorization" / "CGIPassAuth On" in Vhosts ein'; -$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'SSL Protokollversion festlegen'; -$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'Dies ist eine Liste von SSL/TLS Protokollversionen die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn SSL verwendet wird. Hinweis: Ältere Browser sind möglicherweise nicht vollständig zum neusten Protokoll kompatibel.

Standard-Wert ist:
TLSv1.2
'; -$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Erlaubte Dateiendungen'; -$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Beschränkt die Dateierweiterungen des Haupt-Skripts, das FPM zu parsen erlaubt. Dies kann Konfigurationsfehler auf der Webserverseite verhindern. Sie sollten FPM nur auf .php Erweiterungen beschränken, um zu verhindern, dass bösartige Nutzter andere Erweiterungen verwenden, um PHP Code auszuführen. Standardwert: .php'; -$lng['phpfpm']['ini_flags'] = 'Mögliche php_flags für die php.ini. Pro Zeile eine Direktive'; -$lng['phpfpm']['ini_values'] = 'Mögliche php_values für die php.ini. Pro Zeile eine Direktive'; -$lng['phpfpm']['ini_admin_flags'] = 'Mögliche php_admin_flags für die php.ini. Pro Zeile eine Direktive'; -$lng['phpfpm']['ini_admin_values'] = 'Mögliche php_admin_values für die php.ini. Pro Zeile eine Direktive'; -$lng['serversettings']['phpfpm_settings']['envpath'] = 'Pfade für die PATH Umgebungsvariable. Leerlassen, um keine PATH Umgebungsvariable zu setzen.'; -$lng['success']['settingsimported'] = 'Einstellungnen erfolgreich importiert'; -$lng['error']['jsonextensionnotfound'] = 'Diese Funktion benötigt die PHP json-Erweiterung.'; - -// added in froxlor 0.9.39 -$lng['admin']['plans']['name'] = 'Plan Name'; -$lng['admin']['plans']['description'] = 'Beschreibung'; -$lng['admin']['plans']['last_update'] = 'Zuletzt aktualisiert'; -$lng['admin']['plans']['plans'] = 'Hosting Pläne'; -$lng['admin']['plans']['plan_details'] = 'Plan Details'; -$lng['admin']['plans']['add'] = 'Neuen Plan anlegen'; -$lng['admin']['plans']['edit'] = 'Plan editieren'; -$lng['admin']['plans']['use_plan'] = 'Plan übernehmen'; -$lng['question']['plan_reallydelete'] = 'Wollen Sie den Hosting-Plan "%s" wirklich löschen?'; -$lng['admin']['notryfiles']['title'] = 'Keine generierte try_files Anweisung'; -$lng['admin']['notryfiles']['description'] = 'Wählen Sie "Ja", wenn eine eigene try_files Direktive in den "eigenen Vhost Einstellungen" angegeben werden soll (z.B. nötig für manche Wordpress Plugins).'; -$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Überschreibe FPM-Daemon Einstellungen (pm, max_children, etc.)'; -$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '
Nur verwendet wenn "Überschreibe FPM-Daemon Einstellungen" auf "Ja" gestellt ist'; -$lng['panel']['backuppath']['title'] = 'Pfad zur Ablage der Backups'; -$lng['panel']['backuppath']['description'] = 'In diesem Ordner werden die Backups abgelegt. Wenn das Sichern von Web-Daten aktiviert ist, werden alle Dateien aus dem Heimatverzeichnis gesichert, exklusive des hier angegebenen Backup-Ordners.'; - -// added in froxlor 0.10.0 -$lng['panel']['none_value'] = 'Keine'; -$lng['menue']['main']['apihelp'] = 'API Hilfe'; -$lng['menue']['main']['apikeys'] = 'API Keys'; -$lng['apikeys']['no_api_keys'] = 'Keine API Keys gefunden'; -$lng['apikeys']['key_add'] = 'API Key hinzufügen'; -$lng['apikeys']['apikey_removed'] = 'Der API Key mit der ID #%s wurde erfolgreich gelöscht.'; -$lng['apikeys']['allowed_from'] = 'Erlaube Zugriff von'; -$lng['apikeys']['allowed_from_help'] = 'Komma getrennte Liste von IPs oder Netzen.
Standard ist leer (von überall erlaubt).'; -$lng['apikeys']['valid_until'] = 'Gültig bis'; -$lng['apikeys']['valid_until_help'] = 'Datum Gültigkeitsende, Format JJJJ-MM-TT'; -$lng['serversettings']['enable_api']['title'] = 'Aktiviere externe API Nutzung'; -$lng['serversettings']['enable_api']['description'] = 'Um die froxlor API nutzen zu können, muss diese Option aktiviert sein. Für detaillierte Informationen siehe https://docs.froxlor.org/'; -$lng['serversettings']['dhparams_file']['title'] = 'DHParams Datei (Diffie–Hellman key exchange)'; -$lng['serversettings']['dhparams_file']['description'] = 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.
Beispiel: /etc/ssl/webserver/dhparams.pem

Existiert die Datei nicht, wird sie wie folgt erstellt: openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.'; -$lng['2fa']['2fa'] = '2FA Optionen'; -$lng['2fa']['2fa_enabled'] = 'Aktiviere Zwei-Faktor Authentifizierung (2FA)'; -$lng['login']['2fa'] = 'Zwei-Faktor Authentifizierung (2FA)'; -$lng['login']['2facode'] = 'Bitte 2FA Code angeben'; -$lng['2fa']['2fa_removed'] = '2FA erfolgreich gelöscht'; -$lng['2fa']['2fa_added'] = '2FA erfolgreich aktiviert
2FA Details öffnen'; -$lng['2fa']['2fa_add'] = '2FA aktivieren'; -$lng['2fa']['2fa_delete'] = '2FA deaktivieren'; -$lng['2fa']['2fa_verify'] = 'Code verifizieren'; -$lng['mails']['2fa']['mailbody'] = 'Hallo,\n\nihr 2FA-Login Code lautet: {CODE}\n\nDies ist eine automatisch generierte\neMail, bitte antworten Sie nicht auf\ndiese Mitteilung.\n\nIhr Administrator'; -$lng['mails']['2fa']['subject'] = 'Froxlor - 2FA Code'; -$lng['2fa']['2fa_overview_desc'] = 'Hier kann für das Konto eine Zwei-Faktor-Authentisierung aktiviert werden.

Es kann entweder eine Authenticator-App (time-based one-time password / TOTP) genutzt werden oder ein Einmalpasswort, welches nach erfolgreichem Login an die hinterlegte E-Mail Adresse gesendet wird.'; -$lng['2fa']['2fa_email_desc'] = 'Das Konto ist eingerichtet, um Einmalpasswörter per E-Mail zu erhalten. Zum Deaktivieren, klicke auf "' . $lng['2fa']['2fa_delete'] . '"'; -$lng['2fa']['2fa_ga_desc'] = 'Das Konto ist eingerichtet, um zeitbasierte Einmalpasswörter via Authenticator-App zu erhalten. Um die gewünschte Authenticator-App einzurichten, scanne bitte den untenstehenden QR-Code. Zum Deaktivieren, klicke auf "' . $lng['2fa']['2fa_delete'] . '"'; -$lng['admin']['logviewenabled'] = 'Zugriff auf access/error-Logdateien'; -$lng['panel']['viewlogs'] = 'Logdateien einsehen'; -$lng['panel']['not_configured'] = 'Das System wurde noch nicht konfiguriert. Klicke auf den Button um die Installation zu starten.'; -$lng['panel']['ihave_configured'] = 'Ich habe die Dienste konfiguriert'; -$lng['panel']['system_is_configured'] = 'Das System ist bereits konfiguriert'; -$lng['panel']['settings_before_configuration'] = 'Stelle sicher, dass die Einstellungen angepasst wurden bevor die Dienste konfiguriert werden.'; -$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Lösche Domain %domain% von PowerDNS Datenbank'; -$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Lösche SSL Dateien von Domain %domain%'; -$lng['admin']['novhostcontainer'] = '

Keine der IPs und Ports hat die Option "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" aktiviert, einige Einstellungen sind daher nicht verfügbar.'; -$lng['serversettings']['errorlog_level']['title'] = 'Ausführlichkeit des Fehlerprotokolls'; -$lng['serversettings']['errorlog_level']['description'] = 'Steuert die Ausführlichkeit des Fehlerprotokolls. Voreinstellung ist "warn" bei Apache und "error" bei Nginx.'; -$lng['serversettings']['letsencryptecc']['title'] = "ECC / ECDSA Zertifikate ausstellen"; -$lng['serversettings']['letsencryptecc']['description'] = "Wenn eine Schlüsselgröße ausgewählt wird, werden ECC / ECDSA Zertifikate erstellt"; -$lng['serversettings']['froxloraliases']['title'] = "Domain Aliase für Froxlor Vhost"; -$lng['serversettings']['froxloraliases']['description'] = "Komma getrennte Liste von Domains, welche als Server Alias zum Froxlor Vhost hinzugefügt werden"; - -$lng['serversettings']['ssl']['tlsv13_cipher_list']['title'] = 'Explizite TLSv1.3 Ciphers, wenn genutzt'; -$lng['serversettings']['ssl']['tlsv13_cipher_list']['description'] = 'Dies ist eine Liste von Ciphers, die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn eine TLSv1.3 Verbindung hergestellt werden soll. Eine Liste aller Ciphers und wie diese hinzugefügt/ausgeschlossen werden ist der Dokumentation für TLSv1.3 zu entnehmen.

Standard-Wert ist leer'; -$lng['usersettings']['api_allowed']['title'] = 'Erlaube API Zugriff'; -$lng['usersettings']['api_allowed']['description'] = 'Wenn in den Einstellungen aktiviert, kann der Benutzer API Schlüssel erstellen und auf die froxlor API Zugreifen'; -$lng['usersettings']['api_allowed']['notice'] = 'API Zugriff ist für dieses Konto deaktiviert.'; -$lng['serversettings']['default_sslvhostconf']['title'] = 'Standard SSL vHost-Einstellungen'; -$lng['serversettings']['includedefault_sslvhostconf'] = 'Nicht-SSL vHost-Einstellungen in SSL-vHost inkludieren'; -$lng['admin']['ownsslvhostsettings'] = 'Eigene SSL vHost-Einstellungen'; -$lng['admin']['ipsandports']['ssl_default_vhostconf_domain'] = 'Standard SSL vHost-Einstellungen für jeden Domain-Container'; -$lng['customer']['total_diskspace'] = 'Gesamtspeicherplatz'; -$lng['admin']['domain_override_tls'] = 'Überschreibe System TLS Einstellungen'; -$lng['domains']['isaliasdomainof'] = 'Ist Aliasdomain für %s'; -$lng['serversettings']['apply_specialsettings_default']['title'] = 'Standardwert für "' . $lng['admin']['specialsettingsforsubdomains'] . "' Einstellung beim Bearbeiten einer Domain"; -$lng['serversettings']['apply_phpconfigs_default']['title'] = 'Standardwert für "' . $lng['admin']['phpsettingsforsubdomains'] . "' Einstellung beim Bearbeiten einer Domain"; -$lng['admin']['domain_sslenabled'] = 'Aktiviere Nutzung von SSL'; -$lng['admin']['domain_honorcipherorder'] = 'Bevorzuge die serverseitige Cipher Reihenfolge, Standardwert nein'; -$lng['admin']['domain_sessiontickets'] = 'Aktiviere TLS Sessiontickets (RFC 5077), Standardwert ja'; - -$lng['admin']['domain_sessionticketsenabled']['title'] = 'Aktiviere Nutzung von TLS Sessiontickets systemweit'; -$lng['admin']['domain_sessionticketsenabled']['description'] = 'Standardwert yes
Erfordert apache-2.4.11+ oder nginx-1.5.9+'; - -$lng['serversettings']['phpfpm_settings']['restart_note'] = 'Achtung: Der Code wird nicht auf Fehler geprüft. Bei etwaigen Fehlern könnte der PHP-FPM-Prozess nicht mehr starten!'; -$lng['serversettings']['phpfpm_settings']['custom_config']['title'] = 'Benutzerdefinierte Konfiguration'; -$lng['serversettings']['phpfpm_settings']['custom_config']['description'] = 'Füge eine benutzerdefinierte Einstellungen zur PHP-FPM Instanz hinzu, beispielsweise pm.status_path = /status für Monitoring. Unten ersichtliche Variablen können verwendet werden.' . ' ' . $lng['serversettings']['phpfpm_settings']['restart_note'] . ''; - -$lng['serversettings']['awstats']['logformat']['title'] = 'LogFormat Einstellung'; -$lng['serversettings']['awstats']['logformat']['description'] = 'Wenn ein benutzerdefiniertes LogFormat beim Webserver verwendet wird, muss LogFormat von awstats ebenso angepasst werden.
Standard ist 1. Für weitere Informationen siehe Dokumentation unter hier.'; -$lng['error']['cannotdeletesuperadmin'] = 'Der erste Administrator kann nicht gelöscht werden.'; -$lng['error']['no_wwwcnamae_ifwwwalias'] = 'Es kann kein CNAME Eintrag für "www" angelegt werden, da die Domain einen www-Alias aktiviert hat. Ändere diese Einstellung auf "Kein Alias" oder "Wildcard Alias"'; -$lng['serversettings']['hide_incompatible_settings'] = 'Inkompatible Einstellungen ausblenden'; - -$lng['serversettings']['soaemail'] = 'Mail-Adresse für SOA-Einträge (verwendet Panel-Absender-Name der Panel-Einstellungen falls leer)'; -$lng['imprint'] = 'Impressum'; -$lng['serversettings']['imprint_url']['title'] = 'URL zum Impressum'; -$lng['serversettings']['imprint_url']['description'] = 'Die URL zur Impressums-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.'; -$lng['terms'] = 'AGB'; -$lng['serversettings']['terms_url']['title'] = 'URL zu den AGB'; -$lng['serversettings']['terms_url']['description'] = 'Die URL zur AGB-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.'; -$lng['privacy'] = 'Datenschutzerklärung'; -$lng['serversettings']['privacy_url']['title'] = 'URL zur Datenschutzerklärung'; -$lng['serversettings']['privacy_url']['description'] = 'Die URL zur Datenschutzerklärungs-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.'; -$lng['admin']['domaindefaultalias'] = 'Standard ServerAlias-Angabe für neue Domains'; - -$lng['serversettings']['logo_image_header']['title'] = 'Logo Bild (Header)'; -$lng['serversettings']['logo_image_header']['description'] = 'Das hochgeladene Bild wird als Logo oben links nach dem Login angezeigt (empfohlene Höhe sind 30px)'; -$lng['serversettings']['logo_image_login']['title'] = 'Logo Bild (Login)'; -$lng['serversettings']['logo_image_login']['description'] = 'Das hochgeladene Bild wird als Logo während des Logins angezeigt'; -$lng['panel']['image_field_delete'] = 'Das momentan vorhandene Bild löschen'; -$lng['serversettings']['logo_overridetheme']['title'] = 'Überschreibe Theme-Logo mit "Logo Bild" (Header und Login, siehe unten)'; -$lng['serversettings']['logo_overridetheme']['description'] = 'Ist die Nutzung eines hochgeladenen Logos gewünscht, muss diese Einstellung auf "Ja" gesetzt werden. Alternativ kann weiterhin das Theme-basierte Überschreiben via "logo_custom.png" und "logo_custom_login.png" genutzt werden.'; -$lng['serversettings']['logo_overridecustom']['title'] = 'Überschreibe benutzerdefinierte Theme-Logos (logo_custom.png und logo_custom_login.png) mit "Logo Bold" (Header und Login, siehe unten)'; -$lng['serversettings']['logo_overridecustom']['description'] = 'Ist diese Einstellung aktiv, werden benutzerdefinierte Logos im Theme-Ordner mit dem "Logo Bild" ersetzt'; -$lng['serversettings']['createstdsubdom_default']['title'] = 'Standardwert für "'.$lng['admin']['stdsubdomain_add'].'" bei Erstellung eines Kunden'; -$lng['serversettings']['froxlorusergroup']['title'] = 'Benutzerdefinierte Gruppe für alle Kunden-Benutzer'; -$lng['serversettings']['froxlorusergroup']['description'] = 'Voraussetzung hierfür ist die Nutzung von libnss-extrausers (System-Einstellungen). Ein leerer Wert bedeutet, es wird keine Gruppe erstellt, bzw. vorhandene Gruppe wird entfernt.'; -$lng['error']['local_group_exists'] = 'Die angegebene Gruppe existiert bereits auf dem System'; -$lng['error']['local_group_invalid'] = 'Der angegebene Gruppen-Name ist nicht gültig'; -$lng['error']['invaliddnsforletsencrypt'] = 'Die DNS-Einträge der Domain enhalten keine der gewählten IP Adressen. Let\'s Encrypt Zertifikats-Erstellung ist nicht möglich.'; -$lng['error']['notallowedphpconfigused'] = 'Nutzung einer PHP-Konfiguration welche nicht dem Kunden zugeordnet ist'; - -$lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'] = 'Für aktuelle Kunden automatisch hinzufügen'; -$lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'] = 'Ist diese Einstellung aktiv, wird die Konfiguration automatisch allen aktuell existierenden Kunden-Accounts zugewiesen. Diese Einstellung ist nicht permanent, kann aber mehrfach / nach Bedarf ausgeführt werden.'; -$lng['error']['pathmustberelative'] = 'Der Benutzer hat nicht die benötigten Berechtigungen, um Pfade außerhalb des Kunden-Heimatverzeichnisses anzugeben. Bitte einen relativen Pfad angeben (kein führendes /).'; -$lng['serversettings']['acmeshpath']['title'] = 'Pfad zu acme.sh'; -$lng['serversettings']['acmeshpath']['description'] = 'Installationspfad zu acme.sh, inklusive acme.sh Script
Standard ist /root/.acme.sh/acme.sh'; - -$lng['panel']['usage_statistics'] = 'Resourcen-Verbrauch'; -$lng['panel']['security_question'] = 'Sicherheitsabfrage'; -$lng['panel']['listing_empty'] = 'Keine Einträge gefunden'; -$lng['admin']['configfiles']['finishnote'] = 'Parameter Datei erfolgreich erstellt. Folgende Befehle müssen als root ausgeführt werden:'; -$lng['admin']['configfiles']['description'] = 'System-Dienste konfigurieren'; -$lng['admin']['configfiles']['skipconfig'] = 'Nicht (erneut) konfigurieren'; -$lng['admin']['configfiles']['recommendednote'] = 'Empfohlene/benötigte Dienste anhand der aktuellen Systemeinstellungen'; -$lng['admin']['configfiles']['selectrecommended'] = 'Empfohlene wählen'; -$lng['update']['description'] = 'Aktualisierung der froxlor Datenbank'; -$lng['admin']['smtpsettings'] = 'SMTP Einstellungen'; -$lng['panel']['unspecified'] = 'keine Angabe'; -$lng['admin']['smtptestaddr'] = 'Test-Email senden an'; -$lng['admin']['smtptestnote'] = 'Bitte beachten: Die untenstehenden Werte reflektieren die aktuellen Einstellungen und können auch nur dort angepasst werden (siehe Link in der oberen rechten Ecke)'; -$lng['panel']['backtooverview'] = 'Zurück zur Übersicht'; -$lng['panel']['settingsmode'] = 'Modus'; -$lng['panel']['settingsmodebasic'] = 'Einfach'; -$lng['panel']['settingsmodeadvanced'] = 'Erweitert'; -$lng['panel']['settingsmodetoggle'] = 'Modus umschalten'; -$lng['panel']['modalclose'] = 'Schließen'; -$lng['panel']['managetablecolumnsmodal']['title'] = 'Tabellenspalten verwalten'; -$lng['panel']['managetablecolumnsmodal']['description'] = 'Hier können die angezeigten Tabellenspalten angepasst werden'; -$lng['question']['plan_reallydelete'] = 'Wollen Sie den Api-Key wirklich löschen?'; diff --git a/lng/it.lng.php b/lng/it.lng.php new file mode 100644 index 00000000..1ff50187 --- /dev/null +++ b/lng/it.lng.php @@ -0,0 +1,1825 @@ + + * @author Luca Piona + * @author Luca Longinotti + * @author Emilien + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + 'admin' => [ + 'overview' => 'Generale', + 'ressourcedetails' => 'Risorse utilizzate', + 'systemdetails' => 'Dettagli sistema', + 'froxlordetails' => 'Dettagli Froxlor', + 'installedversion' => 'Versione installata', + 'latestversion' => 'Ultima versione disponibile', + 'lookfornewversion' => [ + 'clickhere' => 'Cerca sul web', + 'error' => 'Errore durante la lettura', + ], + 'resources' => 'Risorse', + 'customer' => 'Cliente', + 'customers' => 'Clienti', + 'customer_add' => 'Crea cliente', + 'customer_edit' => 'Modifica cliente', + 'domains' => 'Domini', + 'domain_add' => 'Crea dominio', + 'domain_edit' => 'Modifica dominio', + 'subdomainforemail' => 'Sottodominio utilizzabile come dominio Email', + 'admin' => 'Admin', + 'admins' => 'Admin', + 'admin_add' => 'Crea admin', + 'admin_edit' => 'Modifica admin', + 'customers_see_all' => 'Può vedere tutti i clienti?', + 'domains_see_all' => 'Può vedere tutti i domini?', + 'change_serversettings' => 'Può cambiare le impostazioni del server?', + 'server' => 'Sistema', + 'serversettings' => 'Opzioni', + 'rebuildconf' => 'Rigenera configurazione', + 'stdsubdomain' => 'Sottodominio standard', + 'stdsubdomain_add' => 'Crea sottodominio standard', + 'phpenabled' => 'PHP abilitato', + 'deactivated' => 'Disattiva', + 'deactivated_user' => 'Disattiva utente', + 'sendpassword' => 'Invia password', + 'ownvhostsettings' => 'Impostazioni vHost speciali', + 'configfiles' => [ + 'serverconfiguration' => 'Configurazione servizi', + 'overview' => 'Panoramica', + 'distribution' => 'Distribuzione', + 'service' => 'Servizio', + 'daemon' => 'Demone', + 'etc' => 'Altro (Sistema)', + 'choosedistribution' => '-- Scegli una distribuzione --', + 'chooseservice' => '-- Scegli un servizio --', + 'choosedaemon' => '-- Scegli un demone --', + 'statistics' => 'Statistiche', + 'compactoverview' => 'Visualizzazione-Compatta', + 'wizard' => 'Wizard (assistente)', + 'http' => 'Server WEB (HTTP)', + 'dns' => 'Nameserver (DNS)', + 'mail' => 'Server di posta elettronica (IMAP/POP3)', + 'smtp' => 'Server di posta elettronica (SMTP)', + 'ftp' => 'Server FTP', + ], + 'templates' => [ + 'templates' => 'Template', + 'template_add' => 'Aggiungi template', + 'template_edit' => 'Modifica template', + 'action' => 'Azione', + 'email' => 'Email', + 'subject' => 'Soggetto:', + 'mailbody' => 'Testo dell\'Email', + 'createcustomer' => 'Email di benvenuto per i nuovi clienti', + 'pop_success' => 'Benvenuto per ogni nuovo account Email', + 'template_replace_vars' => 'Variabili da cambiare nel template:', + 'FIRSTNAME' => 'Rimpiazzato con il nome del cliente.', + 'NAME' => 'Rimpiazzato con il cognome del cliente.', + 'USERNAME' => 'Rimpiazzato con il nome utente dell\'account.', + 'PASSWORD' => 'Rimpiazzato con la password dell\'account.', + 'EMAIL' => 'Rimapiazzato con l\'indirizzo dell\'account.', + 'TRAFFIC' => 'Sostituito con il traffico che è stato assegnato al cliente.', + 'TRAFFICUSED' => 'Sostituito con il traffico che è stato usato dal cliente.', + 'pop_success_alternative' => 'Email di Benvenuto spedita all\'indirizzo alternativo per i nuovi account email', + 'EMAIL_PASSWORD' => 'Sostituito con la password dell\'account POP3/IMAP.', + 'index_html' => 'file index per le nuove cartelle create dai clienti', + 'SERVERNAME' => 'Sostituito con il nomeserver.', + 'CUSTOMER' => 'Sostituito con il nome utente del cliente.', + 'ADMIN' => 'Sostituito con il nome utente dell\'amministratore.', + 'CUSTOMER_EMAIL' => 'Sostituito con l\'indirizzo e-mail del cliente.', + 'ADMIN_EMAIL' => 'Sostituito con l\'indirizzo e-mail dell\'amministratore.', + 'filetemplates' => 'File Modelli', + 'filecontent' => 'Contenuto File', + 'new_database_by_customer' => 'Notifica al cliente quando un database è stato creato', + 'new_ftpaccount_by_customer' => 'Notifica al cliente quando un utente FTP è stato creato', + 'newdatabase' => 'Mail di notifica per i nuovi database', + 'newftpuser' => 'Mail di notifica per i nuovi utenti ftp', + 'CUST_NAME' => 'Nome del Cliente', + 'DB_NAME' => 'Nome del Database', + 'DB_PASS' => 'Password del Database', + 'DB_DESC' => 'Descrizione del Database', + 'DB_SRV' => 'Server del Database', + 'PMA_URI' => 'URL a phpMyAdmin (se presente)', + 'USR_NAME' => 'Nome utente FTP', + 'USR_PASS' => 'Password FTP', + 'USR_PATH' => 'Cartella utente FTP (rispetto alla cartella docroot del cliente)', + 'forgotpwd' => 'Mail di notifica per il reset della password', + 'password_reset' => 'Notifica al cliente per il reset della password', + 'trafficmaxpercent' => 'Mail di notifica per i clienti che hanno raggiunto il limite di traffico', + 'MAX_PERCENT' => 'Sostituito con spazio/limite di traffico per l\'invio dei report in precentuale.', + 'USAGE_PERCENT' => 'Sostituito con l\'utilizzo del disco/limite di traffico, che è stato esaurito da parte del cliente in percentuale.', + 'diskmaxpercent' => 'Mail di notifica per i clienti che hanno raggiunto il limite di spazio su disco', + 'DISKAVAILABLE' => 'Sostituito con il spazio utilizzato in MB, che è stato assegnato al cliente.', + 'DISKUSED' => 'Sostituito con il spazio utilizzato in MB, che è stato esaurito da parte del cliente.', + 'SALUTATION' => 'Sostituito con un saluto corretto (nome o azienda)', + 'COMPANY' => 'Sostituisce con il nome dell \'azienda del cliente', + 'LINK' => 'Sostituito con il link di azzeramento password cliente.', + 'SERVER_HOSTNAME' => 'Sostituisce il nome host del sistema (URL a froxlor)', + 'SERVER_IP' => 'Sostituisce l\'indrizzo IP predefinito del server', + 'SERVER_PORT' => 'Sostituisce la porta predefinita del server', + 'DOMAINNAME' => 'Sostituisce il sottodominio predefinito dei clienti (può essere vuoto se non viene generato)', + ], + 'webserver' => 'Webserver', + 'ipsandports' => [ + 'ipsandports' => 'IP e Porte', + 'add' => 'Aggiungi IP/Porta', + 'edit' => 'Modifica IP/Porta', + 'ipandport' => 'IP/Porta', + 'ip' => 'IP', + 'port' => 'Porta', + 'create_listen_statement' => 'Crea la direttiva Listen', + 'create_namevirtualhost_statement' => 'Crea la direttiva NameVirtualHost', + 'create_vhostcontainer' => 'Crea vHost-Container', + 'create_vhostcontainer_servername_statement' => 'Crea la direttiva ServerName in vHost-Container', + 'enable_ssl' => 'Questa è una porta SSL?', + 'ssl_cert_file' => 'Percorso del certificato SSL (SSL certificate)', + 'webserverdefaultconfig' => 'Configurazione predefinita Webserver', + 'webserverdomainconfig' => 'Configurazione Dominio Webserver', + 'webserverssldomainconfig' => 'COnfigura SSL Webserver', + 'ssl_key_file' => 'Percorso al Keyfile SSL', + 'ssl_ca_file' => 'Percorso al CA certificate SSL', + 'default_vhostconf_domain' => 'Impostazioni predefinite vhost per ogni contenitore di dominio', + 'docroot' => [ + 'title' => 'Imposta Cartella principale (vuoto = va in Froxlor)', + 'description' => 'Qui puoi definire una tua cartella principale (la destinazione di una richiesta) per questa combinazione IP/Porta.
ATTENZIONE: Fai molta attenzione a quello che scrivi qui!', + ], + 'ssl_cert_chainfile' => [ + 'title' => 'Percorso al file catena dei certificati SSL', + 'description' => 'Principalmente Bundle CA, o similare, presubilmente vuoi impostare questo se hai acquistato un certificato SSL.', + ], + 'ssl_paste_description' => 'Incolla il contenuto completo del tuo certificato nella casella di testo', + 'ssl_cert_file_content' => 'Contenuto del certificato ssl', + 'ssl_key_file_content' => 'Contenuto del file di chiave (privata) ssl', + 'ssl_ca_file_content' => 'Contenuto del file ssl CA di autorità di certificazione (opzionale)', + 'ssl_ca_file_content_desc' => '

Autenticazione client, imposta questo settaggio soltanto se sai di cosa si tratta.', + 'ssl_cert_chainfile_content' => 'Contenuto del file di catena di certificato (opzionale)', + 'ssl_cert_chainfile_content_desc' => '

Abitualmente Bundle CA o similare, probabilmente vuoi impostare questo settaggio se hai acquistato un certificato SSL.', + ], + 'memorylimitdisabled' => 'Disabilitato', + 'valuemandatory' => 'Questo valore è obbligatorio', + 'valuemandatorycompany' => 'O i campi "nome" e "cognome" O il capo "compagnia" devono essere riempiti', + 'phpversion' => 'Versione PHP', + 'mysqlserverversion' => 'Versione MySQL Server', + 'webserverinterface' => 'Interfaccia Webserver', + 'accountsettings' => 'Impostazioni Account', + 'panelsettings' => 'Impostazioni Pannello', + 'systemsettings' => 'Impostazioni di Sistema', + 'webserversettings' => 'Impostazioni Server Web', + 'mailserversettings' => 'Impostazioni Server di Posta', + 'nameserversettings' => 'Impostazioni Nameserver', + 'updatecounters' => 'Ricalcolo risorse', + 'subcanemaildomain' => [ + 'never' => 'Mai', + 'choosableno' => 'Selezionabile, predefinito no', + 'choosableyes' => 'Selezionabile, predefinito si', + 'always' => 'Sempre', + ], + 'webalizersettings' => 'Impostazioni Webalizer', + 'webalizer' => [ + 'normal' => 'Normale', + 'quiet' => 'Modesto', + 'veryquiet' => 'Niente', + ], + 'domain_nocustomeraddingavailable' => 'Adesso non è possibile aggiungere un dominio. Prima è necessario aggiungere almeno un cliente.', + 'loggersettings' => 'Impostazioni Log', + 'logger' => [ + 'normal' => 'normale', + 'paranoid' => 'paranoico', + ], + 'loggersystem' => 'Log di Sistema', + 'emaildomain' => 'Email dominio', + 'email_only' => 'Solo email?', + 'wwwserveralias' => 'Aggiungi a "www." ServerAlias', + 'subject' => 'Oggetto', + 'recipient' => 'Destinatario', + 'message' => 'Scrivi un messaggio', + 'text' => 'Messaggio', + 'sslsettings' => 'Impostazioni SSL', + 'dkimsettings' => 'Impostazioni DomainKey', + 'caneditphpsettings' => 'È possibile modificare le impostazioni di dominio relative a php?', + 'allips' => 'Tutti gli IP', + 'awstatssettings' => 'Impostazioni Awstats', + 'domain_dns_settings' => 'Impostazioni dominio dns', + 'activated' => 'Attivato', + 'statisticsettings' => 'Impostazioni Statistiche', + 'or' => 'o', + 'sysload' => 'Carico del sistema', + 'noloadavailable' => 'non disponibile', + 'nouptimeavailable' => 'non disponibile', + 'nosubject' => '(Nessun Oggetto)', + 'security_settings' => 'Opzioni di Sicurezza', + 'know_what_youre_doing' => 'Modifica solo, se sai quello che stai facendo!', + 'show_version_login' => [ + 'title' => 'Mostra la versione di Froxlor quando si effettua l\'accesso', + 'description' => 'Mostra la versione di Froxlor in fondo-pagina di accesso', + ], + 'show_version_footer' => [ + 'title' => 'Mostra la versione di Froxlor in fondo-pagina', + 'description' => 'Mostra la versione di Froxlor in fondo ad ogni pagina', + ], + 'froxlor_graphic' => [ + 'title' => 'Intestazione grafica per Froxlor', + 'description' => 'Quale grafica vuoi mostrare nell\'intestazione?', + ], + 'phpsettings' => [ + 'title' => 'Configurazione PHP', + 'description' => 'Descrizione breve', + 'actions' => 'Azioni', + 'activedomains' => 'In uso per dominio/i', + 'notused' => 'Configurazione non utilizzata', + 'editsettings' => 'Modific impostazioni PHP', + 'addsettings' => 'Crea una nuova impostazione PHP', + 'viewsettings' => 'Mostra impostazioni PHP', + 'phpinisettings' => 'Impostazioni php.ini', + 'addnew' => 'Crea nuove impostazioni', + 'binary' => 'PHP Binary', + 'file_extensions' => 'Estensioni File', + 'file_extensions_note' => '(senza punto, separate da spazi)', + 'enable_slowlog' => 'Abilita slowlog (per dominio)', + 'request_terminate_timeout' => 'Richiedi terminate-timeout', + 'request_slowlog_timeout' => 'Richiedi slowlog-timeout', + ], + 'misc' => 'Varie', + 'phpconfig' => [ + 'template_replace_vars' => 'Variabili che saranno sostituite nei file di configurazione', + 'pear_dir' => 'Verrà sostituito con le impostazioni globali per la cartella pear.', + 'open_basedir_c' => 'Inserirà un ; (punto e virgola) per commentare/disabilitare open_basedir se impostato', + 'open_basedir' => 'Verrà sostituito con l\'impostazione open_basedir del dominio.', + 'tmp_dir' => 'Verrà sostituito con la cartella temporanea del dominio.', + 'open_basedir_global' => 'Verrà sostituito con il valore globale del percorso che sarà allegato al open_basedir', + 'customer_email' => 'Verrà sostituito con l\'indirizzo email del cliente che possiede questo dominio.', + 'admin_email' => 'Verrà sostituito con l\'indirizzo email dell\'amministratore di questo dominio.', + 'domain' => 'Verrà sostituito con il dominio.', + 'customer' => 'Verrà sostituito con il nome utente del cliente che possiede questo dominio.', + 'admin' => 'Verrà sostituito con il nome utente dell\'amministratore che possiede questo dominio.', + ], + 'expert_settings' => 'Impostazioni Avanzate!', + 'mod_fcgid_starter' => [ + 'title' => 'Processi PHP per questo dominio (vuoto per lasciare il valore predefinito)', + ], + 'phpserversettings' => 'Impostazioni PHP', + 'mod_fcgid_maxrequests' => [ + 'title' => 'Richieste PHP massime per questo dominio (vuoto per lasciare il valore predefinito)', + ], + 'spfsettings' => 'Impostazioni Dominio SPF', + 'specialsettingsforsubdomains' => 'Applica le impostazioni speciali a tutti i sottodomini (*.esempio.com)', + 'accountdata' => 'Dati conto', + 'contactdata' => 'Dati contatto', + 'servicedata' => 'Dati di servizio', + 'newerversionavailable' => 'È disponibile una nuova versione di Floxlor', + 'cron' => [ + 'cronsettings' => 'Impostazioni Cronjob', + 'add' => 'Aggiungi cronjob', + ], + 'cronjob_edit' => 'Modifica cronjob', + 'warning' => 'ATTENZIONE - Leggi attentamente!', + 'lastlogin_succ' => 'Ultimo accesso', + 'ftpserver' => 'Server FTP', + 'ftpserversettings' => 'Impostazioni del Server FTP', + 'webserver_user' => 'Utente Webserver', + 'webserver_group' => 'Gruppo Webserver', + 'perlenabled' => 'Perl abilitato', + 'fcgid_settings' => 'FCGID', + 'mod_fcgid_user' => 'Utente locale per FCGID (Froxlor vhost)', + 'mod_fcgid_group' => 'Gruppo locale per FCGID (Froxlor vhost)', + 'perl_settings' => 'Perl/CGI', + 'notgiven' => '[se presente]', + 'phpfpm_settings' => 'PHP-FPM', + 'traffic' => 'Traffico', + 'domaintraffic' => 'Domimi', + 'customertraffic' => 'Clienti', + 'serversoftware' => 'Software per Server', + 'store_defaultindex' => 'Archivio del file indice predefinito al percorso radice clienti', + 'assignedmax' => 'Assegnato / Max', + 'usedmax' => 'Usato / Max', + 'used' => 'Usato', + 'speciallogwarning' => '
AVVISO: Cambiando questa impostazione perderai tutte le vecchie statistiche per questo dominio.
', + 'speciallogfile' => [ + 'title' => 'File file log seperato', + 'description' => 'Spunta qui per un log di accesso separato per questo dominio', + ], + 'domain_editable' => [ + 'title' => 'Permetti la modifica del dominio', + 'desc' => 'Se settato a si, il cliente è abilitato a modificare varie impostazioni del dominio.
Se settato su no, il cliente non può modificare nulla.', + ], + 'phpfpm.ininote' => 'Non tutti i valori che potresti volere settare possono essere usati nella configurazione del pool php-fpm.', + 'phpinfo' => 'PHPinfo()', + 'selectserveralias' => 'valore ServerAlias per il dominio', + 'selectserveralias_desc' => 'Scegli se froxlor deve creare un settaggio wildcard (*.dominio.tld), o un alias WWW (www.dominio.tld) o nessun alias', + 'show_news_feed' => 'Mostra il feed notizie sul cruscotto dell \'amministratore', + 'cronsettings' => 'Impostazioni Cronjob', + 'integritycheck' => 'Validazione Database', + 'integrityid' => '#', + 'integrityname' => 'Nome', + 'integrityresult' => 'Risultato', + 'integrityfix' => 'Risolvi problemi automaticamente', + 'customer_show_news_feed' => 'Mostra feed di notizie personalizzati sul cruscotto dei clienti', + 'customer_news_feed_url' => 'Feed RSS- per il feed di notizie personalizzato', + 'movetoadmin' => 'Trasferisci cliente', + 'movecustomertoadmin' => 'Trasferisci cliente all\'amministratore/rivenditore selezionato
Lascia questo vuoto per nessuna modifica.
Se l\'amministratore desiderato non appare nella lista, il suo massimale di clienti e stato ragggiunto.', + 'note' => 'Nota', + ], + 'changepassword' => [ + 'old_password' => 'Vecchia password', + 'new_password' => 'Nuova password', + 'new_password_confirm' => 'Nuova password (verifica)', + 'new_password_ifnotempty' => 'Nuova password (vuota = non cambia)', + 'also_change_ftp' => ' cambia la password dell\'account FTP principale?', + 'also_change_stats' => ' modificare anche la password di statistic', + ], + 'country' => [ + 'AF' => 'Afganistan', + 'AX' => 'Isole Aland', + 'AL' => 'Albania', + 'DZ' => 'Algeria', + 'AS' => 'American Samoa', + 'AD' => 'Andorra', + 'AO' => 'Angola', + 'AI' => 'Anguilla', + 'AQ' => 'Antarctica', + 'AG' => 'Antigua and Barbuda', + 'AR' => 'Argentina', + 'AM' => 'Armenia', + 'AW' => 'Aruba', + 'AU' => 'Australia', + 'AT' => 'Austria', + 'AZ' => 'Azerbaijan', + 'BS' => 'Bahamas', + 'BH' => 'Bahrain', + 'BD' => 'Bangladesh', + 'BB' => 'Barbados', + 'BY' => 'Belarus', + 'BE' => 'Belgium', + 'BZ' => 'Belize', + 'BJ' => 'Benin', + 'BM' => 'Bermuda', + 'BT' => 'Bhutan', + 'BO' => 'Bolivia, Stato Plurinazionale della', + 'BQ' => 'Bonaire, Saint Eustatius e Saba', + 'BA' => 'Bosnia e Herzegovina', + 'BW' => 'Botswana', + 'BV' => 'Bouvet Island', + 'BR' => 'Brasile', + 'IO' => 'Territorio Britannico del oceano indiano', + 'BN' => 'Brunei Darussalam', + 'BG' => 'Bulgaria', + 'BF' => 'Burkina Faso', + 'BI' => 'Burundi', + 'KH' => 'Cambogia', + 'CM' => 'Camerun', + 'CA' => 'Canada', + 'CV' => 'Capo Verde', + 'KY' => 'Isole Cayman', + 'CF' => 'Repubblica dell\'Africa Centrale', + 'TD' => 'Chad', + 'CL' => 'Chile', + 'CN' => 'Cina', + 'CX' => 'Isola di Natale', + 'CC' => 'Isole Cocos (Keeling)', + 'CO' => 'Colombia', + 'KM' => 'Comoros', + 'CG' => 'Congo', + 'CD' => 'Congo, Repubblica democratica del', + 'CK' => 'Isole Cook', + 'CR' => 'Costa Rica', + 'CI' => 'Costa D\'avorio', + 'HR' => 'Croazia', + 'CU' => 'Cuba', + 'CW' => 'Curacao', + 'CY' => 'Cipro', + 'CZ' => 'Repubblica Ceca', + 'DK' => 'Danimarca', + 'DJ' => 'Djibouti', + 'DM' => 'Dominica', + 'DO' => 'Repubblica Dominicana', + 'EC' => 'Ecuador', + 'EG' => 'Egitto', + 'SV' => 'El Salvador', + 'GQ' => 'Guinea Equatoriale', + 'ER' => 'Eritrea', + 'EE' => 'Estonia', + 'ET' => 'Etiopia', + 'FK' => 'Isole Falkland (Malvinas)', + 'FO' => 'Isole Faroe', + 'FJ' => 'Fiji', + 'FI' => 'Finlandia', + 'FR' => 'Francia', + 'GF' => 'Guiana Francese', + 'PF' => 'Polinesia Francese', + 'TF' => 'Territori Francesi del Sud', + 'GA' => 'Gabon', + 'GM' => 'Gambia', + 'GE' => 'Georgia', + 'DE' => 'Germania', + 'GH' => 'Ghana', + 'GI' => 'Gibilterra', + 'GR' => 'Grecia', + 'GL' => 'Groenlandia', + 'GD' => 'Grenada', + 'GP' => 'Guadeloupe', + 'GU' => 'Guam', + 'GT' => 'Guatemala', + 'GG' => 'Guernsey', + 'GN' => 'Guinea', + 'GW' => 'Guinea-Bissau', + 'GY' => 'Guyana', + 'HT' => 'Haiti', + 'HM' => 'Isola Heard e Isola McDonald', + 'VA' => 'Stato del Vaticano', + 'HN' => 'Honduras', + 'HK' => 'Hong Kong', + 'HU' => 'Ungheria', + 'IS' => 'Islanda', + 'IN' => 'India', + 'ID' => 'Indonesia', + 'IR' => 'Iran, Repubblica Islamica del', + 'IQ' => 'Iraq', + 'IE' => 'Irlanda', + 'IM' => 'Isola Man', + 'IL' => 'Israele', + 'IT' => 'ITALIA', + 'JM' => 'Giamaica', + 'JP' => 'Giappone', + 'JE' => 'Jersey', + 'JO' => 'Giordania', + 'KZ' => 'Kazakistan', + 'KE' => 'Kenya', + 'KI' => 'Kiribati', + 'KP' => 'Corea, Repubblica popolare della', + 'KR' => 'Corea, Repubblica della', + 'KW' => 'Kuwait', + 'KG' => 'Kyrgyzstan', + 'LA' => 'Lao, Repubblica popolare del', + 'LV' => 'Lettonia', + 'LB' => 'Libano', + 'LS' => 'Lesotho', + 'LR' => 'Liberia', + 'LY' => 'Libia', + 'LI' => 'Liechtenstein', + 'LT' => 'Lituania', + 'LU' => 'Lussemburgo', + 'MO' => 'Macao', + 'MK' => 'Macedonia', + 'MG' => 'Madagascar', + 'MW' => 'Malawi', + 'MY' => 'Malesia', + 'MV' => 'Maldive', + 'ML' => 'Mali', + 'MT' => 'Malta', + 'MH' => 'Isole Marshall', + 'MQ' => 'Martinique', + 'MR' => 'Mauritania', + 'MU' => 'Mauritius', + 'YT' => 'Mayotte', + 'MX' => 'Messico', + 'FM' => 'Micronesia, Stati Federali del', + 'MD' => 'Moldavia', + 'MC' => 'Monaco', + 'MN' => 'Mongolia', + 'ME' => 'Montenegro', + 'MS' => 'Montserrat', + 'MA' => 'Marocco', + 'MZ' => 'Mozambico', + 'MM' => 'Myanmar', + 'NA' => 'Namibia', + 'NR' => 'Nauru', + 'NP' => 'Nepal', + 'NL' => 'Olanda', + 'NC' => 'Nuova Caledonia', + 'NZ' => 'Nuova Zelanda', + 'NI' => 'Nicaragua', + 'NE' => 'Niger', + 'NG' => 'Nigeria', + 'NU' => 'Niue', + 'NF' => 'Isole Norfolk', + 'MP' => 'Isole Mariana Settentrionali', + 'NO' => 'Norvegia', + 'OM' => 'Oman', + 'PK' => 'Pakistan', + 'PW' => 'Palau', + 'PS' => 'Territorio Occupato della Palestina', + 'PA' => 'Panama', + 'PG' => 'Papua Nuova Guinea', + 'PY' => 'Paraguay', + 'PE' => 'Peru', + 'PH' => 'Filippine', + 'PN' => 'Pitcairn', + 'PL' => 'Polonia', + 'PT' => 'Portogallo', + 'PR' => 'Porto Rico', + 'QA' => 'Qatar', + 'RE' => 'Reunion', + 'RO' => 'Romania', + 'RU' => 'Russia', + 'RW' => 'Ruanda', + 'BL' => 'Saint Barthelemy', + 'SH' => 'Saint Helena, Ascension and Tristan Da Cunha', + 'KN' => 'Saint Kitts and Nevis', + 'LC' => 'Saint Lucia', + 'MF' => 'Saint Martin (French Part)', + 'PM' => 'Saint Pierre and Miquelon', + 'VC' => 'Saint Vincent and the Grenadines', + 'WS' => 'Samoa', + 'SM' => 'San Marino', + 'ST' => 'Sao Tome and Principe', + 'SA' => 'Arabia Saudita', + 'SN' => 'Senegal', + 'RS' => 'Serbia', + 'SC' => 'Seychelles', + 'SL' => 'Sierra Leone', + 'SG' => 'Singapore', + 'SX' => 'Sint Maarten (Dutch Part)', + 'SK' => 'Slovacchia', + 'SI' => 'Slovenia', + 'SB' => 'Isole Solomon', + 'SO' => 'Somalia', + 'ZA' => 'Africa del Sud', + 'GS' => 'South Georgia and the South Sandwich Islands', + 'ES' => 'Spagna', + 'LK' => 'Sri Lanka', + 'SD' => 'Sudan', + 'SR' => 'Suriname', + 'SJ' => 'Svalbard and Jan Mayen', + 'SZ' => 'Swaziland', + 'SE' => 'Svezia', + 'CH' => 'Svizzera', + 'SY' => 'Siria', + 'TW' => 'Taiwan, Provincia della Cina', + 'TJ' => 'Tajikistan', + 'TZ' => 'Tanzania', + 'TH' => 'Tailandia', + 'TL' => 'Timor-Leste', + 'TG' => 'Togo', + 'TK' => 'Tokelau', + 'TO' => 'Tonga', + 'TT' => 'Trinidad and Tobago', + 'TN' => 'Tunisia', + 'TR' => 'Turchia', + 'TM' => 'Turkmenistan', + 'TC' => 'Turks and Caicos Islands', + 'TV' => 'Tuvalu', + 'UG' => 'Uganda', + 'UA' => 'Ucraina', + 'AE' => 'Emirati Arabi Uniti', + 'GB' => 'Gran Bretagna', + 'US' => 'Stati Uniti d\'America', + 'UM' => 'Stati Uniti, Isole Minori', + 'UY' => 'Uruguay', + 'UZ' => 'Uzbekistan', + 'VU' => 'Vanuatu', + 'VE' => 'Venezuela', + 'VN' => 'Vietnam', + 'VG' => 'Isole Vergini Brittaniche', + 'VI' => 'Isole Vergini, U.S.', + 'WF' => 'Wallis and Futuna', + 'EH' => 'Sahara Occidentale', + 'YE' => 'Yemen', + 'ZM' => 'Zambia', + 'ZW' => 'Zimbabue', + ], + 'cron' => [ + 'cronname' => 'Nome cronjob', + 'lastrun' => 'ultima esecuzione', + 'interval' => 'intervallo', + 'isactive' => 'abilitato', + 'description' => 'descrizione', + 'changewarning' => 'La modifica di questi valori può avere conseguenze negative nel comportamento di Froxlor e dei suoi processi automatizzati
Per favore modifica questi valori solo se sei sicuro di quello che stai facendo!', + ], + 'crondesc' => [ + 'cron_unknown_desc' => 'nessuna descrizione fornita', + 'cron_tasks' => 'generazione del file di configurazione', + 'cron_legacy' => 'legacy (vecchi) cronjob', + 'cron_traffic' => 'calcolo del traffico', + 'cron_usage_report' => 'Invia i report di utilizzo web e del traffico', + 'cron_mailboxsize' => 'Calcolo dimensioni caselle di posta', + ], + 'cronjob' => [ + 'cronjobsettings' => 'impostazioni Cronjob', + 'cronjobinterval' => 'Durata intervallo', + 'cronjobintervalv' => 'valore di intervallo Runtime', + ], + 'cronjobs' => [ + 'notyetrun' => 'Non ancora avviato', + ], + 'cronmgmt' => [ + 'minutes' => 'minuti', + 'hours' => 'ore', + 'days' => 'giorni', + 'weeks' => 'settimane', + 'months' => 'mesi', + ], + 'customer' => [ + 'documentroot' => 'Cartella Principale', + 'name' => 'Cognome', + 'firstname' => 'Nome', + 'company' => 'Ditta', + 'street' => 'Via', + 'zipcode' => 'CAP', + 'city' => 'Città', + 'phone' => 'Telefono', + 'fax' => 'Fax', + 'email' => 'Email', + 'customernumber' => 'ID Cliente', + 'diskspace' => 'Spazio Web (MB)', + 'traffic' => 'Traffico (GB)', + 'mysqls' => 'Database MySQL', + 'emails' => 'Indirizzi Email', + 'accounts' => 'Account Email', + 'forwarders' => 'Reindirizzamenti Email', + 'ftps' => 'Account FTP', + 'subdomains' => 'Sottodomini', + 'domains' => 'Domini', + 'title' => 'Titolo', + 'country' => 'Paese', + 'email_quota' => 'Limite E-mail', + 'email_imap' => 'E-mail IMAP', + 'email_pop3' => 'E-mail POP3', + 'mail_quota' => 'Limite Mail', + 'sendinfomail' => 'Inviami i dati via email', + 'generated_pwd' => 'Password suggerita', + 'usedmax' => 'Usato / Massimo', + 'services' => 'Servizi', + ], + 'diskquota' => 'Quota', + 'dkim' => [ + 'dkim_prefix' => [ + 'title' => 'Prefisso', + 'description' => 'Si prega di specificare il percorso della DKIM RSA-files, nonch¸ i file di configurazione per il plugin Milter', + ], + 'dkim_domains' => [ + 'title' => 'Domini nomefile', + 'description' => 'Nome file del parametro DKIM Domains specificata nella configurazione dkim-milter', + ], + 'dkim_dkimkeys' => [ + 'title' => 'Nome file del KeyList', + 'description' => 'Nome file del parametro DKIM KeyList specificata nella configurazione dkim-milter', + ], + 'dkimrestart_command' => [ + 'title' => 'Milter commando riavvio', + 'description' => 'Si prega di specificare il comando per riavviare il servizio DKIM milter', + ], + 'use_dkim' => [ + 'title' => 'Attivare il supporto DKIM?', + 'description' => 'Vuoi utilizzare il sistema Domain Keys (DKIM)?', + ], + 'dkim_algorithm' => [ + 'title' => 'Ammessi Algoritmi Hash', + 'description' => 'Definire gli algoritmi di hash permessi, scegliere "Tutti" per permettere tutti gli algoritmi oppure uno o più tra gli altri algoritmi disponibili', + ], + 'dkim_servicetype' => 'Tipi di Servizio', + 'dkim_keylength' => [ + 'title' => 'Lunghezza Chiave', + 'description' => 'Attenzione: Se si modifica questo valore è necessario eliminare tutte le chiavi private/pubbliche in "%s"', + ], + 'dkim_notes' => [ + 'title' => 'Note DKIM', + 'description' => 'Nota potrebbe essere di interesse, es. un URL come http://www.dnswatch.info. Nessuna interpretazione è fatta da nessun programma. Questo tag deve essere usato con parsimonia per ragioni di spazio nel DNS. Questo è destinato ad essere utilizzato dagli amministratori e non dagli utenti finali.', + ], + ], + 'dns' => [ + 'destinationip' => 'Dominio IP', + 'a_record' => 'A-Record (IPv6 optionale)', + 'mxrecords' => 'Definisci MX records', + 'txtrecords' => 'Definisci TXT records', + 'txtexample' => 'Esempio (SPF-entry):
v=spf1 ip4:xxx.xxx.xx.0/23 -all', + 'standardip' => 'IP predefinito del server', + 'cname_record' => 'Record CNAME', + 'standardmx' => 'Record MX predefinito del server', + 'mxconfig' => 'Record MX personalizzati', + 'priority10' => 'Priorità 10', + 'priority20' => 'Priorità 20', + ], + 'domain' => [ + 'openbasedirpath' => 'Percorso OpenBasedir', + 'docroot' => 'Percorso del campo sopra', + 'homedir' => 'Cartella Home', + ], + 'domains' => [ + 'description' => 'Qui puoi creare (sotto)domini e cambiare il loro percorso.
Il sistema, dopo ogni cambiamento, necessita di un po\' di tempo per applicare le nuove impostazioni.', + 'domainsettings' => 'Opzioni del dominio', + 'domainname' => 'Nome del dominio', + 'subdomain_add' => 'Crea sottodominio', + 'subdomain_edit' => 'Modifica il (sotto)dominio', + 'wildcarddomain' => 'Crea una wildcarddomain?', + 'aliasdomain' => 'Alias per questo dominio', + 'noaliasdomain' => 'Nessun alias per il dominio', + 'hasaliasdomains' => 'Ha domini alias', + 'statstics' => 'Statistiche d\'utilizzo', + 'isassigneddomain' => 'È dominio assegnato', + 'add_date' => 'Aggiunto a Froxlor', + 'registration_date' => 'Aggiunto al registro', + 'topleveldomain' => 'Dominio di primo livello (TLD)', + 'associated_with_domain' => 'Associato', + 'aliasdomains' => 'Alias domini', + 'redirectifpathisurl' => 'Codice di redirezione (Predefinito: vuoto)', + 'redirectifpathisurlinfo' => 'È necessario selezionare uno di questi se hai inserito un URL come percorso', + 'issubof' => 'Questo dominio è un sottodominio di un altro dominio', + 'issubofinfo' => 'Devi impostare correttamente questo dominio se si desidera aggiungere un sottodominio come dominio completo (es. si vuole aggiungere "www.domain.tld", devi selezionare qui "domain.tld")', + 'nosubtomaindomain' => 'No sottodominio di un dominio completo', + 'ipandport_multi' => [ + 'title' => 'Indirizzi IP', + 'description' => 'Specifica uno o più indirizzi IP per il dominio.

NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come alias-domain di un altro dominio.
', + ], + 'ipandport_ssl_multi' => [ + 'title' => 'Indirizzi IP SSL', + ], + 'ssl_redirect' => [ + 'title' => 'Reindirizzamento SSL', + 'description' => 'Questa opzione crea un reindirizzamento per vhosts non-sll in modo che tutte le richieste vengono reindirizzate ai SSL-vhost.

praticamente una richiesta a http://dominio.tld/ ti reindirizzera a https://dominio.tld/', + ], + 'serveraliasoption_wildcard' => 'Wildcard (*.dominio.tld)', + 'serveraliasoption_www' => 'WWW (www.dominio.tld)', + 'serveraliasoption_none' => 'Nessun alias', + 'domain_import' => 'Importa Dominii', + 'import_separator' => 'Separatore', + 'import_offset' => 'Offset', + 'import_file' => 'File CSV', + 'import_description' => 'Per ottenere informazioni dettagliate sulla struttura del file di importazione e su come importare con successo, visita https://docs.froxlor.org/adminguide/domainimport.html', + ], + 'emails' => [ + 'description' => 'Qui puoi creare e cambiare i tuoi indirizzi Email.
Un account è come la bucalettere davanti a casa tua. Se qualcuno ti manda un\'Email, essa sarà recapitata all\'interno del tuo account.

Per scaricare le tue Email usa le seguenti impostazioni nel tuo programma di posta elettronica: (I dati scritti in corsivo vanno cambiati con i tuoi!)
Hostname: Nome del dominio
Username: Nome dell\'account / Indirizzo Email
Password: La password scelta', + 'emailaddress' => 'Indirizzo Email', + 'emails_add' => 'Crea indirizzo Email', + 'emails_edit' => 'Modifica indirizzo Email', + 'catchall' => 'Catch-all', + 'iscatchall' => 'Definisci come indirizzo catch-all?', + 'account' => 'Account', + 'account_add' => 'Crea account', + 'account_delete' => 'Cancella account', + 'from' => 'Da', + 'to' => 'Per', + 'forwarders' => 'Reindirizzamenti', + 'forwarder_add' => 'Crea reindirizzamento', + 'alternative_emailaddress' => 'Indirizzo email alternativo', + 'quota' => 'Limite', + 'noquota' => 'Nessun limite', + 'updatequota' => 'Aggiorna Limite', + 'quota_edit' => 'Cambia limite E-Mail', + 'noemaildomainaddedyet' => 'Non hai ancora un (email-)dominio nel tuo account.', + 'back_to_overview' => 'Torna indietro nel riepilogo', + ], + 'error' => [ + 'error' => 'Errore', + 'directorymustexist' => 'La cartella %s deve esistere. Per favore creala tramite il tuo client FTP.', + 'filemustexist' => 'Il file %s deve esistere.', + 'allresourcesused' => 'Hai già usato tutte le tue risorse.', + 'domains_cantdeletemaindomain' => 'Non puoi cancellare un dominio usato come dominio Email.', + 'domains_canteditdomain' => 'Non puoi modificare questo dominio. La funzione è stata disabilitata dall\'admin.', + 'domains_cantdeletedomainwithemail' => 'Non puoi cancellare un dominio usato come dominio Email. Cancella prima tutti gli indirizzi Email che lo utilizzano.', + 'firstdeleteallsubdomains' => 'Prima di creare un dominio wildcard, cancella tutti i sottodomini presenti per quel dominio.', + 'youhavealreadyacatchallforthisdomain' => 'Hai già definito un catchall per questo dominio.', + 'ftp_cantdeletemainaccount' => 'Non puoi cancellare il tuo account FTP principale.', + 'login' => 'Il nome utente o la password da te immessi sono incorretti. Per favore riprova!', + 'login_blocked' => 'Questo account è stato sospeso per i troppi tentativi di login falliti.
Riprovi tra %s secondi.', + 'notallreqfieldsorerrors' => 'Alcuni campi sono stati lasciati vuoti o sono stati riempiti incorrettamente.', + 'oldpasswordnotcorrect' => 'La vecchia password non è corretta.', + 'youcantallocatemorethanyouhave' => 'Non puoi assegnare più risorse di quante ne possieda tu stesso.', + 'mustbeurl' => 'Non hai inserito un\'indirizzo valido o completo (per es. http://qualchedominio.com/errore404.htm).', + 'invalidpath' => 'Non hai scelto un\'indirizzo valido.', + 'stringisempty' => 'Manca il dato nel campo.', + 'stringiswrong' => 'Dato incorretto.', + 'newpasswordconfirmerror' => 'La nuova password non corrisponde a quella vecchia.', + 'mydomain' => '\'Dominio\'', + 'mydocumentroot' => '\'Documentroot\'', + 'loginnameexists' => 'Il login %s esiste già.', + 'emailiswrong' => 'L\'indirizzo Email %s contiene caratteri invalidi o è incompleto.', + 'loginnameiswrong' => 'Il login %s contiene caratteri invalidi.', + 'userpathcombinationdupe' => 'La combinazione tra nome utente e percorso esiste già.', + 'patherror' => 'Errore! Il percorso non può essere vuoto.', + 'errordocpathdupe' => 'Le opzioni per la cartella %s esistono già.', + 'adduserfirst' => 'Per favore crea prima un utente ...', + 'domainalreadyexists' => 'Il dominio %s è già assegnato ad un cliente.', + 'nolanguageselect' => 'Nessuna lingua selezionata.', + 'nosubjectcreate' => 'Devi definire un titolo per questo template Email.', + 'nomailbodycreate' => 'Devi definiro un testo per questo template Email.', + 'templatenotfound' => 'Il template non è stato trovato.', + 'alltemplatesdefined' => 'Non puoi definire altri template, tutte le lingue sono già definite.', + 'wwwnotallowed' => 'www non è ammesso come sottodominio.', + 'subdomainiswrong' => 'Il sottodominio %s contiene caratteri invalidi.', + 'domaincantbeempty' => 'Il nome dominio non può essere vuoto.', + 'domainexistalready' => 'Il dominio %s esiste già.', + 'domainisaliasorothercustomer' => 'Il dominio alias selezionato è a sua volta un dominio alias o appartiene ad un altro cliente.', + 'emailexistalready' => 'L\'indirizzo Email %s esiste già.', + 'maindomainnonexist' => 'Il dominio principale %s non esiste.', + 'destinationnonexist' => 'Per favore crea il tuo reindirizzamento nel campo \'Destinazione\'.', + 'destinationalreadyexistasmail' => 'Il reindirizzamento a %s esiste già come indirizzo Email attivo.', + 'destinationalreadyexist' => 'Hai già definito un reindirizzamento per %s .', + 'destinationiswrong' => 'Il reindirizzamento %s contiene caratteri invalidi o è incompleto.', + 'ipstillhasdomains' => 'La combinazione IP/Porta che vuoi eliminare ha ancora dei domini assegnati, per favore riassegna questi domini ad altre combinazioni IP/Porta prima di eliminare questa.', + 'cantdeletedefaultip' => 'Non puoi eliminare la combinazione IP/Porta default dei rivenditori, per favore imposta un\'altra combinazione IP/Porta come default dei rivenditori prima di eliminare questa.', + 'cantdeletesystemip' => 'Non puoi eliminare l\'ultima IP di sistema, crea un\'altra combinazione IP/Porta per l\'IP di sistema o cambia l\'IP di sistema.', + 'myipaddress' => '\'IP\'', + 'myport' => '\'Porta\'', + 'myipdefault' => 'Devi selezionare una combinazione IP/Porta che diventerà default.', + 'myipnotdouble' => 'Questa combinazione IP/Porta esiste già.', + 'admin_domain_emailsystemhostname' => 'Spiacente, l\'hostname di sistema non può essere usato come dominio di un cliente', + 'cantchangesystemip' => 'Non puoi cambiare l\'ultima IP di sistema, crea un\'altra combinazione IP/Porta per l\'IP di sistema o cambia l\'IP di sistema.', + 'loginnameissystemaccount' => 'Non puoi creare account che siano analoghi a quelli di sistema (per esempio quelli che iniziano con "%s"). Digita un\'altro nome account.', + 'sessiontimeoutiswrong' => '"Timeout Sessione" deve essere un numero.', + 'maxloginattemptsiswrong' => '"Numero Massimo Tentativi Login" deve essere un numero.', + 'deactivatetimiswrong' => '"Durata Disattivamento" deve essere un numero.', + 'accountprefixiswrong' => '&quopt;Prefisso Utente" incorretto.', + 'mysqlprefixiswrong' => '&quopt;Prefisso SQL" incorretto.', + 'ftpprefixiswrong' => '&quopt;Prefisso FTP" incorretto.', + 'ipiswrong' => '"Indirizzo IP" incorretto. È permesso solo un indirizzo IP valido.', + 'vmailuidiswrong' => '"UID Email" incorretto. È permessa solo una UID numerica.', + 'vmailgidiswrong' => '"GID Email" incorretto. È permessa solo una GID numerica.', + 'adminmailiswrong' => '"Mittente" incorretto. È permesso solo un indirizzo Email valido.', + 'pagingiswrong' => 'Valore degli "Elementi da visualizzare per pagina" incorretto. Sono permessi solo numeri.', + 'phpmyadminiswrong' => 'Il link a phpMyAdmin è invalido.', + 'webmailiswrong' => 'Il link alla WebMail è invalido.', + 'webftpiswrong' => 'Il link al WebFTP è invalido.', + 'stringformaterror' => 'Il valore per il campo "%s" non è nel formato atteso.', + 'youcantdeleteyourself' => 'Non puoi cancellare te stesso per motivi di sicurezza.', + 'youcanteditallfieldsofyourself' => 'Nota: non puoi modificare tutti i campi del tuo account per motivi di sicurezza.', + 'documentrootexists' => 'La cartella "%s" è già presente per questo cliente. Cancella la cartella prima di aggiungere nuovamente il cliente.', + 'formtokencompromised' => 'La richiesta sembra essere compromessa. Per motivi di sicurezza sei stato disconnesso.', + 'logerror' => 'Errore Log: %s', + 'nomessagetosend' => 'Non hai inserito un messaggio.', + 'norecipientsgiven' => 'Non hai specificato alcun destinatario', + 'errorsendingmail' => 'Il messaggio a "%s" fallito', + 'cannotreaddir' => 'Impossibile leggere la cartella "%s"', + 'invalidip' => 'Indirizzo IP non valido: %s', + 'invalidmysqlhost' => 'Indirizzo MySQL non valido: %s', + 'cannotuseawstatsandwebalizeratonetime' => 'Non è possibile abilitare Webalizer e Awstats allo stesso tempo, si prega di sceglierne uno solo', + 'cannotwritetologfile' => 'Impossibile aprire il file di log %s in scrittura', + 'vmailquotawrong' => 'Il limite deve essere un numero positivo.', + 'allocatetoomuchquota' => 'Si è tentato di allocare %s MB Limite, ma non c\'è abbastanza spazio disponibile.', + 'missingfields' => 'Non tutti i campi obbligatori sono stati compilati.', + 'accountnotexisting' => 'L\'account di posta elettronica dato non esiste.', + 'nopermissionsorinvalidid' => 'Non hai i permessi necessari per modificare le impostazioni o è stato fornito un ID non valido.', + 'phpsettingidwrong' => 'Una configurazione PHP con questo ID non esiste', + 'descriptioninvalid' => 'La descrizione è troppo corta, La descrizione è troppo corta o troppo lunga o contiene caratteri non validi.', + 'info' => 'Info', + 'filecontentnotset' => 'Il file non può essere vuoto!', + 'index_file_extension' => 'L\'estensione file del file index deve essere compresa tra 1 e 6 caratteri. L\'estensione può contenere solo i caratteri a-z, A-Z and 0-9', + 'customerdoesntexist' => 'Il cliente che si è selezionato non esiste.', + 'admindoesntexist' => 'L\'amministratore che si è selezionato non esiste.', + 'ipportdoesntexist' => 'La combinazione IP/Porta selezionata non esiste.', + 'usernamealreadyexists' => 'Esiste già il nome utente: %s', + 'plausibilitychecknotunderstood' => 'Il controllo non ha capito la risposta di plausibilità', + 'errorwhensaving' => 'Verificato un errore durante il salvataggio del campo %s', + 'hiddenfieldvaluechanged' => 'Il valore per il campo nascosto "%s" è cambiato durante la modifica delle impostazioni.

Questo non è solitamente un grosso problema, ma le impostazioni potrebbe non essere salvate a causa di questo.', + 'notrequiredpasswordlength' => 'La password scritta è troppo corta. Si prega di scrivere una password lunga almeno %s caratteri.', + 'overviewsettingoptionisnotavalidfield' => 'Woops, un campo che dovrebbe essere mostrato come opzione in Impostazioni-Principale non è un tipo esclusivo. Si possono rimproverare gli sviluppatori per questo. Questo non deve accadere!', + 'pathmaynotcontaincolon' => 'Il percorso che hai inserito non dovrebbe contenere i due punti (:). Inserisci un percorso valido.', + 'exception' => '%s', + 'notrequiredpasswordcomplexity' => 'La complessita della password specificata non è soddisfacente.
Si prega di contattare l\'amministratore se avete domande sulla complessità della password', + 'stringerrordocumentnotvalidforlighty' => 'Una stringa come ErrorDocument non funziona in lighttpd, si prega di specificare un percorso di un file', + 'urlerrordocumentnotvalidforlighty' => 'Un URL come ErrorDocument non funziona in lighttpd, si prega di specificare un percorso di un file', + 'intvaluetoolow' => 'Il numero dato è troppo basso (campo %s)', + 'intvaluetoohigh' => 'Il numero dato è troppo alto (campo %s)', + 'phpfpmstillenabled' => 'PHP-FPM è attivo. Si prega di disattivarlo prima di attivare FCGID', + 'fcgidstillenabled' => 'FCGID è attivo. Si prega di disattivarlo prima di attivare PHP-FPM', + 'domains_cantdeletedomainwithaliases' => 'Non è possibile cancellare un dominio che viene utilizzato per alias-domains. È necessario eliminare prima gli alias.', + 'user_banned' => 'Il tuo account è stato bannato. Contatta l\'amministratore per maggiori informazioni.', + 'loginnameiswrong2' => 'Il nome utente contiente troppi caratteri. Sono permessi soltanto %s caratteri.', + 'session_timeout' => 'Valore troppo basso', + 'session_timeout_desc' => 'Non dovresti settare il timeout della sessione ad un valore minore di 1 minuto.', + 'invalidhostname' => 'Il nome del Host non può essere vuoto o contenere spazi', + 'operationnotpermitted' => 'Operazione non permessa!', + 'featureisdisabled' => 'Funzionalità %s è disabilitata. Perfavore contatta il tuo fornitore di servizi.', + 'usercurrentlydeactivated' => 'L\'utente %s è attualmente disabilitato', + 'setlessthanalreadyused' => 'Non puoi impostare dei limiti minori per \'%s\', di quanto questo utente abbia già utilizzato
', + 'stringmustntbeempty' => 'Il valore per il campo %s non può essere vuoto', + 'sslcertificateismissingprivatekey' => 'Devi specificare una chiave privata per il tuo certificato', + 'sslcertificatewrongdomain' => 'Il certificato fornito non appartiene a questo dominio', + 'sslcertificateinvalidcert' => 'Il contenuto del certificato fornito non sembra essere un certificato valido', + 'sslcertificateinvalidcertkeypair' => 'La chiave privata fornita non sembra appartenere al certificato fornito', + 'sslcertificateinvalidca' => 'Il certificato CA fornito non sembra essere un certificato valido', + 'sslcertificateinvalidchain' => 'I dati della catena di certificato non sembrano essere un certificato valido', + 'givendirnotallowed' => 'La cartella fornita nel campo %s non è permessa.', + 'sslredirectonlypossiblewithsslipport' => 'L\'utilizzo del reindirizzamento SSL è possibile soltanto quando il dominio ha almeno una combinazione IP/porta assegnata ed abilitata SSL.', + 'fcgidstillenableddeadlock' => 'FCGID è attualmente attivo.
Perfavore disattivalo prima di cambiare ad un server web diverso da Apache2', + 'send_report_title' => 'Invia rapporto errori', + 'send_report_desc' => 'Grazie per aver communicato questo errore, aiutandoci a migliorare froxlor.
Questa è la mail che verrà inviata agli svillupatori di froxlor:', + 'send_report' => 'Invia rapporto', + 'send_report_error' => 'Errore nell invio del rapporto:
%s', + 'notallowedtouseaccounts' => 'Il tuo account non permette l\'utilizzo di IMAP/POP3. Non puoi aggiungere account di posta elettronica.', + 'cannotdeletehostnamephpconfig' => 'Questa configurazione PHP è utilizzata dal vhost Froxlor e non può essere eliminata.', + 'cannotdeletedefaultphpconfig' => 'Questa configurazione PHP è impostata come predefinita e non può essere eliminata.', + 'passwordshouldnotbeusername' => 'La password deve essere diversa dal nome utente.', + 'no_phpinfo' => 'Ci dispiace, impossibile leggere phpinfo()', + 'moveofcustomerfailed' => 'Trasferimento del cliente all\'amministratore/rivenditore selezionato fallito. Considera che tutte le altre modfiche al cliente sono state applicate con successo a questa fase.

Messaggio d\'errore: %s', + 'domain_import_error' => 'Il seguente errore è occorsonell \'importazione di dominii: %s', + ], + 'extras' => [ + 'description' => 'Qui puoi aggiungere alcune opzioni extra, per esempio impostare delle cartelle protette.
Il sistema, dopo ogni cambiamento, necessita di un po\' di tempo per applicare le nuove impostazioni.', + 'directoryprotection_add' => 'Aggiungi protezione cartella', + 'view_directory' => 'Mostra protezione cartella', + 'pathoptions_add' => 'Aggiungi opzioni cartella', + 'directory_browsing' => 'Visualizza file e cartelle', + 'pathoptions_edit' => 'Modifica opzioni cartella', + 'errordocument404path' => 'URL to ErrorDocument 404', + 'errordocument403path' => 'URL to ErrorDocument 403', + 'errordocument500path' => 'URL to ErrorDocument 500', + 'errordocument401path' => 'URL to ErrorDocument 401', + 'execute_perl' => 'Esegui perl/CGI', + 'htpasswdauthname' => 'Argomento di Autenticazione (AuthName)', + 'directoryprotection_edit' => 'modifica la protezione della directory', + ], + 'ftp' => [ + 'description' => 'Qui puoi creare e modificare i tuoi account FTP.
I cambiamenti sono effettuati in tempo reale e gli account si possono usare immediatamente.', + 'account_add' => 'Crea account', + 'account_edit' => 'Modifica acocunt FTP', + 'editpassdescription' => 'Imposta una nuova password o lascia vuoto per non cambiarla.', + ], + 'gender' => [ + 'title' => 'Titolo', + 'male' => 'Sig.', + 'female' => 'Sig.ra', + 'undef' => '', + ], + 'index' => [ + 'customerdetails' => 'Dettagli Cliente', + 'accountdetails' => 'Dettagli Account', + ], + 'logger' => [ + 'date' => 'Data', + 'type' => 'Tipo', + 'action' => 'Azione', + 'user' => 'Utente', + 'truncate' => 'Log vuoto', + 'reseller' => 'Rivenditore', + 'admin' => 'Amministratore', + 'cron' => 'Cronjob', + 'login' => 'Login', + 'intern' => 'Interno', + 'unknown' => 'Sconosciuto', + ], + 'login' => [ + 'username' => 'Nome Utente', + 'password' => 'Password', + 'language' => 'Lingua', + 'login' => 'Login', + 'logout' => 'Logout', + 'profile_lng' => 'Scegli la lingua', + 'forgotpwd' => 'Dimenticato la password?', + 'presend' => 'Reimposta la password', + 'email' => 'Indirizzo E-mail', + 'remind' => 'Reimposta la mia password', + 'usernotfound' => 'Utente non trovata!', + 'backtologin' => 'Torna al login', + 'combination_not_found' => 'Combinazione utente-indirizzo email non trovata.', + ], + 'mails' => [ + 'pop_success' => [ + 'mailbody' => 'Salve,\\n\\nil tuo indirizzo Email {EMAIL}\\nè stato configurato con successo.\\n\\nQuesta è un\'Email creata automaticamente,\\n per favore non rispondere!\\n\\nCordiali saluti, Amministratore.', + 'subject' => 'Indirizzo Email configurato con successo', + ], + 'createcustomer' => [ + 'mailbody' => 'Salve {FIRSTNAME} {NAME},\\n\\nqueste sono le informazioni per il tuo account:\\n\\nNome Utente: {USERNAME}\\nPassword: {PASSWORD}\\n\\nGrazie,\\nAmministratore.', + 'subject' => 'Informazioni account', + ], + 'pop_success_alternative' => [ + 'mailbody' => 'Salve,\\n\\nil tuo account email {EMAIL}\\nè stato creato correttamente.\\nLa tua password è {PASSWORD}.\\n\\nQuesta è un\'email creata automaticamente,\\n si prega di non rispondere a questa email!\\n\\nCordiali Saluti, Amministratore.', + 'subject' => 'Account email creato correttamente', + ], + 'password_reset' => [ + 'subject' => 'Reimposta password', + 'mailbody' => 'Salve {USERNAME},\\n\\nla tua password froxlor è stata reimpostata!\\nLa nuova password è: {LINK}\\n\\nGrazie,\\n Team Froxlor', + ], + 'new_database_by_customer' => [ + 'subject' => '[Froxlor] Nuovo database creato', + 'mailbody' => 'Hello {CUST_NAME}, + +hai appena aggiunto un nuovo database. Ecco le informazioni inserite: + +Nome database: {DB_NAME} +Password: {DB_PASS} +Descrizione: {DB_DESC} +DB-Hostname: {DB_SRV} +{PMA_URI} +Cordiali Saluti, Team Froxlor', + ], + 'new_ftpaccount_by_customer' => [ + 'subject' => 'Nuovo utente ftp creato', + 'mailbody' => 'Salve {CUST_NAME}, + +hai appena aggiunto un nuovo utente ftp. Ecco le informazioni inserite: + +Nome utente: {USR_NAME} +Password: {USR_PASS} +Percorso: {USR_PATH} + +Cordiali Saluti, Team Froxlor', + ], + 'trafficmaxpercent' => [ + 'mailbody' => 'Salve {NAME},\\n\\nhai utilizzato {TRAFFICUSED} MB di {TRAFFIC} MB traffico disponibile.\\nQuesto è più del {MAX_PERCENT}%.\\n\\nCordiali Saluti, il Team Froxlor', + 'subject' => 'Raggiunto il limite di traffico', + ], + 'diskmaxpercent' => [ + 'mailbody' => 'Salve {NAME},\\n\\nhai utilizzato {DISKUSED} MB di {DISKAVAILABLE} MB di spazio disponibile.\\nQuesto è più del {MAX_PERCENT}%.\\n\\nCordiali Saluti, il Team Froxlor', + 'subject' => 'Raggiungere il limite di spazio su disco', + ], + ], + 'menu' => [ + 'message' => 'Messaggi', + ], + 'menue' => [ + 'main' => [ + 'main' => 'Principale', + 'changepassword' => 'Cambia la password', + 'changelanguage' => 'Cambia la lingua', + 'username' => 'Utente: ', + 'changetheme' => 'Cambia tema', + ], + 'email' => [ + 'email' => 'Email', + 'emails' => 'Indirizzi', + 'webmail' => 'WebMail', + ], + 'mysql' => [ + 'mysql' => 'MySQL', + 'databases' => 'Database', + 'phpmyadmin' => 'phpMyAdmin', + ], + 'domains' => [ + 'domains' => 'Domini', + 'settings' => 'Opzioni', + ], + 'ftp' => [ + 'ftp' => 'FTP', + 'accounts' => 'Account', + 'webftp' => 'WebFTP', + ], + 'extras' => [ + 'extras' => 'Extra', + 'directoryprotection' => 'Cartelle Protette', + 'pathoptions' => 'Opzioni Cartelle', + ], + 'traffic' => [ + 'traffic' => 'Traffico', + 'current' => 'Mese corrente', + 'table' => 'Traffico', + ], + 'phpsettings' => [ + 'maintitle' => 'Configurazioni PHP', + ], + ], + 'message' => [ + 'norecipients' => 'Nessuna e-mail è stata inviata perch¸ non ci sono i destinatari nel database', + ], + 'mysql' => [ + 'description' => 'Qui puoi creare e modificare il tuo database MySQL
Le modifiche sono istantanee e puoi usare subito il database.
Nel menù a sinistra trovi phpMyAdmin con cui puoi amministrare il tuo database.

Per usare i database nei tuoi script php usa le seguenti impostazioni: (Le parole in corsivo devono essere modificate con quello che hai scritto!)
Hostname:
Utente: Nome database
Password: La password che hai scelto
Database: Nome database', + 'databasename' => 'Nome database', + 'databasedescription' => 'Descrizione database', + 'database_create' => 'Crea database', + 'mysql_server' => 'Server MySQL', + 'database_edit' => 'Modifica database', + 'size' => 'Dimensione', + ], + 'panel' => [ + 'edit' => 'Modifica', + 'delete' => 'Cancella', + 'create' => 'Crea', + 'save' => 'Salva', + 'yes' => 'Si', + 'no' => 'No', + 'emptyfornochanges' => 'lasciare vuoto se non si vuole cambiare', + 'emptyfordefault' => 'lasciare vuoto per l\'impostazione di default', + 'path' => 'Percorso', + 'toggle' => 'Cambia', + 'next' => 'Prossimo', + 'dirsmissing' => 'La cartella fornita non è stata trovata.', + 'urloverridespath' => 'URL (sovrascrive il percorso)', + 'pathorurl' => 'Percorso o URL', + 'ascending' => 'ascendente', + 'descending' => 'discendente', + 'search' => 'Cerca', + 'used' => 'utilizzato', + 'translator' => 'Traduttore', + 'reset' => 'Annulla le modifiche', + 'pathDescription' => 'Se la cartella non esiste, viene creata automaticamente.', + 'back' => 'Indietro', + 'reseller' => 'rivenditore', + 'admin' => 'amministratore', + 'customer' => 'cliente/i', + 'send' => 'invia', + 'nosslipsavailable' => 'Attualmente non ci sono combinazioni ssl ip/porta per questo server', + 'backtooverview' => 'Ritorna alla pagina precedente', + 'dateformat' => 'DD-MM-YYYY', + 'dateformat_function' => 'd-m-Y', + 'timeformat_function' => 'H:i:s', + 'default' => 'Predefinito', + 'never' => 'Mai', + 'active' => 'Attivo', + 'please_choose' => 'Scegli', + 'allow_modifications' => 'Permetti modifiche', + 'megabyte' => 'MegaByte', + 'not_supported' => 'Non supportato in: ', + 'view' => 'view', + 'toomanydirs' => 'Troppe sottocartelle. Rifare tornando indietro nella selezione manuale della cartella.', + 'abort' => 'Termina', + 'not_activated' => 'non attivato', + 'off' => 'off', + 'options' => 'opzioni', + 'neverloggedin' => 'Nessun login effettuato', + 'descriptionerrordocument' => 'Può essere un URL, un percorso ad un file o solo una stringa con un " "
Lasciare vuoto per usare il valore di default del server.', + 'unlock' => 'unlock', + 'theme' => 'Tema', + 'variable' => 'Variabile', + 'description' => 'Descrizione', + 'pathDescriptionEx' => '

Se vuoi redirezionare ad un altro dominio, questo valore deve iniziare con http:// or https://.', + 'pathDescriptionSubdomain' => 'Se la cartella non esiste, viene creata automaticamente.

Se vuoi redirezionare ad un altro dominio, questo valore deve iniziare con http:// or https://.

Se la URL termina con / è considerata una cartella, altrimenti verrà trattata come un file.', + 'cancel' => 'Annulla', + 'ssleditor' => 'Impostazioni SSL per questo dominio', + 'dashboard' => 'Cruscotto', + 'assigned' => 'Assegnato', + 'available' => 'Disponibile', + 'news' => 'Notizie', + 'ftpdesc' => 'Descrizione FTP', + ], + 'phpfpm' => [ + 'vhost_httpuser' => 'Utente locale per PHP-FPM (Froxlor vHost)', + 'vhost_httpgroup' => 'Gruppo locale per PHP-FPM (Froxlor vHost)', + 'ownvhost' => [ + 'title' => 'Abilita PHP-FPM per i vHost Froxlor', + 'description' => 'Se abilitato, Froxlor potrà essere avviato attraverso un utente locale', + ], + 'use_mod_proxy' => [ + 'title' => 'Usa mod_proxy / mod_proxy_fcgi', + 'description' => 'Attiva l\'utilizzo di php-fpm attraverso mod_proxy_fcgi. Richiede almeno apache-2.4.9', + ], + ], + 'pwdreminder' => [ + 'success' => 'La password è stata reimpostata con successo.
A questo punto riceverai una email con la nuova password.', + 'notallowed' => 'Il reimposta password è disabilitato', + 'changed' => 'La tua password è stata aggiornata con successo. Puoi accedere con le tue nuove credenziali.', + 'wrongcode' => 'Ci dispiace, il tuo codice di attivazione non esiste o è già scaduto.', + 'choosenew' => 'Setta la nuova password', + ], + 'question' => [ + 'question' => 'Domanda di sicurezza', + 'admin_customer_reallydelete' => 'Sei sicuro di voler cancellare il cliente %s? Quest\'azione non potrà essere annullata!', + 'admin_domain_reallydelete' => 'Sei sicuro di voler cancellare il dominio %s?', + 'admin_domain_reallydisablesecuritysetting' => 'Sei sicuro di voler disattivare queste opzioni di sicurezza (OpenBasedir)?', + 'admin_admin_reallydelete' => 'Sei sicuro di voler cancellare l\'admin %s? Tutti i clienti e i domini saranno affidati all\'amministratore principale.', + 'admin_template_reallydelete' => 'Sei sicuro di voler cancellare il template \'%s\'?', + 'domains_reallydelete' => 'Sei sicuro di voler cancellare il dominio %s?', + 'email_reallydelete' => 'Sei sicuro di voler cancellare l\'indirizzo Email %s?', + 'email_reallydelete_account' => 'Sei sicuro di voler cancellare l\'account Email di %s?', + 'email_reallydelete_forwarder' => 'Sei sicuro di voler cancellare il reindirizzamento a %s?', + 'extras_reallydelete' => 'Sei sicuro di voler cancellare la protezione per la cartella %s?', + 'extras_reallydelete_pathoptions' => 'Sei sicuro di voler cancellare le opzioni cartella per %s?', + 'ftp_reallydelete' => 'Sei sicuro di voler cancellare l\'account FTP %s?', + 'mysql_reallydelete' => 'Sei sicuro di voler cancellare il database %s? Quest\'azione non potrà essere annullata!', + 'admin_configs_reallyrebuild' => 'Sei sicuro di voler rigenerare i file di configurazione per Apache e Bind?', + 'admin_customer_alsoremovefiles' => 'Cancellare anche i file dell\'utente?', + 'admin_ip_reallydelete' => 'Vuoi veramente eliminare l\'indirizzo IP %s?', + 'admin_domain_reallydocrootoutofcustomerroot' => 'Sei sicuro di volere la cartella base dei dati web di questo dominio al di fuori della cartella base del cliente?', + 'admin_counters_reallyupdate' => 'Sei sicuro di voler ricacolare il consumo delle risorse?', + 'admin_cleartextmailpws_reallywipe' => 'Sei sicuro di voler cancellare tutte le password in chiaro degli account email dalla tabella mail_users? Attenzione non si può tornare indietro!', + 'logger_reallytruncate' => 'Sei sicuro di voler troncare la tabella "%s"?', + 'admin_quotas_reallywipe' => 'Sei sicuro di voler cancellare tutti i limiti dalla tabella mail_users? Questa operazione non può essere annullata!', + 'admin_quotas_reallyenforce' => 'Sei sicuro di voler impostare il limite predefinito a tutti gli utenti? Questa operazione non può essere annullata!', + 'phpsetting_reallydelete' => 'Do you really want to delete these settings? All domains which use these settings currently will be changed to the default config.', + 'remove_subbutmain_domains' => 'Rimuover anche i domini che sono stati aggiunti come domini completi, ma quali sono i sottodomini di questo dominio?', + 'customer_reallyunlock' => 'Sei sicuro di voler sbloccare il cliente %s?', + 'admin_customer_alsoremovemail' => 'Eliminare completamente i dati della posta elettronica dal filesystem??', + 'admin_customer_alsoremoveftphomedir' => 'Rimuovere anche la cartella homedir dell\'utente FTP?', + 'admin_integritycheck_reallyfix' => 'Vuoi veramente provare a risolvere i problemi di integrità del database automaticamente?', + ], + 'redirect_desc' => [ + 'rc_default' => 'Predefinito', + 'rc_movedperm' => 'spostato in modo permanente', + 'rc_found' => 'trovato', + 'rc_seeother' => 'vedi gli altri', + 'rc_tempred' => 'reindirizzamento temporaneo', + ], + 'serversettings' => [ + 'session_timeout' => [ + 'title' => 'Timeout della sessione', + 'description' => 'Quanto tempo un utente deve rimanere inattivo prima che la sessione diventi invalida (secondi)?', + ], + 'accountprefix' => [ + 'title' => 'Prefisso Cliente', + 'description' => 'Che prefisso dovrebbero avere gli account dei clienti?', + ], + 'mysqlprefix' => [ + 'title' => 'Prefisso SQL', + 'description' => 'Che prefisso dovrebbero avere i database SQL?', + ], + 'ftpprefix' => [ + 'title' => 'Prefisso FTP', + 'description' => 'Che prefisso vuoi che per gli account ftp?
Se si modifica questo devi anche modificare il limite (Quota) della query SQL nel file di configurazione del server FTP nel caso in cui venga usata! ', + ], + 'documentroot_prefix' => [ + 'title' => 'Cartella dati web', + 'description' => 'Dove devono essere immagazzinati tutti i dati web?', + ], + 'logfiles_directory' => [ + 'title' => 'Cartella logfiles', + 'description' => 'Dove devono essere immagazzinati tutti i log?', + ], + 'ipaddress' => [ + 'title' => 'Indirizzo IP', + 'description' => 'Qual\'è l\'indirizzo IP di questo server?', + ], + 'hostname' => [ + 'title' => 'Hostname', + 'description' => 'QUal\'è l\'hostname di questo server?', + ], + 'apachereload_command' => [ + 'title' => 'Comando riavvio Apache', + 'description' => 'Qual\'è il comando per riavviare Apache?', + ], + 'bindconf_directory' => [ + 'title' => 'Cartella configurazione Bind', + 'description' => 'Dove sono i file di configurazione per Bind?', + ], + 'bindreload_command' => [ + 'title' => 'Comando riavvio Bind', + 'description' => 'Qual\'è il comando per riavviare Bind?', + ], + 'vmail_uid' => [ + 'title' => 'UID Email', + 'description' => 'Che UserID dovrebbe avere l\'utente che gestisce le Email?', + ], + 'vmail_gid' => [ + 'title' => 'GID Email', + 'description' => 'Che GroupID dovrebbe avere l\'utente che gestisce le Email?', + ], + 'vmail_homedir' => [ + 'title' => 'Cartella Email', + 'description' => 'Dove devono essere immagazzinate tutte le Email?', + ], + 'adminmail' => [ + 'title' => 'Mittente', + 'description' => 'Qual\'è l\'indirizzo del mittente delle Email provenienti dal pannello?', + ], + 'phpmyadmin_url' => [ + 'title' => 'URL phpMyAdmin', + 'description' => 'Qual\'è l\'URL di phpMyAdmin? (deve cominciare per http://)', + ], + 'webmail_url' => [ + 'title' => 'URL WebMail', + 'description' => 'Qual\'è l\'URL della WebMail? (deve cominciare per http://)', + ], + 'webftp_url' => [ + 'title' => 'URL WebFTP', + 'description' => 'Qual\'è l\'URL del WebFTP? (deve cominciare per http://)', + ], + 'language' => [ + 'description' => 'Qual\'è la lingua standard del tuo server?', + ], + 'maxloginattempts' => [ + 'title' => 'Numero massimo tentativi login', + 'description' => 'Numero massimo di tentativi di login prima che l\'account sia disattivato.', + ], + 'deactivatetime' => [ + 'title' => 'Durata disattivamento', + 'description' => 'Tempo (sec.) di disattivazione dell\'account dopo troppi tentativi di login.', + ], + 'pathedit' => [ + 'title' => 'Modalità di scelta percorsi/cartelle', + 'description' => 'Un percorso/cartella andrà scelto attraverso un menu a tendina o inserendolo a mano?', + ], + 'nameservers' => [ + 'title' => 'Nameservers', + 'description' => 'Lista degli hostname (separati dalla virgola) di tutti i nameserver. Il primo della lista sarà il impostato come primario.', + ], + 'mxservers' => [ + 'title' => 'MX servers', + 'description' => 'Lista dei server mx (separati dalla virgola) numero spazio hostname (es. \'10 mx.example.com\').', + ], + 'paging' => [ + 'title' => 'Elementi da visualizzare per pagina', + 'description' => 'Quanti elementi dovrebbero essere visualizzati su una pagina? (0 = disattiva impaginazione)', + ], + 'defaultip' => [ + 'title' => 'IP/Porta default', + 'description' => 'Qual\'è la combinazione IP/Porta default?', + ], + 'phpappendopenbasedir' => [ + 'title' => 'Percoso da aggiungere a OpenBasedir', + 'description' => 'Questi percorsi (separati da colonne) verranno aggiunti allo statement OpenBasedir in ognuno vhost-container.', + ], + 'natsorting' => [ + 'title' => 'Usa l\'ordinamento naturale in vista elenco', + 'description' => 'Disponi la lista come web1 -> web2 -> web11 al posto di web1 -> web11 -> web2.', + ], + 'deactivateddocroot' => [ + 'title' => 'Docroot per gli utenti disattivati', + 'description' => 'Quando un utente viene disattivato questo percorso viene usato come suo docroot. Lascia vuoto per non creare un vhost a tutti.', + ], + 'mailpwcleartext' => [ + 'title' => 'Salva le password in chiaro degli account email nel database', + 'description' => 'Se impostato a Si, tutte le password saranno salvate in chiaro (saranno leggibili a chiunque abbia accesso al database) nella tabella mail_users. Attiva questa opzione solo se necessaria!', + 'removelink' => 'Clicca qui per cancellare tutte le password in chiaro dalla tabella.', + ], + 'ftpdomain' => [ + 'title' => 'Account FTP @domain', + 'description' => 'I Clienti possono creare account ftp utente@dominiocliente?', + ], + 'mod_fcgid' => [ + 'title' => 'Includi PHP via mod_fcgid/suexec', + 'description' => 'Usa mod_fcgid/suexec/libnss_mysql per avviare PHP con il corrispondente account-utente.
Questo richiede una speciale configurazione del Webserver. Tutte le opzioni seguenti sono validi solo se il modulo è abilitato.', + 'configdir' => [ + 'title' => 'Cartella della configurazione', + 'description' => 'Dove vuoi che venga salvata la configurazione di fcgid? Se non ti sei compilato suexec da solo, di solito questo percorso è /var/www', + ], + 'tmpdir' => [ + 'title' => 'Cartella Temp', + 'description' => 'Dove va salvata la cartella temp', + ], + 'starter' => [ + 'title' => 'Processi per Dominio', + 'description' => 'Quanti processi dovrebbero essere avviati/permessi per ogni dominio? Il valore 0 è raccomandato poichè PHP si autogestisce i processi in modo molto efficiente.', + ], + 'wrapper' => [ + 'title' => 'Wrapper in Vhosts', + 'description' => 'Come dovrebbe essere il wrapper incluso nel Vhosts', + ], + 'peardir' => [ + 'title' => 'Cartella globale di PEAR', + 'description' => 'Quali sono le cartelle globali di PEAR che dovrebbero essere sostituite in ogni configurazione php.ini? Più cartelle devono essere separate da : (due punti).', + ], + 'maxrequests' => [ + 'title' => 'Richieste massime per dominio', + 'description' => 'Quante richieste dovrebbero essere permesse per dominio?', + ], + 'defaultini' => 'Configurazione di default di PHP per i nuovi domini', + 'defaultini_ownvhost' => 'Configurazione di Default di PHP per Froxlor-vhost', + 'idle_timeout' => [ + 'title' => 'Timeout Inattività', + 'description' => 'Impostazione Timeout per il Mod FastCGI.', + ], + ], + 'sendalternativemail' => [ + 'title' => 'Usa un\'indirizzo email alternativo', + 'description' => 'Invia la password dell\'email a un\'indirizzo diverso da quello creato', + ], + 'apacheconf_vhost' => [ + 'title' => 'File/cartella della configurazione vhost del Webserver', + 'description' => 'Dove vuoi che venga salvata la configurazione vhost? Qui puoi scegliere un file (tutti i vhosts in un file) o una cartella (ogni vhost avrà il suo file).', + ], + 'apacheconf_diroptions' => [ + 'title' => 'Webserver diroptions configuration file/dirname', + 'description' => 'Dove vuoi che venga salvata la configurazione dir-options? Qui puoi scegliere un file (tutti i vhosts in un file) o una cartella (ogni vhost avrà il suo file).', + ], + 'apacheconf_htpasswddir' => [ + 'title' => 'Cartella htpasswd del Webserver', + 'description' => 'Dove vuoi che vengano salvati i file htpasswd per la protezione delle cartelle?', + ], + 'mysql_access_host' => [ + 'description' => 'Lista degli host (separati da una virgola) a cui gli utenti possono collegarsi al server MySQL.', + 'title' => 'Hosts Accesso MySQL', + ], + 'webalizer_quiet' => [ + 'description' => 'Verbosità del programma webalizer', + 'title' => 'Webalizer output', + ], + 'logger' => [ + 'enable' => 'Abilita/Disabilita Log', + 'severity' => 'Livello Log', + 'types' => [ + 'title' => 'Tipo di Log', + 'description' => 'Specificare tipo di Log. Per selezionare più tipi, tenere premuto CTRL durante la selezione.
Tipi di log disponibili: syslog, file, mysql', + ], + 'logfile' => 'Percorso completo e nome del file del Log', + 'logcron' => 'Log cronjobs (one run)', + ], + 'ssl' => [ + 'openssl_cnf' => 'Defaults per la creazione del file Cert', + 'use_ssl' => [ + 'title' => 'Abilita utilizzo SSL', + 'description' => 'Spunta questo se vuoi usare SSL per il tuo server web', + ], + 'ssl_cert_file' => [ + 'title' => 'Percorso al certificato SSL', + 'description' => 'Specifica il percorso includendo il nome del file .crt o .pem (certificato principale)', + ], + 'ssl_key_file' => [ + 'title' => 'Percorso al file di chiave SSL', + 'description' => 'Specifica il percorso includendo il nome del file per la chiave privata (abitualmente.key)', + ], + 'ssl_ca_file' => [ + 'title' => 'Percorso al certificato della CA (autoritá certificatrice) SSL (opzionale)', + 'description' => 'Autenticazione client, da settare soltanto se desiderato.', + ], + 'ssl_cipher_list' => [ + 'title' => 'Configura le cifrature SSL permesse', + 'description' => 'Questa è una lista di cifrature che vuoi (o non vuoi) usare nelle communicazioni SSL. Per una lista delle cifrature e come includerle od escluderle, vedi le sezioni "CIPHER LIST FORMAT" e "CIPHER STRINGS" sulla man-page per le cifrature.

Il valore predefinito è:
ECDHE-RSA-AES128-SHA256:AES128-GCM-SHA256:RC4:HIGH:!MD5:!aNULL:!EDH
', + ], + ], + 'default_vhostconf' => [ + 'title' => 'Impostazioni default vhost', + 'description' => 'Il contenuto di questo campo sarà incluso direttamente nel contenitore di dominio vhost. Attenzione: Il codice non sarà controllato per eventuali errori. Se contiene errori, il webserver non riavviarsi correttamente!', + ], + 'decimal_places' => 'Numero di cifre decimali del traffico/spazio web in uscita', + 'webalizer_enabled' => 'Abilita le statistiche webalizer', + 'awstats_enabled' => 'Abilita le statistiche awstats', + 'selfdns' => [ + 'title' => 'Impostazioni dominio dns del cliente', + ], + 'selfdnscustomer' => [ + 'title' => 'Consenti ai clienti di modificare le impostazioni DNS del dominio', + ], + 'unix_names' => [ + 'title' => 'Usa nomi utente UNIX compatibile', + 'description' => 'Consente di utilizzare - e _ nei nomi utente se No', + ], + 'allow_password_reset' => [ + 'title' => 'Consenti ai clienti di reimpostare la password', + 'description' => 'I clienti possono reimpostare la propria password e una nuova password verrà inviata al loro indirizzo e-mail', + ], + 'allow_password_reset_admin' => [ + 'title' => 'Consenti di reimpostare la password agli ammministratori', + 'description' => 'Amministratori/rivenditori possono reimpostare la propria password e una nuova password verrà inviata al loro indirizzo e-mail', + ], + 'mail_quota' => [ + 'title' => 'Limite casella email', + 'description' => 'Limite predefinito per una nuova casella email creata (MegaByte).', + ], + 'mail_quota_enabled' => [ + 'title' => 'Usa limiti per le caselle email dei clienti', + 'description' => 'Attiva per utilizzare i limiti nelle caselle email. Predefinito No poich¸ questo richiede una configurazione speciale.', + 'removelink' => 'Clicca qui per togliere tutti i limiti dalle caselle email.', + 'enforcelink' => 'Clicca qui per applicare il limite predefinito a tutte le caselle email degli utenti.', + ], + 'index_file_extension' => [ + 'description' => 'Quale estensione di file deve essere usata per il file index nelle cartelle del cliente appena creato? Questa estensione di file sarà utilizzata se Lei o uno dei vostri amministratori ha creato il proprio file modello di index.', + 'title' => 'Estensione file per il file index delle cartelle dei clienti appena creati', + ], + 'session_allow_multiple_login' => [ + 'title' => 'Permettere login multipli', + 'description' => 'Se attivato un utente può accedere più volte.', + ], + 'panel_allow_domain_change_admin' => [ + 'title' => 'Permettere di spostare domini tra gli amministratori', + 'description' => 'Se attivato si può cambiare l\'amministratore di un dominio dalle impostazioni del dominio
Attenzione: Se un cliente non viene assegnato allo stesso amministratore e dominio, l\'amministratore può vedere tutti gli altri domini di questo cliente!', + ], + 'panel_allow_domain_change_customer' => [ + 'title' => 'Permetti di spostare domini tra i clienti', + 'description' => 'Se attivato si può cambiare il cliente di un dominio dalle impostazioni del dominio.
Attenzione: Froxlor non cambierà alcun percorso. Ciò potrebbe rendere inutilizzabile un dominio!', + ], + 'cron' => [ + 'debug' => [ + 'title' => 'Debug Cronscript', + 'description' => 'Attiva per mantenere il file lock dopo l\'avvio di cron, solo per debug
Attenzione:Mantenendo il file di lock al successivo avvio cron potrebbe non funzionare correttamente', + ], + ], + 'specialsettingsforsubdomains' => [ + 'description' => 'Se si queste impostazioni personalizzate dei vhost saranno aggiunte a tutti sottodomini; se no le impostazioni speciali dei sottodomini verranno rimosse.', + ], + 'panel_password_min_length' => [ + 'title' => 'Lunghezza minima della password', + 'description' => 'Qui è possibile impostare una lunghezza minima per le password.\'0\' significa: nessuna lunghezza minima richiesta.', + ], + 'system_store_index_file_subs' => [ + 'title' => 'Salva il file index predefinito anche nelle nuove sottocartelle', + 'description' => 'Se abilitato, il file index predefinito viene memorizzato per ogni cartella sottodominio appena creata (non se la cartella esiste già!)', + ], + 'adminmail_return' => [ + 'title' => 'Indirizzo di Risposta', + 'description' => 'Definire un indirizzo email come \'Indirizzo di Risposta\' per le email inviate dal Pannello', + ], + 'adminmail_defname' => 'Nome del mittente del Pannello nell\'email', + 'stdsubdomainhost' => [ + 'title' => 'Sottodominio standard cliente', + 'description' => 'Quale hostname dovrebbe essere usato per creare sottodomini standard per i clienti. Se vuoto, viene utilizzato l\'hostname del sistema.', + ], + 'awstats_path' => 'Percorso a AWStats \'awstats_buildstaticpages.pl\'', + 'awstats_conf' => 'Cartella della configurazione di AWStats', + 'defaultttl' => 'Dominio TTL per impegnare in secondi (predefinito \'604800\' = 1 settimana)', + 'defaultwebsrverrhandler_enabled' => 'Abilita errordocuments in automatico per tutti i clienti', + 'defaultwebsrverrhandler_err401' => [ + 'title' => 'File/URL per l\'errore 401', + 'description' => '
Non supportato in: lighttpd
', + ], + 'defaultwebsrverrhandler_err403' => [ + 'title' => 'File/URL per l\'errore 403', + 'description' => '
Non supportato in: lighttpd
', + ], + 'defaultwebsrverrhandler_err404' => 'File/URL per l\'errore 404', + 'defaultwebsrverrhandler_err500' => [ + 'title' => 'File/URL per l\'errore 500', + 'description' => '
Non supportato in: lighttpd
', + ], + 'ftpserver' => [ + 'desc' => 'Se pureftpd è selezionato i file .ftpquota per i limiti dell\'utente sono creati e aggiornati giornalmente', + ], + 'customredirect_enabled' => [ + 'title' => 'Permetti ai clienti le redirezioni', + 'description' => 'Consente ai clienti di scegliere il codice di stato http per le redirezioni che verranno utilizzate', + ], + 'customredirect_default' => [ + 'title' => 'Redirezione Predefinita', + 'description' => 'Imposta il codice della redirezione predefinito che dovrebbe essere usato se il cliente non lo imposta', + ], + 'mail_also_with_mxservers' => 'Crea mail-, imap-, pop3- and smtp-"A record" anche con MX-Servers impostato', + 'froxlordirectlyviahostname' => 'Accedi direttamente a Froxlor via hostname', + 'panel_password_regex' => [ + 'title' => 'Espressione per le password', + 'description' => 'Qui è possibile impostare una espressione regolare per la complessità delle password.
Vuoto = nessun requisito specificato', + ], + 'perl_path' => [ + 'title' => 'Percorso perl', + 'description' => 'Rilevante solo se si utilizza lighttpd. Predefinito /usr/bin/perl', + ], + 'mod_fcgid_ownvhost' => [ + 'title' => 'Abilita FCGID per i vhost Froxlor', + 'description' => 'Se attivato, Froxlor verrà eseguito con un utente locale
ATTENZIONE:Questo richiede una configurazione manuale, vedi FCGID - handbook', + ], + 'perl' => [ + 'suexecworkaround' => [ + 'title' => 'Abilita SuExec workaround (solo con Apache)', + 'description' => 'Abilita solo se la docroots del cliente non sono all\'interno del percorso suexec di Apache
Se attivato, Froxlor genererà un link simbolico dalla cartella perl abilitata dei clienti + /cgi-bin/ al percorso specificato.
Nota: Perl funziona solo nelle sottocartelle /cgi-bin/ e non nella cartella stessa (come farebbe normalmente senza questa correzione!)', + ], + 'suexeccgipath' => [ + 'title' => 'Percorso dei link simbolici della cartella abilitata perl del cliente', + 'description' => 'Imposta questo solo se la soluzione SuExec è abilitata.
ATTENZIONE: Assicurati che questo percorso sia all\'interno del percorso suexec oppure questa soluzione è inutile', + ], + ], + 'awstats_awstatspath' => 'Percorso AWStats \'awstats.pl\'', + 'awstats_icons' => [ + 'title' => 'Percorso della cartella delle icone di AWstats', + 'description' => 'es. /usr/share/awstats/htdocs/icon/', + ], + 'login_domain_login' => 'Permetti il login con i domini', + 'nginx_php_backend' => [ + 'title' => 'Nginx PHP backend', + 'description' => 'questo è dove in ascolto il processo PHP per le richieste da nginx, può essere un socket unix combinazione IP:Porta', + ], + 'phpreload_command' => [ + 'title' => 'Comando riavvio PHP', + 'description' => 'questo viene utilizzato per ricaricare il backend PHP se è in uso
Predefinito: vuoto', + ], + 'phpfpm_settings' => [ + 'configdir' => 'Cartella di configurazione php-fpm', + 'reload' => 'comando di riavvio php-fpm', + 'pm' => 'Gestore processi (pm)', + 'max_children' => [ + 'title' => 'Il numero di processi figli', + 'description' => 'Il numero di processi figli che vengono creati quando il pm è impostato a \'static\' e il numero massimo di processi figli che vengono creati quando il pm è impostato a \'dynamic\'
Equivalente a PHP_FCGI_CHILDREN', + ], + 'start_servers' => [ + 'title' => 'Il numero di processi figli creati all\'avvio', + 'description' => 'Nota: Usato solo quando il pm è impostato a \'dynamic\'', + ], + 'min_spare_servers' => [ + 'title' => 'Il numero minimo di processi inattivi nel server', + 'description' => 'Nota: Usato solo quando il pm è impostato a \'dynamic\'
Nota: Obbligatorio quando il pm è impostato a \'dynamic\'', + ], + 'max_spare_servers' => [ + 'title' => 'Il numero massimo di processi inattivi nel server', + 'description' => 'Nota: Usato solo quando il pm è impostato a \'dynamic\'
Nota: Obbligatorio quando il pm è impostato a \'dynamic\'', + ], + 'max_requests' => [ + 'title' => 'Richieste per figli prima di rigenerare', + 'description' => 'Per le richieste senza fine specificare \'0\'. Equivalente a PHP_FCGI_MAX_REQUESTS.', + ], + 'aliasconfigdir' => 'Configurazione cartella Alias per php-fpm', + 'idle_timeout' => [ + 'title' => 'Timeout Inattività', + 'description' => 'Impostazione Timeout per PHP5 FPM FastCGI.', + ], + 'ipcdir' => [ + 'title' => 'Cartella FastCGI IPC', + 'description' => 'La cartella nella quale verrano salvati i socket php-fpm dal server web.
Questa cartella deve essere leggibile dal server Web', + ], + ], + 'report' => [ + 'report' => 'Abilita l\'invio dei report di utilizzo web e del traffico', + 'webmax' => 'Percentuale di avviso per lo spazio web', + 'trafficmax' => 'Percentuale di avviso per il traffico', + ], + 'dropdown' => 'Dropdown', + 'manual' => 'Manuale', + 'default_theme' => 'Tema predefinito', + 'validate_domain' => 'Convalida dei domini', + 'bindenable' => [ + 'title' => 'Abilita Nameserver', + 'description' => 'Qui il Nameserver può essere abilitato e disabilitato globalmente.', + ], + 'default_vhostconf_domain' => [ + 'description' => 'Il contenuto di questo campo verrà incluso direttamente nella configurazione del contenitore del dominio vHost. ATTENZIONE: Non verrano verificati eventuali errori del codice contenuto. Se conterrà degli errori, vi è il rischio che il server WEB non si avvii più!', + ], + 'phpfpm' => [ + 'title' => 'Abilita php-fpm', + 'description' => 'Questa impostazione richiede una configurazione speciale del server web. Vedi il manuale PHP-FPM', + ], + 'diskquota_enabled' => 'Quota attivita?', + 'diskquota_repquota_path' => [ + 'description' => 'Percorso a repquota', + ], + 'diskquota_quotatool_path' => [ + 'description' => 'Percorso al quotatool', + ], + 'diskquota_customer_partition' => [ + 'description' => 'Partizione, sulla quale sono salvati i dati dei clienti', + ], + 'vmail_maildirname' => [ + 'title' => 'nome Maildir', + 'description' => 'cartella Maildir nell account utente. Normalmente \'Maildir\', in alcune implementazioni \'.maildir\', e direttamente nella cartella utente se lasciato vuoto.', + ], + 'catchall_enabled' => [ + 'title' => 'Usa Catchall', + 'description' => 'Vuoi offrire ai tuoi clienti la funzionalità di catchall?', + ], + 'apache_24' => [ + 'title' => 'Usa impostazioni per Apache 2.4', + 'description' => 'ATTENZIONE: spunta soltanto se hai installato la versione 2.4 o superiore di Apache
altrimenti il tuo server Web non si avvierà', + ], + 'nginx_fastcgiparams' => [ + 'title' => 'Percorso al file fastcgi_params', + 'description' => 'Specifica il percorso al file fastcgi_params di nginx includendo il nome del file', + ], + 'documentroot_use_default_value' => [ + 'title' => 'Usa il nome del dominio come valore predefinito per il percorso DocumentRoot (radice dei documenti)', + 'description' => 'Se abilitato ed il percorso radice DocumentRoot è vuoto, il valore predefinito sarà il nome del (sotto)dominio.

Esempio:
/var/customers/nome_cliente/example.com/
/var/customers/nome_cliente/sottodominio.example.com/', + ], + 'panel_phpconfigs_hidestdsubdomain' => [ + 'title' => 'Nascondi i sottodominii predefiniti nel riepilogo di configurazione PHP', + 'description' => 'Se attivato i sottodomini predefiniti dei clienti non saranno visualizzati nel riepilogo della configurazione php

Nota: Questo è solo visibile se avete abilitato FCGID o PHP-FPM', + ], + 'passwordcryptfunc' => [ + 'title' => 'Scegli quale metodo crittografico deve essere usato per le password', + ], + 'systemdefault' => 'Predefinito di sistema', + 'panel_allow_theme_change_admin' => 'Permetti agli amministratori di cambiare il tema', + 'panel_allow_theme_change_customer' => 'Permetti ai clienti di cambiare il tema', + 'axfrservers' => [ + 'title' => 'Server AXFR', + 'description' => 'Un elenco separato da virgole di indirizzi IP autorizzati a trasferire zone dns (AXFR).', + ], + 'customerssl_directory' => [ + 'title' => 'Cartella dei certificati ssl clienti del Webserver', + 'description' => 'Dove devono esssere creati i certificati ssl cliente?

NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.
', + ], + 'allow_error_report_admin' => [ + 'title' => 'Permetti agli amministratori/rivenditori di inviare errori di database a Froxlor', + 'description' => 'Attenzione: Non inviarci MAI dati personali (dei clienti)!', + ], + 'allow_error_report_customer' => [ + 'title' => 'Permetti ai clienti di inviare errori di database a Froxlor', + 'description' => 'Attenzione: Non inviarci MAI dati personali (dei clienti)!', + ], + 'mailtraffic_enabled' => [ + 'title' => 'Analizza traffico posta', + 'description' => 'Abilita l\\\'analisi dei log del server di posta per calcolare il traffico', + ], + 'mdaserver' => [ + 'title' => 'tipo MDA', + 'description' => 'Tipo del Server di consegna di posta', + ], + 'mdalog' => [ + 'title' => 'log MDA', + 'description' => 'File log del Server di consegna di posta', + ], + 'mtaserver' => [ + 'title' => 'tipo MTA', + 'description' => 'Tipo agente di trasferimento di posta', + ], + 'mtalog' => [ + 'title' => 'log MTA', + 'description' => 'File log dell\\\'agente di trasferimento di posta', + ], + 'system_cronconfig' => [ + 'title' => 'File di configurazione Cron', + 'description' => 'Percorso al file di configurazione del servizio cron. Questo file verrà aggiornato regolarmente ed automaticamente da froxlor.
+Nota: Perfavore sii sicuro di usare lo stesso nome di file come per il cronjob principale di froxlor (predefinito: /etc/cron.d/froxlor)!

Se usi FreeBSD, qui specifica: /etc/crontab!', + ], + 'system_crondreload' => [ + 'title' => 'Commando per riavviare il servizio Cron', + 'description' => 'Specifica il commando da eseguire per riavviare il servizio cron del tuo sistema', + ], + 'system_croncmdline' => [ + 'title' => 'Commando di esecuzione Cron (binario php)', + 'description' => 'Commando per eseguire i nostri cronjob. Modificalo soltanto se sai cosa stai facendo (predefinito: "/usr/bin/nice -n 5 /usr/bin/php -q")!', + ], + 'system_cron_allowautoupdate' => [ + 'title' => 'Permetti aggiornamenti automatici del database', + 'description' => '
ATTENZIONE:
Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.

l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione
', + ], + 'dns_createhostnameentry' => 'Crea la zone/config di bind per il nome host del sistema', + 'panel_password_alpha_lower' => [ + 'title' => 'Caratteri minuscoli', + 'description' => 'La Password deve contenere almeno una lettera minuscola (a-z).', + ], + 'panel_password_alpha_upper' => [ + 'title' => 'Caratteri maiuscoli', + 'description' => 'La Password deve contenere almeno una lettere maiuscola (A-Z).', + ], + 'panel_password_numeric' => [ + 'title' => 'Numeri', + 'description' => 'La Password deve contenere almeno un numero (0-9).', + ], + 'panel_password_special_char_required' => [ + 'title' => 'Caratteri speciali', + 'description' => 'La Password deve contenere almeno uno dei caratteri speciali definiti nel campo sottostante.', + ], + 'panel_password_special_char' => [ + 'title' => 'Lista dei caratteri speciali', + 'description' => 'Uno di questi caratteri è richiesto se è attivata l\'opzione soprastante.', + ], + ], + 'spf' => [ + 'use_spf' => 'Attiva SPF per i domini?', + 'spf_entry' => 'Impostazioni SPF per tutti i domini', + ], + 'success' => [ + 'messages_success' => 'Inviato correttamente il messaggio a %s recipients', + 'success' => 'Informazioni', + 'clickheretocontinue' => 'Clicca qui per continuare', + 'settingssaved' => 'Le impostazioni sono state salvate con successo.', + 'rebuildingconfigs' => 'Inseriti con successo i lavori per la ricostruzione del file di configurazione', + 'domain_import_successfully' => 'Importato %s dominii con successo.', + ], + 'tasks' => [ + 'outstanding_tasks' => 'Processi Cron in sospeso', + 'REBUILD_VHOST' => 'Ricostruzione della configurazione del webserver', + 'CREATE_HOME' => 'Aggiunto il nuovo cliente %loginname%', + 'REBUILD_DNS' => 'Ricostruzione della configurazione di bind', + 'CREATE_FTP' => 'Creazione delle cartelle per i nuovi utenti ftp', + 'DELETE_CUSTOMER_FILES' => 'Eliminazione dei file del cliente %loginname%', + 'noneoutstanding' => 'Attualmente non ci sono processi in sospeso per Froxlor', + 'CREATE_QUOTA' => 'Setta quota al filesystem', + 'DELETE_EMAIL_DATA' => 'Elimina i dati di posta elettronica del cliente.', + 'DELETE_FTP_DATA' => 'Elimina i dati account-ftp del cliente.', + 'REBUILD_CRON' => 'Ricostruisci il file cron.d', + ], + 'traffic' => [ + 'month' => 'Mese', + 'day' => 'Giorno', + 'months' => [ + 1 => 'Gennaio', + 2 => 'Febbraio', + 3 => 'Marzo', + 4 => 'Aprile', + 5 => 'Maggio', + 6 => 'Giugno', + 7 => 'Luglio', + 8 => 'Agosto', + 9 => 'Settembre', + 10 => 'Ottobre', + 11 => 'Novembre', + 12 => 'Dicembre', + 'jan' => 'Gen', + 'feb' => 'Feb', + 'mar' => 'Mar', + 'apr' => 'Apr', + 'may' => 'Mag', + 'jun' => 'Giu', + 'jul' => 'Lug', + 'aug' => 'Ago', + 'sep' => 'Set', + 'oct' => 'Ott', + 'nov' => 'Nov', + 'dec' => 'Dic', + 'total' => 'Totale', + ], + 'mb' => 'Traffico (MB)', + 'distribution' => 'FTP | HTTP | Mail', + 'sumhttp' => 'Sommatoria Traffico in ingresso HTTP', + 'sumftp' => 'Sommatoria Traffico in ingresso FTP', + 'summail' => 'Sommatoria Traffico in ingresso Mail', + 'customer' => 'Cliente', + 'domain' => 'Domini', + 'trafficoverview' => 'Riepilogo del traffico di', + 'details' => 'Dettagli', + 'http' => 'HTTP (MiB)', + 'ftp' => 'FTP (MiB)', + 'mail' => 'Mail (MiB)', + ], + 'translator' => 'Luca Longinotti, Luca Piona, Emilien, Christian Munari', + 'update' => [ + 'updateinprogress_onlyadmincanlogin' => 'Una nuova versione di Froxlor è stata installata ma non ancora impostata.
Solo l\'amministratore può accedere e completare l\'aggiornamento.', + 'update' => 'Aggiorna Froxlor', + 'proceed' => 'Procedi', + 'update_information' => [ + 'part_a' => 'I file di Froxlor sono stati aggiornati alla versione %newversion. La versione installata è %curversion.', + 'part_b' => '

I clienti non potranno accedere fino a quando l\'aggiornamento non sarà completato.
Procedere?', + ], + 'noupdatesavail' => 'È già presente l\'ultima versione di Froxlor.', + ], + 'usersettings' => [ + 'custom_notes' => [ + 'title' => 'Note personali', + 'description' => 'Sentiti libero di inserire qualsi nota vuoi o necessiti qui. Apparirano nel riepilogo dell\'amministratore/cliente perl \'utente corrispondente.', + 'show' => 'Mostra le tue note nel cruscotto dell\'utente', + ], + ], +]; diff --git a/lng/italian.lng.php b/lng/italian.lng.php deleted file mode 100644 index f90f3b53..00000000 --- a/lng/italian.lng.php +++ /dev/null @@ -1,1665 +0,0 @@ - - * @author Luca Longinotti - * @author Emilien - * @author Froxlor Team - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Global - */ -$lng['translator'] = 'Luca Longinotti, Luca Piona, Emilien, Christian Munari'; -$lng['panel']['edit'] = 'Modifica'; -$lng['panel']['delete'] = 'Cancella'; -$lng['panel']['create'] = 'Crea'; -$lng['panel']['save'] = 'Salva'; -$lng['panel']['yes'] = 'Si'; -$lng['panel']['no'] = 'No'; -$lng['panel']['emptyfornochanges'] = 'lasciare vuoto se non si vuole cambiare'; -$lng['panel']['emptyfordefault'] = 'lasciare vuoto per l\'impostazione di default'; -$lng['panel']['path'] = 'Percorso'; -$lng['panel']['toggle'] = 'Cambia'; -$lng['panel']['next'] = 'Prossimo'; -$lng['panel']['dirsmissing'] = 'La cartella fornita non è stata trovata.'; - -/** - * Login - */ - -$lng['login']['username'] = 'Nome Utente'; -$lng['login']['password'] = 'Password'; -$lng['login']['language'] = 'Lingua'; -$lng['login']['login'] = 'Login'; -$lng['login']['logout'] = 'Logout'; -$lng['login']['profile_lng'] = 'Scegli la lingua'; - -/** - * Customer - */ - -$lng['customer']['documentroot'] = 'Cartella Principale'; -$lng['customer']['name'] = 'Cognome'; -$lng['customer']['firstname'] = 'Nome'; -$lng['customer']['company'] = 'Ditta'; -$lng['customer']['street'] = 'Via'; -$lng['customer']['zipcode'] = 'CAP'; -$lng['customer']['city'] = 'Città'; -$lng['customer']['phone'] = 'Telefono'; -$lng['customer']['fax'] = 'Fax'; -$lng['customer']['email'] = 'Email'; -$lng['customer']['customernumber'] = 'ID Cliente'; -$lng['customer']['diskspace'] = 'Spazio Web (MB)'; -$lng['customer']['traffic'] = 'Traffico (GB)'; -$lng['customer']['mysqls'] = 'Database MySQL'; -$lng['customer']['emails'] = 'Indirizzi Email'; -$lng['customer']['accounts'] = 'Account Email'; -$lng['customer']['forwarders'] = 'Reindirizzamenti Email'; -$lng['customer']['ftps'] = 'Account FTP'; -$lng['customer']['subdomains'] = 'Sottodomini'; -$lng['customer']['domains'] = 'Domini'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Principale'; -$lng['menue']['main']['changepassword'] = 'Cambia la password'; -$lng['menue']['main']['changelanguage'] = 'Cambia la lingua'; -$lng['menue']['email']['email'] = 'Email'; -$lng['menue']['email']['emails'] = 'Indirizzi'; -$lng['menue']['email']['webmail'] = 'WebMail'; -$lng['menue']['mysql']['mysql'] = 'MySQL'; -$lng['menue']['mysql']['databases'] = 'Database'; -$lng['menue']['mysql']['phpmyadmin'] = 'phpMyAdmin'; -$lng['menue']['domains']['domains'] = 'Domini'; -$lng['menue']['domains']['settings'] = 'Opzioni'; -$lng['menue']['ftp']['ftp'] = 'FTP'; -$lng['menue']['ftp']['accounts'] = 'Account'; -$lng['menue']['ftp']['webftp'] = 'WebFTP'; -$lng['menue']['extras']['extras'] = 'Extra'; -$lng['menue']['extras']['directoryprotection'] = 'Cartelle Protette'; -$lng['menue']['extras']['pathoptions'] = 'Opzioni Cartelle'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Dettagli Cliente'; -$lng['index']['accountdetails'] = 'Dettagli Account'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Vecchia password'; -$lng['changepassword']['new_password'] = 'Nuova password'; -$lng['changepassword']['new_password_confirm'] = 'Nuova password (verifica)'; -$lng['changepassword']['new_password_ifnotempty'] = 'Nuova password (vuota = non cambia)'; -$lng['changepassword']['also_change_ftp'] = ' cambia la password dell\'account FTP principale?'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Qui puoi creare (sotto)domini e cambiare il loro percorso.
Il sistema, dopo ogni cambiamento, necessita di un po\' di tempo per applicare le nuove impostazioni.'; -$lng['domains']['domainsettings'] = 'Opzioni del dominio'; -$lng['domains']['domainname'] = 'Nome del dominio'; -$lng['domains']['subdomain_add'] = 'Crea sottodominio'; -$lng['domains']['subdomain_edit'] = 'Modifica il (sotto)dominio'; -$lng['domains']['wildcarddomain'] = 'Crea una wildcarddomain?'; -$lng['domains']['aliasdomain'] = 'Alias per questo dominio'; -$lng['domains']['noaliasdomain'] = 'Nessun alias per il dominio'; - -/** - * E-mails - */ - -$lng['emails']['description'] = 'Qui puoi creare e cambiare i tuoi indirizzi Email.
Un account è come la bucalettere davanti a casa tua. Se qualcuno ti manda un\'Email, essa sarà recapitata all\'interno del tuo account.

Per scaricare le tue Email usa le seguenti impostazioni nel tuo programma di posta elettronica: (I dati scritti in corsivo vanno cambiati con i tuoi!)
Hostname: Nome del dominio
Username: Nome dell\'account / Indirizzo Email
Password: La password scelta'; -$lng['emails']['emailaddress'] = 'Indirizzo Email'; -$lng['emails']['emails_add'] = 'Crea indirizzo Email'; -$lng['emails']['emails_edit'] = 'Modifica indirizzo Email'; -$lng['emails']['catchall'] = 'Catch-all'; -$lng['emails']['iscatchall'] = 'Definisci come indirizzo catch-all?'; -$lng['emails']['account'] = 'Account'; -$lng['emails']['account_add'] = 'Crea account'; -$lng['emails']['account_delete'] = 'Cancella account'; -$lng['emails']['from'] = 'Da'; -$lng['emails']['to'] = 'Per'; -$lng['emails']['forwarders'] = 'Reindirizzamenti'; -$lng['emails']['forwarder_add'] = 'Crea reindirizzamento'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Qui puoi creare e modificare i tuoi account FTP.
I cambiamenti sono effettuati in tempo reale e gli account si possono usare immediatamente.'; -$lng['ftp']['account_add'] = 'Crea account'; - -/** - * MySQL - */ - -// $lng['mysql']['description'] = 'Qui puoi creare e modificare i tuoi database MySQL.
I cambiamenti sono effettuati in tempo reale e i databases si possono usare immediatamente.
Nel menù di sinistra trovi il tool phpMyAdmin con il quale potrai comodamente amministrare i tuoi databases attraverso il tuo web-browser.

Per utilizzare i database nei vostri script PHP, utilizzate le seguenti impostazioni: (I dati scritti in corsivo vanno cambiati con i tuoi!)
Hostname:
Username: L\'username scelto
Password: La password scelta per quell\'username
Database: Nome del database'; -$lng['mysql']['description'] = 'Qui puoi creare e modificare il tuo database MySQL
Le modifiche sono istantanee e puoi usare subito il database.
Nel menù a sinistra trovi phpMyAdmin con cui puoi amministrare il tuo database.

Per usare i database nei tuoi script php usa le seguenti impostazioni: (Le parole in corsivo devono essere modificate con quello che hai scritto!)
Hostname:
Utente: Nome database
Password: La password che hai scelto
Database: Nome database'; -$lng['mysql']['databasename'] = 'Nome database'; -$lng['mysql']['databasedescription'] = 'Descrizione database'; -$lng['mysql']['database_create'] = 'Crea database'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Qui puoi aggiungere alcune opzioni extra, per esempio impostare delle cartelle protette.
Il sistema, dopo ogni cambiamento, necessita di un po\' di tempo per applicare le nuove impostazioni.'; -$lng['extras']['directoryprotection_add'] = 'Aggiungi protezione cartella'; -$lng['extras']['view_directory'] = 'Mostra protezione cartella'; -$lng['extras']['pathoptions_add'] = 'Aggiungi opzioni cartella'; -$lng['extras']['directory_browsing'] = 'Visualizza file e cartelle'; -$lng['extras']['pathoptions_edit'] = 'Modifica opzioni cartella'; -$lng['extras']['errordocument404path'] = 'URL to ErrorDocument 404'; -$lng['extras']['errordocument403path'] = 'URL to ErrorDocument 403'; -$lng['extras']['errordocument500path'] = 'URL to ErrorDocument 500'; -$lng['extras']['errordocument401path'] = 'URL to ErrorDocument 401'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Errore'; -$lng['error']['directorymustexist'] = 'La cartella %s deve esistere. Per favore creala tramite il tuo client FTP.'; -$lng['error']['filemustexist'] = 'Il file %s deve esistere.'; -$lng['error']['allresourcesused'] = 'Hai già usato tutte le tue risorse.'; -$lng['error']['domains_cantdeletemaindomain'] = 'Non puoi cancellare un dominio usato come dominio Email.'; -$lng['error']['domains_canteditdomain'] = 'Non puoi modificare questo dominio. La funzione è stata disabilitata dall\'admin.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'Non puoi cancellare un dominio usato come dominio Email. Cancella prima tutti gli indirizzi Email che lo utilizzano.'; -$lng['error']['firstdeleteallsubdomains'] = 'Prima di creare un dominio wildcard, cancella tutti i sottodomini presenti per quel dominio.'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'Hai già definito un catchall per questo dominio.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'Non puoi cancellare il tuo account FTP principale.'; -$lng['error']['login'] = 'Il nome utente o la password da te immessi sono incorretti. Per favore riprova!'; -$lng['error']['login_blocked'] = 'Questo account è stato sospeso per i troppi tentativi di login falliti.
Riprovi tra %s secondi.'; -$lng['error']['notallreqfieldsorerrors'] = 'Alcuni campi sono stati lasciati vuoti o sono stati riempiti incorrettamente.'; -$lng['error']['oldpasswordnotcorrect'] = 'La vecchia password non è corretta.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'Non puoi assegnare più risorse di quante ne possieda tu stesso.'; -$lng['error']['mustbeurl'] = 'Non hai inserito un\'indirizzo valido o completo (per es. http://qualchedominio.com/errore404.htm).'; -$lng['error']['invalidpath'] = 'Non hai scelto un\'indirizzo valido.'; -$lng['error']['stringisempty'] = 'Manca il dato nel campo.'; -$lng['error']['stringiswrong'] = 'Dato incorretto.'; -$lng['error']['newpasswordconfirmerror'] = 'La nuova password non corrisponde a quella vecchia.'; -$lng['error']['mydomain'] = '\'Dominio\''; -$lng['error']['mydocumentroot'] = '\'Documentroot\''; -$lng['error']['loginnameexists'] = 'Il login %s esiste già.'; -$lng['error']['emailiswrong'] = 'L\'indirizzo Email %s contiene caratteri invalidi o è incompleto.'; -$lng['error']['loginnameiswrong'] = 'Il login %s contiene caratteri invalidi.'; -$lng['error']['userpathcombinationdupe'] = 'La combinazione tra nome utente e percorso esiste già.'; -$lng['error']['patherror'] = 'Errore! Il percorso non può essere vuoto.'; -$lng['error']['errordocpathdupe'] = 'Le opzioni per la cartella %s esistono già.'; -$lng['error']['adduserfirst'] = 'Per favore crea prima un utente ...'; -$lng['error']['domainalreadyexists'] = 'Il dominio %s è già assegnato ad un cliente.'; -$lng['error']['nolanguageselect'] = 'Nessuna lingua selezionata.'; -$lng['error']['nosubjectcreate'] = 'Devi definire un titolo per questo template Email.'; -$lng['error']['nomailbodycreate'] = 'Devi definiro un testo per questo template Email.'; -$lng['error']['templatenotfound'] = 'Il template non è stato trovato.'; -$lng['error']['alltemplatesdefined'] = 'Non puoi definire altri template, tutte le lingue sono già definite.'; -$lng['error']['wwwnotallowed'] = 'www non è ammesso come sottodominio.'; -$lng['error']['subdomainiswrong'] = 'Il sottodominio %s contiene caratteri invalidi.'; -$lng['error']['domaincantbeempty'] = 'Il nome dominio non può essere vuoto.'; -$lng['error']['domainexistalready'] = 'Il dominio %s esiste già.'; -$lng['error']['domainisaliasorothercustomer'] = 'Il dominio alias selezionato è a sua volta un dominio alias o appartiene ad un altro cliente.'; -$lng['error']['emailexistalready'] = 'L\'indirizzo Email %s esiste già.'; -$lng['error']['maindomainnonexist'] = 'Il dominio principale %s non esiste.'; -$lng['error']['destinationnonexist'] = 'Per favore crea il tuo reindirizzamento nel campo \'Destinazione\'.'; -$lng['error']['destinationalreadyexistasmail'] = 'Il reindirizzamento a %s esiste già come indirizzo Email attivo.'; -$lng['error']['destinationalreadyexist'] = 'Hai già definito un reindirizzamento per %s .'; -$lng['error']['destinationiswrong'] = 'Il reindirizzamento %s contiene caratteri invalidi o è incompleto.'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Domanda di sicurezza'; -$lng['question']['admin_customer_reallydelete'] = 'Sei sicuro di voler cancellare il cliente %s? Quest\'azione non potrà essere annullata!'; -$lng['question']['admin_domain_reallydelete'] = 'Sei sicuro di voler cancellare il dominio %s?'; -$lng['question']['admin_domain_reallydisablesecuritysetting'] = 'Sei sicuro di voler disattivare queste opzioni di sicurezza (OpenBasedir)?'; -$lng['question']['admin_admin_reallydelete'] = 'Sei sicuro di voler cancellare l\'admin %s? Tutti i clienti e i domini saranno affidati all\'amministratore principale.'; -$lng['question']['admin_template_reallydelete'] = 'Sei sicuro di voler cancellare il template \'%s\'?'; -$lng['question']['domains_reallydelete'] = 'Sei sicuro di voler cancellare il dominio %s?'; -$lng['question']['email_reallydelete'] = 'Sei sicuro di voler cancellare l\'indirizzo Email %s?'; -$lng['question']['email_reallydelete_account'] = 'Sei sicuro di voler cancellare l\'account Email di %s?'; -$lng['question']['email_reallydelete_forwarder'] = 'Sei sicuro di voler cancellare il reindirizzamento a %s?'; -$lng['question']['extras_reallydelete'] = 'Sei sicuro di voler cancellare la protezione per la cartella %s?'; -$lng['question']['extras_reallydelete_pathoptions'] = 'Sei sicuro di voler cancellare le opzioni cartella per %s?'; -$lng['question']['ftp_reallydelete'] = 'Sei sicuro di voler cancellare l\'account FTP %s?'; -$lng['question']['mysql_reallydelete'] = 'Sei sicuro di voler cancellare il database %s? Quest\'azione non potrà essere annullata!'; -$lng['question']['admin_configs_reallyrebuild'] = 'Sei sicuro di voler rigenerare i file di configurazione per Apache e Bind?'; -$lng['question']['admin_customer_alsoremovefiles'] = 'Cancellare anche i file dell\'utente?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['mailbody'] = 'Salve,\n\nil tuo indirizzo Email {EMAIL}\nè stato configurato con successo.\n\nQuesta è un\'Email creata automaticamente,\n per favore non rispondere!\n\nCordiali saluti, Amministratore.'; -$lng['mails']['pop_success']['subject'] = 'Indirizzo Email configurato con successo'; -$lng['mails']['createcustomer']['mailbody'] = 'Salve {FIRSTNAME} {NAME},\n\nqueste sono le informazioni per il tuo account:\n\nNome Utente: {USERNAME}\nPassword: {PASSWORD}\n\nGrazie,\nAmministratore.'; -$lng['mails']['createcustomer']['subject'] = 'Informazioni account'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Generale'; -$lng['admin']['ressourcedetails'] = 'Risorse utilizzate'; -$lng['admin']['systemdetails'] = 'Dettagli sistema'; -$lng['admin']['froxlordetails'] = 'Dettagli Froxlor'; -$lng['admin']['installedversion'] = 'Versione installata'; -$lng['admin']['latestversion'] = 'Ultima versione disponibile'; -$lng['admin']['lookfornewversion']['clickhere'] = 'Cerca sul web'; -$lng['admin']['lookfornewversion']['error'] = 'Errore durante la lettura'; -$lng['admin']['resources'] = 'Risorse'; -$lng['admin']['customer'] = 'Cliente'; -$lng['admin']['customers'] = 'Clienti'; -$lng['admin']['customer_add'] = 'Crea cliente'; -$lng['admin']['customer_edit'] = 'Modifica cliente'; -$lng['admin']['domains'] = 'Domini'; -$lng['admin']['domain_add'] = 'Crea dominio'; -$lng['admin']['domain_edit'] = 'Modifica dominio'; -$lng['admin']['subdomainforemail'] = 'Sottodominio utilizzabile come dominio Email'; -$lng['admin']['admin'] = 'Admin'; -$lng['admin']['admins'] = 'Admin'; -$lng['admin']['admin_add'] = 'Crea admin'; -$lng['admin']['admin_edit'] = 'Modifica admin'; -$lng['admin']['customers_see_all'] = 'Può vedere tutti i clienti?'; -$lng['admin']['domains_see_all'] = 'Può vedere tutti i domini?'; -$lng['admin']['change_serversettings'] = 'Può cambiare le impostazioni del server?'; -$lng['admin']['server'] = 'Sistema'; -$lng['admin']['serversettings'] = 'Opzioni'; -$lng['admin']['rebuildconf'] = 'Rigenera configurazione'; -$lng['admin']['stdsubdomain'] = 'Sottodominio standard'; -$lng['admin']['stdsubdomain_add'] = 'Crea sottodominio standard'; -$lng['admin']['phpenabled'] = 'PHP abilitato'; -$lng['admin']['deactivated'] = 'Disattiva'; -$lng['admin']['deactivated_user'] = 'Disattiva utente'; -$lng['admin']['sendpassword'] = 'Invia password'; -$lng['admin']['ownvhostsettings'] = 'Impostazioni vHost speciali'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Configurazione servizi'; -$lng['admin']['templates']['templates'] = 'Template'; -$lng['admin']['templates']['template_add'] = 'Aggiungi template'; -$lng['admin']['templates']['template_edit'] = 'Modifica template'; -$lng['admin']['templates']['action'] = 'Azione'; -$lng['admin']['templates']['email'] = 'Email'; -$lng['admin']['templates']['subject'] = 'Soggetto:'; -$lng['admin']['templates']['mailbody'] = 'Testo dell\'Email'; -$lng['admin']['templates']['createcustomer'] = 'Email di benvenuto per i nuovi clienti'; -$lng['admin']['templates']['pop_success'] = 'Benvenuto per ogni nuovo account Email'; -$lng['admin']['templates']['template_replace_vars'] = 'Variabili da cambiare nel template:'; -$lng['admin']['templates']['FIRSTNAME'] = 'Rimpiazzato con il nome del cliente.'; -$lng['admin']['templates']['NAME'] = 'Rimpiazzato con il cognome del cliente.'; -$lng['admin']['templates']['USERNAME'] = 'Rimpiazzato con il nome utente dell\'account.'; -$lng['admin']['templates']['PASSWORD'] = 'Rimpiazzato con la password dell\'account.'; -$lng['admin']['templates']['EMAIL'] = 'Rimapiazzato con l\'indirizzo dell\'account.'; -$lng['admin']['webserver'] = 'Webserver'; - -/** - * Serversettings - */ - -$lng['serversettings']['session_timeout']['title'] = 'Timeout della sessione'; -$lng['serversettings']['session_timeout']['description'] = 'Quanto tempo un utente deve rimanere inattivo prima che la sessione diventi invalida (secondi)?'; -$lng['serversettings']['accountprefix']['title'] = 'Prefisso Cliente'; -$lng['serversettings']['accountprefix']['description'] = 'Che prefisso dovrebbero avere gli account dei clienti?'; -$lng['serversettings']['mysqlprefix']['title'] = 'Prefisso SQL'; -$lng['serversettings']['mysqlprefix']['description'] = 'Che prefisso dovrebbero avere i database SQL?'; -$lng['serversettings']['ftpprefix']['title'] = 'Prefisso FTP'; -$lng['serversettings']['ftpprefix']['description'] = 'Che prefisso vuoi che per gli account ftp?
Se si modifica questo devi anche modificare il limite (Quota) della query SQL nel file di configurazione del server FTP nel caso in cui venga usata! '; -$lng['serversettings']['documentroot_prefix']['title'] = 'Cartella dati web'; -$lng['serversettings']['documentroot_prefix']['description'] = 'Dove devono essere immagazzinati tutti i dati web?'; -$lng['serversettings']['logfiles_directory']['title'] = 'Cartella logfiles'; -$lng['serversettings']['logfiles_directory']['description'] = 'Dove devono essere immagazzinati tutti i log?'; -$lng['serversettings']['ipaddress']['title'] = 'Indirizzo IP'; -$lng['serversettings']['ipaddress']['description'] = 'Qual\'è l\'indirizzo IP di questo server?'; -$lng['serversettings']['hostname']['title'] = 'Hostname'; -$lng['serversettings']['hostname']['description'] = 'QUal\'è l\'hostname di questo server?'; -$lng['serversettings']['apachereload_command']['title'] = 'Comando riavvio Apache'; -$lng['serversettings']['apachereload_command']['description'] = 'Qual\'è il comando per riavviare Apache?'; -$lng['serversettings']['bindconf_directory']['title'] = 'Cartella configurazione Bind'; -$lng['serversettings']['bindconf_directory']['description'] = 'Dove sono i file di configurazione per Bind?'; -$lng['serversettings']['bindreload_command']['title'] = 'Comando riavvio Bind'; -$lng['serversettings']['bindreload_command']['description'] = 'Qual\'è il comando per riavviare Bind?'; -$lng['serversettings']['vmail_uid']['title'] = 'UID Email'; -$lng['serversettings']['vmail_uid']['description'] = 'Che UserID dovrebbe avere l\'utente che gestisce le Email?'; -$lng['serversettings']['vmail_gid']['title'] = 'GID Email'; -$lng['serversettings']['vmail_gid']['description'] = 'Che GroupID dovrebbe avere l\'utente che gestisce le Email?'; -$lng['serversettings']['vmail_homedir']['title'] = 'Cartella Email'; -$lng['serversettings']['vmail_homedir']['description'] = 'Dove devono essere immagazzinate tutte le Email?'; -$lng['serversettings']['adminmail']['title'] = 'Mittente'; -$lng['serversettings']['adminmail']['description'] = 'Qual\'è l\'indirizzo del mittente delle Email provenienti dal pannello?'; -$lng['serversettings']['phpmyadmin_url']['title'] = 'URL phpMyAdmin'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'Qual\'è l\'URL di phpMyAdmin? (deve cominciare per http://)'; -$lng['serversettings']['webmail_url']['title'] = 'URL WebMail'; -$lng['serversettings']['webmail_url']['description'] = 'Qual\'è l\'URL della WebMail? (deve cominciare per http://)'; -$lng['serversettings']['webftp_url']['title'] = 'URL WebFTP'; -$lng['serversettings']['webftp_url']['description'] = 'Qual\'è l\'URL del WebFTP? (deve cominciare per http://)'; -$lng['serversettings']['language']['description'] = 'Qual\'è la lingua standard del tuo server?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Numero massimo tentativi login'; -$lng['serversettings']['maxloginattempts']['description'] = 'Numero massimo di tentativi di login prima che l\'account sia disattivato.'; -$lng['serversettings']['deactivatetime']['title'] = 'Durata disattivamento'; -$lng['serversettings']['deactivatetime']['description'] = 'Tempo (sec.) di disattivazione dell\'account dopo troppi tentativi di login.'; -$lng['serversettings']['pathedit']['title'] = 'Modalità di scelta percorsi/cartelle'; -$lng['serversettings']['pathedit']['description'] = 'Un percorso/cartella andrà scelto attraverso un menu a tendina o inserendolo a mano?'; -$lng['serversettings']['nameservers']['title'] = 'Nameservers'; -$lng['serversettings']['nameservers']['description'] = 'Lista degli hostname (separati dalla virgola) di tutti i nameserver. Il primo della lista sarà il impostato come primario.'; -$lng['serversettings']['mxservers']['title'] = 'MX servers'; -$lng['serversettings']['mxservers']['description'] = 'Lista dei server mx (separati dalla virgola) numero spazio hostname (es. \'10 mx.example.com\').'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['serversettings']['paging']['title'] = 'Elementi da visualizzare per pagina'; -$lng['serversettings']['paging']['description'] = 'Quanti elementi dovrebbero essere visualizzati su una pagina? (0 = disattiva impaginazione)'; -$lng['error']['ipstillhasdomains'] = 'La combinazione IP/Porta che vuoi eliminare ha ancora dei domini assegnati, per favore riassegna questi domini ad altre combinazioni IP/Porta prima di eliminare questa.'; -$lng['error']['cantdeletedefaultip'] = 'Non puoi eliminare la combinazione IP/Porta default dei rivenditori, per favore imposta un\'altra combinazione IP/Porta come default dei rivenditori prima di eliminare questa.'; -$lng['error']['cantdeletesystemip'] = 'Non puoi eliminare l\'ultima IP di sistema, crea un\'altra combinazione IP/Porta per l\'IP di sistema o cambia l\'IP di sistema.'; -$lng['error']['myipaddress'] = '\'IP\''; -$lng['error']['myport'] = '\'Porta\''; -$lng['error']['myipdefault'] = 'Devi selezionare una combinazione IP/Porta che diventerà default.'; -$lng['error']['myipnotdouble'] = 'Questa combinazione IP/Porta esiste già.'; -// $lng['error']['admin_domain_emailsystemhostname'] = 'Non puoi usare l\'hostname del server come dominio email'; -// $lng['error']['admin_domain_emailsystemhostname'] = 'L\'hostname del server non può essere utilizzato come dominio email.'; -$lng['error']['admin_domain_emailsystemhostname'] = 'Spiacente, l\'hostname di sistema non può essere usato come dominio di un cliente'; -$lng['question']['admin_ip_reallydelete'] = 'Vuoi veramente eliminare l\'indirizzo IP %s?'; -$lng['admin']['ipsandports']['ipsandports'] = 'IP e Porte'; -$lng['admin']['ipsandports']['add'] = 'Aggiungi IP/Porta'; -$lng['admin']['ipsandports']['edit'] = 'Modifica IP/Porta'; -$lng['admin']['ipsandports']['ipandport'] = 'IP/Porta'; -$lng['admin']['ipsandports']['ip'] = 'IP'; -$lng['admin']['ipsandports']['port'] = 'Porta'; - -// ADDED IN 1.2.13-rc3 - -$lng['error']['cantchangesystemip'] = 'Non puoi cambiare l\'ultima IP di sistema, crea un\'altra combinazione IP/Porta per l\'IP di sistema o cambia l\'IP di sistema.'; -$lng['question']['admin_domain_reallydocrootoutofcustomerroot'] = 'Sei sicuro di volere la cartella base dei dati web di questo dominio al di fuori della cartella base del cliente?'; - -// ADDED IN 1.2.14-rc1 - -$lng['admin']['memorylimitdisabled'] = 'Disabilitato'; -$lng['error']['loginnameissystemaccount'] = 'Non puoi creare account che siano analoghi a quelli di sistema (per esempio quelli che iniziano con "%s"). Digita un\'altro nome account.'; -$lng['domain']['openbasedirpath'] = 'Percorso OpenBasedir'; -$lng['domain']['docroot'] = 'Percorso del campo sopra'; -$lng['domain']['homedir'] = 'Cartella Home'; -$lng['admin']['valuemandatory'] = 'Questo valore è obbligatorio'; -$lng['admin']['valuemandatorycompany'] = 'O i campi "nome" e "cognome" O il capo "compagnia" devono essere riempiti'; -$lng['menue']['main']['username'] = 'Utente: '; -$lng['panel']['urloverridespath'] = 'URL (sovrascrive il percorso)'; -$lng['panel']['pathorurl'] = 'Percorso o URL'; -$lng['error']['sessiontimeoutiswrong'] = '"Timeout Sessione" deve essere un numero.'; -$lng['error']['maxloginattemptsiswrong'] = '"Numero Massimo Tentativi Login" deve essere un numero.'; -$lng['error']['deactivatetimiswrong'] = '"Durata Disattivamento" deve essere un numero.'; -$lng['error']['accountprefixiswrong'] = '&quopt;Prefisso Utente" incorretto.'; -$lng['error']['mysqlprefixiswrong'] = '&quopt;Prefisso SQL" incorretto.'; -$lng['error']['ftpprefixiswrong'] = '&quopt;Prefisso FTP" incorretto.'; -$lng['error']['ipiswrong'] = '"Indirizzo IP" incorretto. È permesso solo un indirizzo IP valido.'; -$lng['error']['vmailuidiswrong'] = '"UID Email" incorretto. È permessa solo una UID numerica.'; -$lng['error']['vmailgidiswrong'] = '"GID Email" incorretto. È permessa solo una GID numerica.'; -$lng['error']['adminmailiswrong'] = '"Mittente" incorretto. È permesso solo un indirizzo Email valido.'; -$lng['error']['pagingiswrong'] = 'Valore degli "Elementi da visualizzare per pagina" incorretto. Sono permessi solo numeri.'; -$lng['error']['phpmyadminiswrong'] = 'Il link a phpMyAdmin è invalido.'; -$lng['error']['webmailiswrong'] = 'Il link alla WebMail è invalido.'; -$lng['error']['webftpiswrong'] = 'Il link al WebFTP è invalido.'; -$lng['domains']['hasaliasdomains'] = 'Ha domini alias'; -$lng['serversettings']['defaultip']['title'] = 'IP/Porta default'; -$lng['serversettings']['defaultip']['description'] = 'Qual\'è la combinazione IP/Porta default?'; -$lng['domains']['statstics'] = 'Statistiche d\'utilizzo'; -$lng['panel']['ascending'] = 'ascendente'; -$lng['panel']['descending'] = 'discendente'; -$lng['panel']['search'] = 'Cerca'; -$lng['panel']['used'] = 'utilizzato'; - -// ADDED IN 1.2.14-rc3 - -$lng['panel']['translator'] = 'Traduttore'; - -// ADDED IN 1.2.14-rc4 - -$lng['error']['stringformaterror'] = 'Il valore per il campo "%s" non è nel formato atteso.'; - -// ADDED IN 1.2.15-rc1 -// Translated by marone42@googlemail.com on 03/15/2007 - -$lng['admin']['phpversion'] = 'Versione PHP'; -$lng['admin']['mysqlserverversion'] = 'Versione MySQL Server'; -$lng['admin']['webserverinterface'] = 'Interfaccia Webserver'; -$lng['domains']['isassigneddomain'] = 'È dominio assegnato'; -$lng['serversettings']['phpappendopenbasedir']['title'] = 'Percoso da aggiungere a OpenBasedir'; -$lng['serversettings']['phpappendopenbasedir']['description'] = 'Questi percorsi (separati da colonne) verranno aggiunti allo statement OpenBasedir in ognuno vhost-container.'; - -// CHANGED IN 1.2.15-rc1 - -$lng['error']['youcantdeleteyourself'] = 'Non puoi cancellare te stesso per motivi di sicurezza.'; -$lng['error']['youcanteditallfieldsofyourself'] = 'Nota: non puoi modificare tutti i campi del tuo account per motivi di sicurezza.'; - -// ADDED IN 1.2.16-svn1 - -$lng['serversettings']['natsorting']['title'] = 'Usa l\'ordinamento naturale in vista elenco'; -$lng['serversettings']['natsorting']['description'] = 'Disponi la lista come web1 -> web2 -> web11 al posto di web1 -> web11 -> web2.'; - -// ADDED IN 1.2.16-svn2 - -$lng['serversettings']['deactivateddocroot']['title'] = 'Docroot per gli utenti disattivati'; -$lng['serversettings']['deactivateddocroot']['description'] = 'Quando un utente viene disattivato questo percorso viene usato come suo docroot. Lascia vuoto per non creare un vhost a tutti.'; - -// ADDED IN 1.2.16-svn4 - -$lng['panel']['reset'] = 'Annulla le modifiche'; -$lng['admin']['accountsettings'] = 'Impostazioni Account'; -$lng['admin']['panelsettings'] = 'Impostazioni Pannello'; -$lng['admin']['systemsettings'] = 'Impostazioni di Sistema'; -$lng['admin']['webserversettings'] = 'Impostazioni Server Web'; -$lng['admin']['mailserversettings'] = 'Impostazioni Server di Posta'; -$lng['admin']['nameserversettings'] = 'Impostazioni Nameserver'; -$lng['admin']['updatecounters'] = 'Ricalcolo risorse'; -$lng['question']['admin_counters_reallyupdate'] = 'Sei sicuro di voler ricacolare il consumo delle risorse?'; -$lng['panel']['pathDescription'] = 'Se la cartella non esiste, viene creata automaticamente.'; - -// ADDED IN 1.2.16-svn6 -$lng['admin']['templates']['TRAFFIC'] = 'Sostituito con il traffico che è stato assegnato al cliente.'; -$lng['admin']['templates']['TRAFFICUSED'] = 'Sostituito con il traffico che è stato usato dal cliente.'; - -// ADDED IN 1.2.16-svn7 - -$lng['admin']['subcanemaildomain']['never'] = 'Mai'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'Selezionabile, predefinito no'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'Selezionabile, predefinito si'; -$lng['admin']['subcanemaildomain']['always'] = 'Sempre'; -$lng['changepassword']['also_change_stats'] = ' modificare anche la password di statistic'; - -// ADDED IN 1.2.16-svn8 - -$lng['serversettings']['mailpwcleartext']['title'] = 'Salva le password in chiaro degli account email nel database'; -$lng['serversettings']['mailpwcleartext']['description'] = 'Se impostato a Si, tutte le password saranno salvate in chiaro (saranno leggibili a chiunque abbia accesso al database) nella tabella mail_users. Attiva questa opzione solo se necessaria!'; -$lng['serversettings']['mailpwcleartext']['removelink'] = 'Clicca qui per cancellare tutte le password in chiaro dalla tabella.'; -$lng['question']['admin_cleartextmailpws_reallywipe'] = 'Sei sicuro di voler cancellare tutte le password in chiaro degli account email dalla tabella mail_users? Attenzione non si può tornare indietro!'; -$lng['admin']['configfiles']['overview'] = 'Panoramica'; -$lng['admin']['configfiles']['distribution'] = 'Distribuzione'; -$lng['admin']['configfiles']['service'] = 'Servizio'; -$lng['admin']['configfiles']['daemon'] = 'Demone'; -$lng['admin']['configfiles']['etc'] = 'Altro (Sistema)'; -$lng['admin']['configfiles']['choosedistribution'] = '-- Scegli una distribuzione --'; -$lng['admin']['configfiles']['chooseservice'] = '-- Scegli un servizio --'; -$lng['admin']['configfiles']['choosedaemon'] = '-- Scegli un demone --'; - -// ADDED IN 1.2.16-svn10 - -$lng['serversettings']['ftpdomain']['title'] = 'Account FTP @domain'; -$lng['serversettings']['ftpdomain']['description'] = 'I Clienti possono creare account ftp utente@dominiocliente?'; -$lng['panel']['back'] = 'Indietro'; - -// ADDED IN 1.2.16-svn12 - -$lng['serversettings']['mod_fcgid']['title'] = 'Includi PHP via mod_fcgid/suexec'; -$lng['serversettings']['mod_fcgid']['description'] = 'Usa mod_fcgid/suexec/libnss_mysql per avviare PHP con il corrispondente account-utente.
Questo richiede una speciale configurazione del Webserver. Tutte le opzioni seguenti sono validi solo se il modulo è abilitato.'; -$lng['serversettings']['sendalternativemail']['title'] = 'Usa un\'indirizzo email alternativo'; -$lng['serversettings']['sendalternativemail']['description'] = 'Invia la password dell\'email a un\'indirizzo diverso da quello creato'; -$lng['emails']['alternative_emailaddress'] = 'Indirizzo email alternativo'; -$lng['mails']['pop_success_alternative']['mailbody'] = 'Salve,\n\nil tuo account email {EMAIL}\nè stato creato correttamente.\nLa tua password è {PASSWORD}.\n\nQuesta è un\'email creata automaticamente,\n si prega di non rispondere a questa email!\n\nCordiali Saluti, Amministratore.'; -$lng['mails']['pop_success_alternative']['subject'] = 'Account email creato correttamente'; -$lng['admin']['templates']['pop_success_alternative'] = 'Email di Benvenuto spedita all\'indirizzo alternativo per i nuovi account email'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Sostituito con la password dell\'account POP3/IMAP.'; - -// ADDED IN 1.2.16-svn13 - -$lng['error']['documentrootexists'] = 'La cartella "%s" è già presente per questo cliente. Cancella la cartella prima di aggiungere nuovamente il cliente.'; - -// ADDED IN 1.2.16-svn14 - -$lng['serversettings']['apacheconf_vhost']['title'] = 'File/cartella della configurazione vhost del Webserver'; -$lng['serversettings']['apacheconf_vhost']['description'] = 'Dove vuoi che venga salvata la configurazione vhost? Qui puoi scegliere un file (tutti i vhosts in un file) o una cartella (ogni vhost avrà il suo file).'; -$lng['serversettings']['apacheconf_diroptions']['title'] = 'Webserver diroptions configuration file/dirname'; -$lng['serversettings']['apacheconf_diroptions']['description'] = 'Dove vuoi che venga salvata la configurazione dir-options? Qui puoi scegliere un file (tutti i vhosts in un file) o una cartella (ogni vhost avrà il suo file).'; -$lng['serversettings']['apacheconf_htpasswddir']['title'] = 'Cartella htpasswd del Webserver'; -$lng['serversettings']['apacheconf_htpasswddir']['description'] = 'Dove vuoi che vengano salvati i file htpasswd per la protezione delle cartelle?'; - -// ADDED IN 1.2.16-svn15 - -$lng['error']['formtokencompromised'] = 'La richiesta sembra essere compromessa. Per motivi di sicurezza sei stato disconnesso.'; -$lng['serversettings']['mysql_access_host']['description'] = 'Lista degli host (separati da una virgola) a cui gli utenti possono collegarsi al server MySQL.'; - -// ADDED IN 1.2.18-svn1 - -$lng['admin']['ipsandports']['create_listen_statement'] = 'Crea la direttiva Listen'; -$lng['admin']['ipsandports']['create_namevirtualhost_statement'] = 'Crea la direttiva NameVirtualHost'; -$lng['admin']['ipsandports']['create_vhostcontainer'] = 'Crea vHost-Container'; -$lng['admin']['ipsandports']['create_vhostcontainer_servername_statement'] = 'Crea la direttiva ServerName in vHost-Container'; - -// ADDED IN 1.2.18-svn2 - -$lng['admin']['webalizersettings'] = 'Impostazioni Webalizer'; -$lng['admin']['webalizer']['normal'] = 'Normale'; -$lng['admin']['webalizer']['quiet'] = 'Modesto'; -$lng['admin']['webalizer']['veryquiet'] = 'Niente'; -$lng['serversettings']['webalizer_quiet']['description'] = 'Verbosità del programma webalizer'; - -// ADDED IN 1.2.18-svn4 - -$lng['admin']['domain_nocustomeraddingavailable'] = 'Adesso non è possibile aggiungere un dominio. Prima è necessario aggiungere almeno un cliente.'; - -// ADDED IN 1.2.19-svn1 - -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Cartella della configurazione'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Dove vuoi che venga salvata la configurazione di fcgid? Se non ti sei compilato suexec da solo, di solito questo percorso è /var/www'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Cartella Temp'; - -// ADDED IN 1.2.19-svn4 - -$lng['menue']['traffic']['traffic'] = 'Traffico'; -$lng['menue']['traffic']['current'] = 'Mese corrente'; -$lng['traffic']['month'] = "Mese"; -$lng['traffic']['day'] = "Giorno"; -$lng['traffic']['months'][1] = "Gennaio"; -$lng['traffic']['months'][2] = "Febbraio"; -$lng['traffic']['months'][3] = "Marzo"; -$lng['traffic']['months'][4] = "Aprile"; -$lng['traffic']['months'][5] = "Maggio"; -$lng['traffic']['months'][6] = "Giugno"; -$lng['traffic']['months'][7] = "Luglio"; -$lng['traffic']['months'][8] = "Agosto"; -$lng['traffic']['months'][9] = "Settembre"; -$lng['traffic']['months'][10] = "Ottobre"; -$lng['traffic']['months'][11] = "Novembre"; -$lng['traffic']['months'][12] = "Dicembre"; -$lng['traffic']['mb'] = "Traffico (MB)"; -$lng['traffic']['distribution'] = 'FTP | HTTP | Mail'; -$lng['traffic']['sumhttp'] = 'Sommatoria Traffico in ingresso HTTP'; -$lng['traffic']['sumftp'] = 'Sommatoria Traffico in ingresso FTP'; -$lng['traffic']['summail'] = 'Sommatoria Traffico in ingresso Mail'; - -// ADDED IN 1.2.19-svn6 - -$lng['admin']['loggersettings'] = 'Impostazioni Log'; -$lng['serversettings']['logger']['enable'] = 'Abilita/Disabilita Log'; -$lng['serversettings']['logger']['severity'] = 'Livello Log'; -$lng['admin']['logger']['normal'] = 'normale'; -$lng['admin']['logger']['paranoid'] = 'paranoico'; -$lng['serversettings']['logger']['types']['title'] = 'Tipo di Log'; -$lng['serversettings']['logger']['types']['description'] = 'Specificare tipo di Log. Per selezionare più tipi, tenere premuto CTRL durante la selezione.
Tipi di log disponibili: syslog, file, mysql'; -$lng['serversettings']['logger']['logfile'] = 'Percorso completo e nome del file del Log'; -$lng['error']['logerror'] = 'Errore Log: %s'; -$lng['serversettings']['logger']['logcron'] = 'Log cronjobs (one run)'; -$lng['question']['logger_reallytruncate'] = 'Sei sicuro di voler troncare la tabella "%s"?'; -$lng['admin']['loggersystem'] = 'Log di Sistema'; -$lng['logger']['date'] = 'Data'; -$lng['logger']['type'] = 'Tipo'; -$lng['logger']['action'] = 'Azione'; -$lng['logger']['user'] = 'Utente'; -$lng['logger']['truncate'] = 'Log vuoto'; - -// ADDED IN 1.2.19-svn7 -$lng['serversettings']['ssl']['openssl_cnf'] = 'Defaults per la creazione del file Cert'; -$lng['panel']['reseller'] = 'rivenditore'; -$lng['panel']['admin'] = 'amministratore'; -$lng['panel']['customer'] = 'cliente/i'; -$lng['error']['nomessagetosend'] = 'Non hai inserito un messaggio.'; -$lng['error']['norecipientsgiven'] = 'Non hai specificato alcun destinatario'; -$lng['admin']['emaildomain'] = 'Email dominio'; -$lng['admin']['email_only'] = 'Solo email?'; -$lng['admin']['wwwserveralias'] = 'Aggiungi a "www." ServerAlias'; -$lng['admin']['ipsandports']['enable_ssl'] = 'Questa è una porta SSL?'; -$lng['admin']['ipsandports']['ssl_cert_file'] = 'Percorso del certificato SSL (SSL certificate)'; -$lng['panel']['send'] = 'invia'; -$lng['admin']['subject'] = 'Oggetto'; -$lng['admin']['recipient'] = 'Destinatario'; -$lng['admin']['message'] = 'Scrivi un messaggio'; -$lng['admin']['text'] = 'Messaggio'; -$lng['menu']['message'] = 'Messaggi'; -$lng['error']['errorsendingmail'] = 'Il messaggio a "%s" fallito'; -$lng['error']['cannotreaddir'] = 'Impossibile leggere la cartella "%s"'; -$lng['success']['messages_success'] = 'Inviato correttamente il messaggio a %s recipients'; -$lng['message']['norecipients'] = 'Nessuna e-mail è stata inviata perch¸ non ci sono i destinatari nel database'; -$lng['admin']['sslsettings'] = 'Impostazioni SSL'; -$lng['cronjobs']['notyetrun'] = 'Non ancora avviato'; -$lng['serversettings']['default_vhostconf']['title'] = 'Impostazioni default vhost'; -$lng['serversettings']['default_vhostconf']['description'] = 'Il contenuto di questo campo sarà incluso direttamente nel contenitore di dominio vhost. Attenzione: Il codice non sarà controllato per eventuali errori. Se contiene errori, il webserver non riavviarsi correttamente!'; -$lng['error']['invalidip'] = 'Indirizzo IP non valido: %s'; -$lng['serversettings']['decimal_places'] = 'Numero di cifre decimali del traffico/spazio web in uscita'; - -// ADDED IN 1.2.19-svn8 - -$lng['admin']['dkimsettings'] = 'Impostazioni DomainKey'; -$lng['dkim']['dkim_prefix']['title'] = 'Prefisso'; -$lng['dkim']['dkim_prefix']['description'] = 'Si prega di specificare il percorso della DKIM RSA-files, nonch¸ i file di configurazione per il plugin Milter'; -$lng['dkim']['dkim_domains']['title'] = 'Domini nomefile'; -$lng['dkim']['dkim_domains']['description'] = 'Nome file del parametro DKIM Domains specificata nella configurazione dkim-milter'; -$lng['dkim']['dkim_dkimkeys']['title'] = 'Nome file del KeyList'; -$lng['dkim']['dkim_dkimkeys']['description'] = 'Nome file del parametro DKIM KeyList specificata nella configurazione dkim-milter'; -$lng['dkim']['dkimrestart_command']['title'] = 'Milter commando riavvio'; -$lng['dkim']['dkimrestart_command']['description'] = 'Si prega di specificare il comando per riavviare il servizio DKIM milter'; - -// ADDED IN 1.2.19-svn9 - -$lng['admin']['caneditphpsettings'] = 'È possibile modificare le impostazioni di dominio relative a php?'; - -// ADDED IN 1.2.19-svn12 - -$lng['admin']['allips'] = 'Tutti gli IP'; -$lng['panel']['nosslipsavailable'] = 'Attualmente non ci sono combinazioni ssl ip/porta per questo server'; -$lng['dkim']['use_dkim']['title'] = 'Attivare il supporto DKIM?'; -$lng['dkim']['use_dkim']['description'] = 'Vuoi utilizzare il sistema Domain Keys (DKIM)?'; -$lng['error']['invalidmysqlhost'] = 'Indirizzo MySQL non valido: %s'; -$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'Non è possibile abilitare Webalizer e Awstats allo stesso tempo, si prega di sceglierne uno solo'; -$lng['serversettings']['webalizer_enabled'] = 'Abilita le statistiche webalizer'; -$lng['serversettings']['awstats_enabled'] = 'Abilita le statistiche awstats'; -$lng['admin']['awstatssettings'] = 'Impostazioni Awstats'; - -// ADDED IN 1.2.19-svn16 - -$lng['admin']['domain_dns_settings'] = 'Impostazioni dominio dns'; -$lng['dns']['destinationip'] = 'Dominio IP'; -$lng['dns']['a_record'] = 'A-Record (IPv6 optionale)'; -$lng['dns']['mxrecords'] = 'Definisci MX records'; -$lng['dns']['txtrecords'] = 'Definisci TXT records'; -$lng['dns']['txtexample'] = 'Esempio (SPF-entry):
v=spf1 ip4:xxx.xxx.xx.0/23 -all'; -$lng['serversettings']['selfdns']['title'] = 'Impostazioni dominio dns del cliente'; -$lng['serversettings']['selfdnscustomer']['title'] = 'Consenti ai clienti di modificare le impostazioni DNS del dominio'; -$lng['admin']['activated'] = 'Attivato'; -$lng['admin']['statisticsettings'] = 'Impostazioni Statistiche'; -$lng['admin']['or'] = 'o'; - -// ADDED IN 1.2.19-svn17 - -$lng['serversettings']['unix_names']['title'] = 'Usa nomi utente UNIX compatibile'; -$lng['serversettings']['unix_names']['description'] = 'Consente di utilizzare - e _ nei nomi utente se No'; -$lng['error']['cannotwritetologfile'] = 'Impossibile aprire il file di log %s in scrittura'; -$lng['admin']['sysload'] = 'Carico del sistema'; -$lng['admin']['noloadavailable'] = 'non disponibile'; -$lng['admin']['nouptimeavailable'] = 'non disponibile'; -$lng['panel']['backtooverview'] = 'Ritorna alla pagina precedente'; -$lng['admin']['nosubject'] = '(Nessun Oggetto)'; -$lng['admin']['configfiles']['statistics'] = 'Statistiche'; -$lng['login']['forgotpwd'] = 'Dimenticato la password?'; -$lng['login']['presend'] = 'Reimposta la password'; -$lng['login']['email'] = 'Indirizzo E-mail'; -$lng['login']['remind'] = 'Reimposta la mia password'; -$lng['login']['usernotfound'] = 'Utente non trovata!'; -$lng['mails']['password_reset']['subject'] = 'Reimposta password'; -$lng['mails']['password_reset']['mailbody'] = 'Salve {USERNAME},\n\nla tua password froxlor è stata reimpostata!\nLa nuova password è: {LINK}\n\nGrazie,\n Team Froxlor'; -$lng['pwdreminder']['success'] = 'La password è stata reimpostata con successo.
A questo punto riceverai una email con la nuova password.'; - -// ADDED IN 1.2.19-svn18 - -$lng['serversettings']['allow_password_reset']['title'] = 'Consenti ai clienti di reimpostare la password'; -$lng['pwdreminder']['notallowed'] = 'Il reimposta password è disabilitato'; - -// ADDED IN 1.2.19-svn21 - -$lng['customer']['title'] = 'Titolo'; -$lng['customer']['country'] = 'Paese'; -$lng['panel']['dateformat'] = 'DD-MM-YYYY'; -$lng['panel']['dateformat_function'] = 'd-m-Y'; - -// Y = Year, m = Month, d = Day - -$lng['panel']['timeformat_function'] = 'H:i:s'; - -// H = Hour, i = Minute, s = Second - -$lng['panel']['default'] = 'Predefinito'; -$lng['panel']['never'] = 'Mai'; -$lng['panel']['active'] = 'Attivo'; -$lng['panel']['please_choose'] = 'Scegli'; -$lng['panel']['allow_modifications'] = 'Permetti modifiche'; -$lng['domains']['add_date'] = 'Aggiunto a Froxlor'; -$lng['domains']['registration_date'] = 'Aggiunto al registro'; -$lng['domains']['topleveldomain'] = 'Dominio di primo livello (TLD)'; - -// ADDED IN 1.2.19-svn22 - -$lng['serversettings']['allow_password_reset']['description'] = 'I clienti possono reimpostare la propria password e una nuova password verrà inviata al loro indirizzo e-mail'; -$lng['serversettings']['allow_password_reset_admin']['title'] = 'Consenti di reimpostare la password agli ammministratori'; -$lng['serversettings']['allow_password_reset_admin']['description'] = 'Amministratori/rivenditori possono reimpostare la propria password e una nuova password verrà inviata al loro indirizzo e-mail'; - -// ADDED IN 1.2.19-svn25 - -$lng['emails']['quota'] = 'Limite'; -$lng['emails']['noquota'] = 'Nessun limite'; -$lng['emails']['updatequota'] = 'Aggiorna Limite'; -$lng['serversettings']['mail_quota']['title'] = 'Limite casella email'; -$lng['serversettings']['mail_quota']['description'] = 'Limite predefinito per una nuova casella email creata (MegaByte).'; -$lng['serversettings']['mail_quota_enabled']['title'] = 'Usa limiti per le caselle email dei clienti'; -$lng['serversettings']['mail_quota_enabled']['description'] = 'Attiva per utilizzare i limiti nelle caselle email. Predefinito No poich¸ questo richiede una configurazione speciale.'; -$lng['serversettings']['mail_quota_enabled']['removelink'] = 'Clicca qui per togliere tutti i limiti dalle caselle email.'; -$lng['serversettings']['mail_quota_enabled']['enforcelink'] = 'Clicca qui per applicare il limite predefinito a tutte le caselle email degli utenti.'; -$lng['question']['admin_quotas_reallywipe'] = 'Sei sicuro di voler cancellare tutti i limiti dalla tabella mail_users? Questa operazione non può essere annullata!'; -$lng['question']['admin_quotas_reallyenforce'] = 'Sei sicuro di voler impostare il limite predefinito a tutti gli utenti? Questa operazione non può essere annullata!'; -$lng['error']['vmailquotawrong'] = 'Il limite deve essere un numero positivo.'; -$lng['customer']['email_quota'] = 'Limite E-mail'; -$lng['customer']['email_imap'] = 'E-mail IMAP'; -$lng['customer']['email_pop3'] = 'E-mail POP3'; -$lng['customer']['mail_quota'] = 'Limite Mail'; -$lng['panel']['megabyte'] = 'MegaByte'; -$lng['panel']['not_supported'] = 'Non supportato in: '; -$lng['emails']['quota_edit'] = 'Cambia limite E-Mail'; -$lng['error']['allocatetoomuchquota'] = 'Si è tentato di allocare %s MB Limite, ma non c\'è abbastanza spazio disponibile.'; -$lng['error']['missingfields'] = 'Non tutti i campi obbligatori sono stati compilati.'; -$lng['error']['accountnotexisting'] = 'L\'account di posta elettronica dato non esiste.'; -$lng['admin']['security_settings'] = 'Opzioni di Sicurezza'; -$lng['admin']['know_what_youre_doing'] = 'Modifica solo, se sai quello che stai facendo!'; -$lng['admin']['show_version_login']['title'] = 'Mostra la versione di Froxlor quando si effettua l\'accesso'; -$lng['admin']['show_version_login']['description'] = 'Mostra la versione di Froxlor in fondo-pagina di accesso'; -$lng['admin']['show_version_footer']['title'] = 'Mostra la versione di Froxlor in fondo-pagina'; -$lng['admin']['show_version_footer']['description'] = 'Mostra la versione di Froxlor in fondo ad ogni pagina'; -$lng['admin']['froxlor_graphic']['title'] = 'Intestazione grafica per Froxlor'; -$lng['admin']['froxlor_graphic']['description'] = 'Quale grafica vuoi mostrare nell\'intestazione?'; - -// improved froxlor - -$lng['menue']['phpsettings']['maintitle'] = 'Configurazioni PHP'; -$lng['admin']['phpsettings']['title'] = 'Configurazione PHP'; -$lng['admin']['phpsettings']['description'] = 'Descrizione breve'; -$lng['admin']['phpsettings']['actions'] = 'Azioni'; -$lng['admin']['phpsettings']['activedomains'] = 'In uso per dominio/i'; -$lng['admin']['phpsettings']['notused'] = 'Configurazione non utilizzata'; -$lng['admin']['misc'] = 'Varie'; -$lng['admin']['phpsettings']['editsettings'] = 'Modific impostazioni PHP'; -$lng['admin']['phpsettings']['addsettings'] = 'Crea una nuova impostazione PHP'; -$lng['admin']['phpsettings']['viewsettings'] = 'Mostra impostazioni PHP'; -$lng['admin']['phpsettings']['phpinisettings'] = 'Impostazioni php.ini'; -$lng['error']['nopermissionsorinvalidid'] = 'Non hai i permessi necessari per modificare le impostazioni o è stato fornito un ID non valido.'; -$lng['panel']['view'] = 'view'; -$lng['question']['phpsetting_reallydelete'] = 'Do you really want to delete these settings? All domains which use these settings currently will be changed to the default config.'; -$lng['admin']['phpsettings']['addnew'] = 'Crea nuove impostazioni'; -$lng['error']['phpsettingidwrong'] = 'Una configurazione PHP con questo ID non esiste'; -$lng['error']['descriptioninvalid'] = 'La descrizione è troppo corta, La descrizione è troppo corta o troppo lunga o contiene caratteri non validi.'; -$lng['error']['info'] = 'Info'; -$lng['admin']['phpconfig']['template_replace_vars'] = 'Variabili che saranno sostituite nei file di configurazione'; -$lng['admin']['phpconfig']['pear_dir'] = 'Verrà sostituito con le impostazioni globali per la cartella pear.'; -$lng['admin']['phpconfig']['open_basedir_c'] = 'Inserirà un ; (punto e virgola) per commentare/disabilitare open_basedir se impostato'; -$lng['admin']['phpconfig']['open_basedir'] = 'Verrà sostituito con l\'impostazione open_basedir del dominio.'; -$lng['admin']['phpconfig']['tmp_dir'] = 'Verrà sostituito con la cartella temporanea del dominio.'; -$lng['admin']['phpconfig']['open_basedir_global'] = 'Verrà sostituito con il valore globale del percorso che sarà allegato al open_basedir'; -$lng['admin']['phpconfig']['customer_email'] = 'Verrà sostituito con l\'indirizzo email del cliente che possiede questo dominio.'; -$lng['admin']['phpconfig']['admin_email'] = 'Verrà sostituito con l\'indirizzo email dell\'amministratore di questo dominio.'; -$lng['admin']['phpconfig']['domain'] = 'Verrà sostituito con il dominio.'; -$lng['admin']['phpconfig']['customer'] = 'Verrà sostituito con il nome utente del cliente che possiede questo dominio.'; -$lng['admin']['phpconfig']['admin'] = 'Verrà sostituito con il nome utente dell\'amministratore che possiede questo dominio.'; -$lng['login']['backtologin'] = 'Torna al login'; -$lng['serversettings']['mod_fcgid']['starter']['title'] = 'Processi per Dominio'; -$lng['serversettings']['mod_fcgid']['starter']['description'] = 'Quanti processi dovrebbero essere avviati/permessi per ogni dominio? Il valore 0 è raccomandato poichè PHP si autogestisce i processi in modo molto efficiente.'; -$lng['serversettings']['mod_fcgid']['wrapper']['title'] = 'Wrapper in Vhosts'; -$lng['serversettings']['mod_fcgid']['wrapper']['description'] = 'Come dovrebbe essere il wrapper incluso nel Vhosts'; -$lng['serversettings']['mod_fcgid']['tmpdir']['description'] = 'Dove va salvata la cartella temp'; -$lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Cartella globale di PEAR'; -$lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Quali sono le cartelle globali di PEAR che dovrebbero essere sostituite in ogni configurazione php.ini? Più cartelle devono essere separate da : (due punti).'; - -// improved Froxlor 2 - -$lng['admin']['templates']['index_html'] = 'file index per le nuove cartelle create dai clienti'; -$lng['admin']['templates']['SERVERNAME'] = 'Sostituito con il nomeserver.'; -$lng['admin']['templates']['CUSTOMER'] = 'Sostituito con il nome utente del cliente.'; -$lng['admin']['templates']['ADMIN'] = 'Sostituito con il nome utente dell\'amministratore.'; -$lng['admin']['templates']['CUSTOMER_EMAIL'] = 'Sostituito con l\'indirizzo e-mail del cliente.'; -$lng['admin']['templates']['ADMIN_EMAIL'] = 'Sostituito con l\'indirizzo e-mail dell\'amministratore.'; -$lng['admin']['templates']['filetemplates'] = 'File Modelli'; -$lng['admin']['templates']['filecontent'] = 'Contenuto File'; -$lng['error']['filecontentnotset'] = 'Il file non può essere vuoto!'; -$lng['serversettings']['index_file_extension']['description'] = 'Quale estensione di file deve essere usata per il file index nelle cartelle del cliente appena creato? Questa estensione di file sarà utilizzata se Lei o uno dei vostri amministratori ha creato il proprio file modello di index.'; -$lng['serversettings']['index_file_extension']['title'] = 'Estensione file per il file index delle cartelle dei clienti appena creati'; -$lng['error']['index_file_extension'] = 'L\'estensione file del file index deve essere compresa tra 1 e 6 caratteri. L\'estensione può contenere solo i caratteri a-z, A-Z and 0-9'; -$lng['admin']['expert_settings'] = 'Impostazioni Avanzate!'; -$lng['admin']['mod_fcgid_starter']['title'] = 'Processi PHP per questo dominio (vuoto per lasciare il valore predefinito)'; - -$lng['error']['customerdoesntexist'] = 'Il cliente che si è selezionato non esiste.'; -$lng['error']['admindoesntexist'] = 'L\'amministratore che si è selezionato non esiste.'; - -// ADDED IN 1.2.19-svn37 -$lng['serversettings']['session_allow_multiple_login']['title'] = 'Permettere login multipli'; -$lng['serversettings']['session_allow_multiple_login']['description'] = 'Se attivato un utente può accedere più volte.'; -$lng['serversettings']['panel_allow_domain_change_admin']['title'] = 'Permettere di spostare domini tra gli amministratori'; -$lng['serversettings']['panel_allow_domain_change_admin']['description'] = 'Se attivato si può cambiare l\'amministratore di un dominio dalle impostazioni del dominio
Attenzione: Se un cliente non viene assegnato allo stesso amministratore e dominio, l\'amministratore può vedere tutti gli altri domini di questo cliente!'; -$lng['serversettings']['panel_allow_domain_change_customer']['title'] = 'Permetti di spostare domini tra i clienti'; -$lng['serversettings']['panel_allow_domain_change_customer']['description'] = 'Se attivato si può cambiare il cliente di un dominio dalle impostazioni del dominio.
Attenzione: Froxlor non cambierà alcun percorso. Ciò potrebbe rendere inutilizzabile un dominio!'; -$lng['domains']['associated_with_domain'] = 'Associato'; -$lng['domains']['aliasdomains'] = 'Alias domini'; -$lng['error']['ipportdoesntexist'] = 'La combinazione IP/Porta selezionata non esiste.'; - -// ADDED IN 1.2.19-svn38 - -$lng['admin']['phpserversettings'] = 'Impostazioni PHP'; -$lng['admin']['phpsettings']['binary'] = 'PHP Binary'; -$lng['admin']['phpsettings']['file_extensions'] = 'Estensioni File'; -$lng['admin']['phpsettings']['file_extensions_note'] = '(senza punto, separate da spazi)'; -$lng['admin']['mod_fcgid_maxrequests']['title'] = 'Richieste PHP massime per questo dominio (vuoto per lasciare il valore predefinito)'; -$lng['serversettings']['mod_fcgid']['maxrequests']['title'] = 'Richieste massime per dominio'; -$lng['serversettings']['mod_fcgid']['maxrequests']['description'] = 'Quante richieste dovrebbero essere permesse per dominio?'; - -// ADDED IN 1.4.2.1-1 - -$lng['mysql']['mysql_server'] = 'Server MySQL'; - -// ADDED IN 1.4.2.1-2 - -$lng['admin']['ipsandports']['webserverdefaultconfig'] = 'Configurazione predefinita Webserver'; -$lng['admin']['ipsandports']['webserverdomainconfig'] = 'Configurazione Dominio Webserver'; -$lng['admin']['ipsandports']['webserverssldomainconfig'] = 'COnfigura SSL Webserver'; -$lng['admin']['ipsandports']['ssl_key_file'] = 'Percorso al Keyfile SSL'; -$lng['admin']['ipsandports']['ssl_ca_file'] = 'Percorso al CA certificate SSL'; -$lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Impostazioni predefinite vhost per ogni contenitore di dominio'; - -$lng['error']['usernamealreadyexists'] = 'Esiste già il nome utente: %s'; - -$lng['error']['plausibilitychecknotunderstood'] = 'Il controllo non ha capito la risposta di plausibilità'; -$lng['error']['errorwhensaving'] = 'Verificato un errore durante il salvataggio del campo %s'; - -$lng['success']['success'] = 'Informazioni'; -$lng['success']['clickheretocontinue'] = 'Clicca qui per continuare'; -$lng['success']['settingssaved'] = 'Le impostazioni sono state salvate con successo.'; - -// ADDED IN FROXLOR 0.9 - -$lng['admin']['spfsettings'] = 'Impostazioni Dominio SPF'; -$lng['spf']['use_spf'] = 'Attiva SPF per i domini?'; -$lng['spf']['spf_entry'] = 'Impostazioni SPF per tutti i domini'; -$lng['panel']['toomanydirs'] = 'Troppe sottocartelle. Rifare tornando indietro nella selezione manuale della cartella.'; -$lng['panel']['abort'] = 'Termina'; -$lng['serversettings']['cron']['debug']['title'] = 'Debug Cronscript'; -$lng['serversettings']['cron']['debug']['description'] = 'Attiva per mantenere il file lock dopo l\'avvio di cron, solo per debug
Attenzione:Mantenendo il file di lock al successivo avvio cron potrebbe non funzionare correttamente'; -$lng['panel']['not_activated'] = 'non attivato'; -$lng['panel']['off'] = 'off'; -$lng['update']['updateinprogress_onlyadmincanlogin'] = 'Una nuova versione di Froxlor è stata installata ma non ancora impostata.
Solo l\'amministratore può accedere e completare l\'aggiornamento.'; -$lng['update']['update'] = 'Aggiorna Froxlor'; -$lng['update']['proceed'] = 'Procedi'; -$lng['update']['update_information']['part_a'] = 'I file di Froxlor sono stati aggiornati alla versione %newversion. La versione installata è %curversion.'; -$lng['update']['update_information']['part_b'] = '

I clienti non potranno accedere fino a quando l\'aggiornamento non sarà completato.
Procedere?'; -$lng['update']['noupdatesavail'] = 'È già presente l\'ultima versione di Froxlor.'; -$lng['admin']['specialsettingsforsubdomains'] = 'Applica le impostazioni speciali a tutti i sottodomini (*.esempio.com)'; -$lng['serversettings']['specialsettingsforsubdomains']['description'] = 'Se si queste impostazioni personalizzate dei vhost saranno aggiunte a tutti sottodomini; se no le impostazioni speciali dei sottodomini verranno rimosse.'; -$lng['tasks']['outstanding_tasks'] = 'Processi Cron in sospeso'; -$lng['tasks']['REBUILD_VHOST'] = 'Ricostruzione della configurazione del webserver'; -$lng['tasks']['CREATE_HOME'] = 'Aggiunto il nuovo cliente %loginname%'; -$lng['tasks']['REBUILD_DNS'] = 'Ricostruzione della configurazione di bind'; -$lng['tasks']['CREATE_FTP'] = 'Creazione delle cartelle per i nuovi utenti ftp'; -$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Eliminazione dei file del cliente %loginname%'; -$lng['tasks']['noneoutstanding'] = 'Attualmente non ci sono processi in sospeso per Froxlor'; - -// ADDED IN FROXLOR 0.9.1 - -$lng['admin']['accountdata'] = 'Dati conto'; -$lng['admin']['contactdata'] = 'Dati contatto'; -$lng['admin']['servicedata'] = 'Dati di servizio'; - -// ADDED IN FROXLOR 0.9.2 - -$lng['admin']['newerversionavailable'] = 'È disponibile una nuova versione di Floxlor'; - -// ADDED IN FROXLOR 0.9.3 - -$lng['emails']['noemaildomainaddedyet'] = 'Non hai ancora un (email-)dominio nel tuo account.'; -$lng['error']['hiddenfieldvaluechanged'] = 'Il valore per il campo nascosto "%s" è cambiato durante la modifica delle impostazioni.

Questo non è solitamente un grosso problema, ma le impostazioni potrebbe non essere salvate a causa di questo.'; - -// ADDED IN FROXLOR 0.9.3-svn1 - -$lng['serversettings']['panel_password_min_length']['title'] = 'Lunghezza minima della password'; -$lng['serversettings']['panel_password_min_length']['description'] = 'Qui è possibile impostare una lunghezza minima per le password.\'0\' significa: nessuna lunghezza minima richiesta.'; -$lng['error']['notrequiredpasswordlength'] = 'La password scritta è troppo corta. Si prega di scrivere una password lunga almeno %s caratteri.'; -$lng['serversettings']['system_store_index_file_subs']['title'] = 'Salva il file index predefinito anche nelle nuove sottocartelle'; -$lng['serversettings']['system_store_index_file_subs']['description'] = 'Se abilitato, il file index predefinito viene memorizzato per ogni cartella sottodominio appena creata (non se la cartella esiste già!)'; - -// ADDED IN FROXLOR 0.9.3-svn2 - -$lng['serversettings']['adminmail_return']['title'] = 'Indirizzo di Risposta'; -$lng['serversettings']['adminmail_return']['description'] = 'Definire un indirizzo email come \'Indirizzo di Risposta\' per le email inviate dal Pannello'; -$lng['serversettings']['adminmail_defname'] = 'Nome del mittente del Pannello nell\'email'; - -// ADDED IN FROXLOR 0.9.3-svn3 -$lng['dkim']['dkim_algorithm']['title'] = 'Ammessi Algoritmi Hash'; -$lng['dkim']['dkim_algorithm']['description'] = 'Definire gli algoritmi di hash permessi, scegliere "Tutti" per permettere tutti gli algoritmi oppure uno o più tra gli altri algoritmi disponibili'; -$lng['dkim']['dkim_servicetype'] = 'Tipi di Servizio'; -$lng['dkim']['dkim_keylength']['title'] = 'Lunghezza Chiave'; -$lng['dkim']['dkim_keylength']['description'] = 'Attenzione: Se si modifica questo valore è necessario eliminare tutte le chiavi private/pubbliche in "%s"'; -$lng['dkim']['dkim_notes']['title'] = 'Note DKIM'; -$lng['dkim']['dkim_notes']['description'] = 'Nota potrebbe essere di interesse, es. un URL come http://www.dnswatch.info. Nessuna interpretazione è fatta da nessun programma. Questo tag deve essere usato con parsimonia per ragioni di spazio nel DNS. Questo è destinato ad essere utilizzato dagli amministratori e non dagli utenti finali.'; - -$lng['admin']['cron']['cronsettings'] = 'Impostazioni Cronjob'; -$lng['cron']['cronname'] = 'Nome cronjob'; -$lng['cron']['lastrun'] = 'ultima esecuzione'; -$lng['cron']['interval'] = 'intervallo'; -$lng['cron']['isactive'] = 'abilitato'; -$lng['cron']['description'] = 'descrizione'; -$lng['crondesc']['cron_unknown_desc'] = 'nessuna descrizione fornita'; -$lng['admin']['cron']['add'] = 'Aggiungi cronjob'; -$lng['crondesc']['cron_tasks'] = 'generazione del file di configurazione'; -$lng['crondesc']['cron_legacy'] = 'legacy (vecchi) cronjob'; -$lng['crondesc']['cron_traffic'] = 'calcolo del traffico'; -$lng['cronmgmt']['minutes'] = 'minuti'; -$lng['cronmgmt']['hours'] = 'ore'; -$lng['cronmgmt']['days'] = 'giorni'; -$lng['cronmgmt']['weeks'] = 'settimane'; -$lng['cronmgmt']['months'] = 'mesi'; -$lng['admin']['cronjob_edit'] = 'Modifica cronjob'; -$lng['cronjob']['cronjobsettings'] = 'impostazioni Cronjob'; -$lng['cronjob']['cronjobinterval'] = 'Durata intervallo'; -$lng['panel']['options'] = 'opzioni'; -$lng['admin']['warning'] = 'ATTENZIONE - Leggi attentamente!'; -$lng['cron']['changewarning'] = 'La modifica di questi valori può avere conseguenze negative nel comportamento di Froxlor e dei suoi processi automatizzati
Per favore modifica questi valori solo se sei sicuro di quello che stai facendo!'; - -$lng['serversettings']['stdsubdomainhost']['title'] = 'Sottodominio standard cliente'; -$lng['serversettings']['stdsubdomainhost']['description'] = 'Quale hostname dovrebbe essere usato per creare sottodomini standard per i clienti. Se vuoto, viene utilizzato l\'hostname del sistema.'; - -// ADDED IN FROXLOR 0.9.4-svn1 -$lng['ftp']['account_edit'] = 'Modifica acocunt FTP'; -$lng['ftp']['editpassdescription'] = 'Imposta una nuova password o lascia vuoto per non cambiarla.'; -$lng['customer']['sendinfomail'] = 'Inviami i dati via email'; -$lng['mails']['new_database_by_customer']['subject'] = '[Froxlor] Nuovo database creato'; -$lng['mails']['new_database_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nhai appena aggiunto un nuovo database. Ecco le informazioni inserite:\n\nNome database: {DB_NAME}\nPassword: {DB_PASS}\nDescrizione: {DB_DESC}\nDB-Hostname: {DB_SRV}\n{PMA_URI}\nCordiali Saluti, Team Froxlor"; -$lng['serversettings']['awstats_path'] = 'Percorso a AWStats \'awstats_buildstaticpages.pl\''; -$lng['serversettings']['awstats_conf'] = 'Cartella della configurazione di AWStats'; -$lng['error']['overviewsettingoptionisnotavalidfield'] = 'Woops, un campo che dovrebbe essere mostrato come opzione in Impostazioni-Principale non è un tipo esclusivo. Si possono rimproverare gli sviluppatori per questo. Questo non deve accadere!'; -$lng['admin']['configfiles']['compactoverview'] = 'Visualizzazione-Compatta'; -$lng['admin']['lastlogin_succ'] = 'Ultimo accesso'; -$lng['panel']['neverloggedin'] = 'Nessun login effettuato'; - -// ADDED IN FROXLOR 0.9.6-svn1 -$lng['serversettings']['defaultttl'] = 'Dominio TTL per impegnare in secondi (predefinito \'604800\' = 1 settimana)'; - -// ADDED IN FROXLOR 0.9.6-svn3 -$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Abilita errordocuments in automatico per tutti i clienti'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL per l\'errore 401'; -$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '
Non supportato in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL per l\'errore 403'; -$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '
Non supportato in: lighttpd
'; -$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL per l\'errore 404'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL per l\'errore 500'; -$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '
Non supportato in: lighttpd
'; - -// ADDED IN FROXLOR 0.9.6-svn5 -$lng['serversettings']['mod_fcgid']['defaultini'] = 'Configurazione di default di PHP per i nuovi domini'; - -// ADDED IN FROXLOR 0.9.6-svn6 -$lng['admin']['ftpserver'] = 'Server FTP'; -$lng['admin']['ftpserversettings'] = 'Impostazioni del Server FTP'; -$lng['serversettings']['ftpserver']['desc'] = 'Se pureftpd è selezionato i file .ftpquota per i limiti dell\'utente sono creati e aggiornati giornalmente'; - -// ADDED IN FROXLOR 0.9.7-svn1 -$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'Nuovo utente ftp creato'; -$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Salve {CUST_NAME},\n\nhai appena aggiunto un nuovo utente ftp. Ecco le informazioni inserite:\n\nNome utente: {USR_NAME}\nPassword: {USR_PASS}\nPercorso: {USR_PATH}\n\nCordiali Saluti, Team Froxlor"; -$lng['domains']['redirectifpathisurl'] = 'Codice di redirezione (Predefinito: vuoto)'; -$lng['domains']['redirectifpathisurlinfo'] = 'È necessario selezionare uno di questi se hai inserito un URL come percorso'; -$lng['serversettings']['customredirect_enabled']['title'] = 'Permetti ai clienti le redirezioni'; -$lng['serversettings']['customredirect_enabled']['description'] = 'Consente ai clienti di scegliere il codice di stato http per le redirezioni che verranno utilizzate'; -$lng['serversettings']['customredirect_default']['title'] = 'Redirezione Predefinita'; -$lng['serversettings']['customredirect_default']['description'] = 'Imposta il codice della redirezione predefinito che dovrebbe essere usato se il cliente non lo imposta'; - -// ADDED IN FROXLOR 0.9.7-svn2 -$lng['error']['pathmaynotcontaincolon'] = 'Il percorso che hai inserito non dovrebbe contenere i due punti (:). Inserisci un percorso valido.'; - -// ADDED IN FROXLOR 0.9.7-svn3 - -// these stay only in english.lng.php - they are the same -// for all other languages and are used if not found there -$lng['redirect_desc']['rc_default'] = 'Predefinito'; -$lng['redirect_desc']['rc_movedperm'] = 'spostato in modo permanente'; -$lng['redirect_desc']['rc_found'] = 'trovato'; -$lng['redirect_desc']['rc_seeother'] = 'vedi gli altri'; -$lng['redirect_desc']['rc_tempred'] = 'reindirizzamento temporaneo'; - -// ADDED IN FROXLOR 0.9.8 -$lng['error']['exception'] = '%s'; - -// ADDED IN FROXLOR 0.9.9-svn1 -$lng['serversettings']['mail_also_with_mxservers'] = 'Crea mail-, imap-, pop3- and smtp-"A record" anche con MX-Servers impostato'; - -// ADDED IN FROXLOR 0.9.10-svn1 -$lng['admin']['webserver_user'] = 'Utente Webserver'; -$lng['admin']['webserver_group'] = 'Gruppo Webserver'; - -// ADDED IN FROXLOR 0.9.10 -$lng['serversettings']['froxlordirectlyviahostname'] = 'Accedi direttamente a Froxlor via hostname'; - -// ADDED IN FROXLOR 0.9.11-svn1 -$lng['serversettings']['panel_password_regex']['title'] = 'Espressione per le password'; -$lng['serversettings']['panel_password_regex']['description'] = 'Qui è possibile impostare una espressione regolare per la complessità delle password.
Vuoto = nessun requisito specificato'; -$lng['error']['notrequiredpasswordcomplexity'] = 'La complessita della password specificata non è soddisfacente.
Si prega di contattare l\'amministratore se avete domande sulla complessità della password'; - -// ADDED IN FROXLOR 0.9.11-svn2 -$lng['extras']['execute_perl'] = 'Esegui perl/CGI'; -$lng['admin']['perlenabled'] = 'Perl abilitato'; - -// ADDED IN FROXLOR 0.9.11-svn3 -$lng['serversettings']['perl_path']['title'] = 'Percorso perl'; -$lng['serversettings']['perl_path']['description'] = 'Rilevante solo se si utilizza lighttpd. Predefinito /usr/bin/perl'; - -// ADDED IN FROXLOR 0.9.12-svn1 -$lng['admin']['fcgid_settings'] = 'FCGID'; -$lng['serversettings']['mod_fcgid_ownvhost']['title'] = 'Abilita FCGID per i vhost Froxlor'; -$lng['serversettings']['mod_fcgid_ownvhost']['description'] = 'Se attivato, Froxlor verrà eseguito con un utente locale
ATTENZIONE:Questo richiede una configurazione manuale, vedi FCGID - handbook'; -$lng['admin']['mod_fcgid_user'] = 'Utente locale per FCGID (Froxlor vhost)'; -$lng['admin']['mod_fcgid_group'] = 'Gruppo locale per FCGID (Froxlor vhost)'; - -// ADDED IN FROXLOR 0.9.12-svn2 -$lng['admin']['perl_settings'] = 'Perl/CGI'; -$lng['serversettings']['perl']['suexecworkaround']['title'] = 'Abilita SuExec workaround (solo con Apache)'; -$lng['serversettings']['perl']['suexecworkaround']['description'] = 'Abilita solo se la docroots del cliente non sono all\'interno del percorso suexec di Apache
Se attivato, Froxlor genererà un link simbolico dalla cartella perl abilitata dei clienti + /cgi-bin/ al percorso specificato.
Nota: Perl funziona solo nelle sottocartelle /cgi-bin/ e non nella cartella stessa (come farebbe normalmente senza questa correzione!)'; -$lng['serversettings']['perl']['suexeccgipath']['title'] = 'Percorso dei link simbolici della cartella abilitata perl del cliente'; -$lng['serversettings']['perl']['suexeccgipath']['description'] = 'Imposta questo solo se la soluzione SuExec è abilitata.
ATTENZIONE: Assicurati che questo percorso sia all\'interno del percorso suexec oppure questa soluzione è inutile'; -$lng['panel']['descriptionerrordocument'] = 'Può essere un URL, un percorso ad un file o solo una stringa con un " "
Lasciare vuoto per usare il valore di default del server.'; -$lng['error']['stringerrordocumentnotvalidforlighty'] = 'Una stringa come ErrorDocument non funziona in lighttpd, si prega di specificare un percorso di un file'; -$lng['error']['urlerrordocumentnotvalidforlighty'] = 'Un URL come ErrorDocument non funziona in lighttpd, si prega di specificare un percorso di un file'; - -// ADDED IN FROXLOR 0.9.12-svn3 -$lng['question']['remove_subbutmain_domains'] = 'Rimuover anche i domini che sono stati aggiunti come domini completi, ma quali sono i sottodomini di questo dominio?'; -$lng['domains']['issubof'] = 'Questo dominio è un sottodominio di un altro dominio'; -$lng['domains']['issubofinfo'] = 'Devi impostare correttamente questo dominio se si desidera aggiungere un sottodominio come dominio completo (es. si vuole aggiungere "www.domain.tld", devi selezionare qui "domain.tld")'; -$lng['domains']['nosubtomaindomain'] = 'No sottodominio di un dominio completo'; -$lng['admin']['templates']['new_database_by_customer'] = 'Notifica al cliente quando un database è stato creato'; -$lng['admin']['templates']['new_ftpaccount_by_customer'] = 'Notifica al cliente quando un utente FTP è stato creato'; -$lng['admin']['templates']['newdatabase'] = 'Mail di notifica per i nuovi database'; -$lng['admin']['templates']['newftpuser'] = 'Mail di notifica per i nuovi utenti ftp'; -$lng['admin']['templates']['CUST_NAME'] = 'Nome del Cliente'; -$lng['admin']['templates']['DB_NAME'] = 'Nome del Database'; -$lng['admin']['templates']['DB_PASS'] = 'Password del Database'; -$lng['admin']['templates']['DB_DESC'] = 'Descrizione del Database'; -$lng['admin']['templates']['DB_SRV'] = 'Server del Database'; -$lng['admin']['templates']['PMA_URI'] = 'URL a phpMyAdmin (se presente)'; -$lng['admin']['notgiven'] = '[se presente]'; -$lng['admin']['templates']['USR_NAME'] = 'Nome utente FTP'; -$lng['admin']['templates']['USR_PASS'] = 'Password FTP'; -$lng['admin']['templates']['USR_PATH'] = 'Cartella utente FTP (rispetto alla cartella docroot del cliente)'; - -// ADDED IN FROXLOR 0.9.12-svn4 -$lng['serversettings']['awstats_awstatspath'] = 'Percorso AWStats \'awstats.pl\''; - -// ADDED IN FROXLOR 0.9.12-svn6 -$lng['extras']['htpasswdauthname'] = 'Argomento di Autenticazione (AuthName)'; -$lng['extras']['directoryprotection_edit'] = 'modifica la protezione della directory'; -$lng['admin']['templates']['forgotpwd'] = 'Mail di notifica per il reset della password'; -$lng['admin']['templates']['password_reset'] = 'Notifica al cliente per il reset della password'; - -// ADDED IN FROXLOR 0.9.14-svn1 -$lng['serversettings']['mod_fcgid']['defaultini_ownvhost'] = 'Configurazione di Default di PHP per Froxlor-vhost'; - -// ADDED IN FROXLOR 0.9.14-svn3 -$lng['serversettings']['awstats_icons']['title'] = 'Percorso della cartella delle icone di AWstats'; -$lng['serversettings']['awstats_icons']['description'] = 'es. /usr/share/awstats/htdocs/icon/'; - -// ADDED IN FROXLOR 0.9.14-svn5 -$lng['admin']['ipsandports']['docroot']['title'] = 'Imposta Cartella principale (vuoto = va in Froxlor)'; -$lng['admin']['ipsandports']['docroot']['description'] = 'Qui puoi definire una tua cartella principale (la destinazione di una richiesta) per questa combinazione IP/Porta.
ATTENZIONE: Fai molta attenzione a quello che scrivi qui!'; - -// ADDED IN FROXLOR 0.9.14-svn6 -$lng['serversettings']['login_domain_login'] = 'Permetti il login con i domini'; - -// ADDED IN FROXLOR 0.9.14 -$lng['panel']['unlock'] = 'unlock'; -$lng['question']['customer_reallyunlock'] = 'Sei sicuro di voler sbloccare il cliente %s?'; - -// ADDED IN FROXLOR 0.9.15-svn1 -$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend'; -$lng['serversettings']['nginx_php_backend']['description'] = 'questo è dove in ascolto il processo PHP per le richieste da nginx, può essere un socket unix combinazione IP:Porta'; -$lng['serversettings']['phpreload_command']['title'] = 'Comando riavvio PHP'; -$lng['serversettings']['phpreload_command']['description'] = 'questo viene utilizzato per ricaricare il backend PHP se è in uso
Predefinito: vuoto'; - -// ADDED IN FROXLOR 0.9.16 -$lng['error']['intvaluetoolow'] = 'Il numero dato è troppo basso (campo %s)'; -$lng['error']['intvaluetoohigh'] = 'Il numero dato è troppo alto (campo %s)'; -$lng['admin']['phpfpm_settings'] = 'PHP-FPM'; -$lng['serversettings']['phpfpm_settings']['configdir'] = 'Cartella di configurazione php-fpm'; -$lng['serversettings']['phpfpm_settings']['reload'] = 'comando di riavvio php-fpm'; -$lng['serversettings']['phpfpm_settings']['pm'] = 'Gestore processi (pm)'; -$lng['serversettings']['phpfpm_settings']['max_children']['title'] = 'Il numero di processi figli'; -$lng['serversettings']['phpfpm_settings']['max_children']['description'] = 'Il numero di processi figli che vengono creati quando il pm è impostato a \'static\' e il numero massimo di processi figli che vengono creati quando il pm è impostato a \'dynamic\'
Equivalente a PHP_FCGI_CHILDREN'; -$lng['serversettings']['phpfpm_settings']['start_servers']['title'] = 'Il numero di processi figli creati all\'avvio'; -$lng['serversettings']['phpfpm_settings']['start_servers']['description'] = 'Nota: Usato solo quando il pm è impostato a \'dynamic\''; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['title'] = 'Il numero minimo di processi inattivi nel server'; -$lng['serversettings']['phpfpm_settings']['min_spare_servers']['description'] = 'Nota: Usato solo quando il pm è impostato a \'dynamic\'
Nota: Obbligatorio quando il pm è impostato a \'dynamic\''; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['title'] = 'Il numero massimo di processi inattivi nel server'; -$lng['serversettings']['phpfpm_settings']['max_spare_servers']['description'] = 'Nota: Usato solo quando il pm è impostato a \'dynamic\'
Nota: Obbligatorio quando il pm è impostato a \'dynamic\''; -$lng['serversettings']['phpfpm_settings']['max_requests']['title'] = 'Richieste per figli prima di rigenerare'; -$lng['serversettings']['phpfpm_settings']['max_requests']['description'] = 'Per le richieste senza fine specificare \'0\'. Equivalente a PHP_FCGI_MAX_REQUESTS.'; -$lng['error']['phpfpmstillenabled'] = 'PHP-FPM è attivo. Si prega di disattivarlo prima di attivare FCGID'; -$lng['error']['fcgidstillenabled'] = 'FCGID è attivo. Si prega di disattivarlo prima di attivare PHP-FPM'; -$lng['phpfpm']['vhost_httpuser'] = 'Utente locale per PHP-FPM (Froxlor vHost)'; -$lng['phpfpm']['vhost_httpgroup'] = 'Gruppo locale per PHP-FPM (Froxlor vHost)'; -$lng['phpfpm']['ownvhost']['title'] = 'Abilita PHP-FPM per i vHost Froxlor'; -$lng['phpfpm']['ownvhost']['description'] = 'Se abilitato, Froxlor potrà essere avviato attraverso un utente locale'; - -// ADDED IN FROXLOR 0.9.17 -$lng['crondesc']['cron_usage_report'] = 'Invia i report di utilizzo web e del traffico'; -$lng['serversettings']['report']['report'] = 'Abilita l\'invio dei report di utilizzo web e del traffico'; -$lng['serversettings']['report']['webmax'] = 'Percentuale di avviso per lo spazio web'; -$lng['serversettings']['report']['trafficmax'] = 'Percentuale di avviso per il traffico'; -$lng['mails']['trafficmaxpercent']['mailbody'] = 'Salve {NAME},\n\nhai utilizzato {TRAFFICUSED} MB di {TRAFFIC} MB traffico disponibile.\nQuesto è più del {MAX_PERCENT}%.\n\nCordiali Saluti, il Team Froxlor'; -$lng['mails']['trafficmaxpercent']['subject'] = 'Raggiunto il limite di traffico'; -$lng['admin']['templates']['trafficmaxpercent'] = 'Mail di notifica per i clienti che hanno raggiunto il limite di traffico'; -$lng['admin']['templates']['MAX_PERCENT'] = 'Sostituito con spazio/limite di traffico per l\'invio dei report in precentuale.'; -$lng['admin']['templates']['USAGE_PERCENT'] = 'Sostituito con l\'utilizzo del disco/limite di traffico, che è stato esaurito da parte del cliente in percentuale.'; -$lng['admin']['templates']['diskmaxpercent'] = 'Mail di notifica per i clienti che hanno raggiunto il limite di spazio su disco'; -$lng['admin']['templates']['DISKAVAILABLE'] = 'Sostituito con il spazio utilizzato in MB, che è stato assegnato al cliente.'; -$lng['admin']['templates']['DISKUSED'] = 'Sostituito con il spazio utilizzato in MB, che è stato esaurito da parte del cliente.'; -$lng['serversettings']['dropdown'] = 'Dropdown'; -$lng['serversettings']['manual'] = 'Manuale'; -$lng['mails']['diskmaxpercent']['mailbody'] = 'Salve {NAME},\n\nhai utilizzato {DISKUSED} MB di {DISKAVAILABLE} MB di spazio disponibile.\nQuesto è più del {MAX_PERCENT}%.\n\nCordiali Saluti, il Team Froxlor'; -$lng['mails']['diskmaxpercent']['subject'] = 'Raggiungere il limite di spazio su disco'; -$lng['mysql']['database_edit'] = 'Modifica database'; - -// ADDED IN FROXLOR 0.9.18 -$lng['error']['domains_cantdeletedomainwithaliases'] = 'Non è possibile cancellare un dominio che viene utilizzato per alias-domains. È necessario eliminare prima gli alias.'; -$lng['serversettings']['default_theme'] = 'Tema predefinito'; -$lng['menue']['main']['changetheme'] = 'Cambia tema'; -$lng['panel']['theme'] = 'Tema'; -$lng['success']['rebuildingconfigs'] = 'Inseriti con successo i lavori per la ricostruzione del file di configurazione'; -$lng['panel']['variable'] = 'Variabile'; -$lng['panel']['description'] = 'Descrizione'; -$lng['emails']['back_to_overview'] = 'Torna indietro nel riepilogo'; - -// ADDED IN FROXLOR 0.9.20 -$lng['error']['user_banned'] = 'Il tuo account è stato bannato. Contatta l\'amministratore per maggiori informazioni.'; -$lng['serversettings']['validate_domain'] = 'Convalida dei domini'; -$lng['login']['combination_not_found'] = 'Combinazione utente-indirizzo email non trovata.'; -$lng['customer']['generated_pwd'] = 'Password suggerita'; -$lng['customer']['usedmax'] = 'Usato / Massimo'; -$lng['admin']['traffic'] = 'Traffico'; -$lng['admin']['domaintraffic'] = 'Domimi'; -$lng['admin']['customertraffic'] = 'Clienti'; -$lng['traffic']['customer'] = 'Cliente'; -$lng['traffic']['domain'] = 'Domini'; -$lng['traffic']['trafficoverview'] = 'Riepilogo del traffico di'; -$lng['traffic']['months']['jan'] = 'Gen'; -$lng['traffic']['months']['feb'] = 'Feb'; -$lng['traffic']['months']['mar'] = 'Mar'; -$lng['traffic']['months']['apr'] = 'Apr'; -$lng['traffic']['months']['may'] = 'Mag'; -$lng['traffic']['months']['jun'] = 'Giu'; -$lng['traffic']['months']['jul'] = 'Lug'; -$lng['traffic']['months']['aug'] = 'Ago'; -$lng['traffic']['months']['sep'] = 'Set'; -$lng['traffic']['months']['oct'] = 'Ott'; -$lng['traffic']['months']['nov'] = 'Nov'; -$lng['traffic']['months']['dec'] = 'Dic'; -$lng['traffic']['months']['total'] = 'Totale'; -$lng['traffic']['details'] = 'Dettagli'; -$lng['menue']['traffic']['table'] = 'Traffico'; - -$lng['error']['loginnameiswrong2'] = 'Il nome utente contiente troppi caratteri. Sono permessi soltanto %s caratteri.'; -$lng['question']['admin_customer_alsoremovemail'] = 'Eliminare completamente i dati della posta elettronica dal filesystem??'; -$lng['question']['admin_customer_alsoremoveftphomedir'] = 'Rimuovere anche la cartella homedir dell\'utente FTP?'; -$lng['admin']['templates']['SALUTATION'] = 'Sostituito con un saluto corretto (nome o azienda)'; -$lng['admin']['templates']['COMPANY'] = 'Sostituisce con il nome dell \'azienda del cliente'; -$lng['serversettings']['bindenable']['title'] = 'Abilita Nameserver'; -$lng['serversettings']['bindenable']['description'] = 'Qui il Nameserver può essere abilitato e disabilitato globalmente.'; -$lng['admin']['serversoftware'] = 'Software per Server'; -$lng['panel']['pathDescriptionEx'] = '

Se vuoi redirezionare ad un altro dominio, questo valore deve iniziare con http:// or https://.'; -$lng['panel']['pathDescriptionSubdomain'] = $lng['panel']['pathDescription'] . $lng['panel']['pathDescriptionEx'] . "

Se la URL termina con / è considerata una cartella, altrimenti verrà trattata come un file."; -$lng['admin']['configfiles']['wizard'] = 'Wizard (assistente)'; -$lng['admin']['configfiles']['http'] = 'Server WEB (HTTP)'; -$lng['admin']['configfiles']['dns'] = 'Nameserver (DNS)'; -$lng['admin']['configfiles']['mail'] = 'Server di posta elettronica (IMAP/POP3)'; -$lng['admin']['configfiles']['smtp'] = 'Server di posta elettronica (SMTP)'; -$lng['admin']['configfiles']['ftp'] = 'Server FTP'; -$lng['serversettings']['mysql_access_host']['title'] = 'Hosts Accesso MySQL'; -$lng['serversettings']['webalizer_quiet']['title'] = 'Webalizer output'; -$lng['serversettings']['ssl']['use_ssl']['title'] = 'Abilita utilizzo SSL'; -$lng['serversettings']['ssl']['use_ssl']['description'] = 'Spunta questo se vuoi usare SSL per il tuo server web'; -$lng['serversettings']['ssl']['ssl_cert_file']['title'] = 'Percorso al certificato SSL'; -$lng['serversettings']['ssl']['ssl_cert_file']['description'] = 'Specifica il percorso includendo il nome del file .crt o .pem (certificato principale)'; -$lng['serversettings']['default_vhostconf_domain']['description'] = 'Il contenuto di questo campo verrà incluso direttamente nella configurazione del contenitore del dominio vHost. ATTENZIONE: Non verrano verificati eventuali errori del codice contenuto. Se conterrà degli errori, vi è il rischio che il server WEB non si avvii più!'; -$lng['dns']['standardip'] = 'IP predefinito del server'; -$lng['dns']['cname_record'] = 'Record CNAME'; -$lng['dns']['standardmx'] = 'Record MX predefinito del server'; -$lng['dns']['mxconfig'] = 'Record MX personalizzati'; -$lng['dns']['priority10'] = 'Priorità 10'; -$lng['dns']['priority20'] = 'Priorità 20'; -$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Percorso al file di chiave SSL'; -$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specifica il percorso includendo il nome del file per la chiave privata (abitualmente.key)'; -$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Percorso al certificato della CA (autoritá certificatrice) SSL (opzionale)'; -$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Autenticazione client, da settare soltanto se desiderato.'; -$lng['cronjob']['cronjobintervalv'] = 'valore di intervallo Runtime'; -$lng['admin']['store_defaultindex'] = 'Archivio del file indice predefinito al percorso radice clienti'; -$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Percorso al file catena dei certificati SSL'; -$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Principalmente Bundle CA, o similare, presubilmente vuoi impostare questo se hai acquistato un certificato SSL.'; -$lng['serversettings']['phpfpm']['title'] = 'Abilita php-fpm'; -$lng['serversettings']['phpfpm']['description'] = 'Questa impostazione richiede una configurazione speciale del server web. Vedi il manuale PHP-FPM'; -$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configurazione cartella Alias per php-fpm'; -$lng['gender']['title'] = 'Titolo'; -$lng['gender']['male'] = 'Sig.'; -$lng['gender']['female'] = 'Sig.ra'; -$lng['gender']['undef'] = ''; -$lng['country']['AF'] = "Afganistan"; -$lng['country']['AX'] = "Isole Aland"; -$lng['country']['AL'] = "Albania"; -$lng['country']['DZ'] = "Algeria"; -$lng['country']['AS'] = "American Samoa"; -$lng['country']['AD'] = "Andorra"; -$lng['country']['AO'] = "Angola"; -$lng['country']['AI'] = "Anguilla"; -$lng['country']['AQ'] = "Antarctica"; -$lng['country']['AG'] = "Antigua and Barbuda"; -$lng['country']['AR'] = "Argentina"; -$lng['country']['AM'] = "Armenia"; -$lng['country']['AW'] = "Aruba"; -$lng['country']['AU'] = "Australia"; -$lng['country']['AT'] = "Austria"; -$lng['country']['AZ'] = "Azerbaijan"; -$lng['country']['BS'] = "Bahamas"; -$lng['country']['BH'] = "Bahrain"; -$lng['country']['BD'] = "Bangladesh"; -$lng['country']['BB'] = "Barbados"; -$lng['country']['BY'] = "Belarus"; -$lng['country']['BE'] = "Belgium"; -$lng['country']['BZ'] = "Belize"; -$lng['country']['BJ'] = "Benin"; -$lng['country']['BM'] = "Bermuda"; -$lng['country']['BT'] = "Bhutan"; -$lng['country']['BO'] = "Bolivia, Stato Plurinazionale della"; -$lng['country']['BQ'] = "Bonaire, Saint Eustatius e Saba"; -$lng['country']['BA'] = "Bosnia e Herzegovina"; -$lng['country']['BW'] = "Botswana"; -$lng['country']['BV'] = "Bouvet Island"; -$lng['country']['BR'] = "Brasile"; -$lng['country']['IO'] = "Territorio Britannico del oceano indiano"; -$lng['country']['BN'] = "Brunei Darussalam"; -$lng['country']['BG'] = "Bulgaria"; -$lng['country']['BF'] = "Burkina Faso"; -$lng['country']['BI'] = "Burundi"; -$lng['country']['KH'] = "Cambogia"; -$lng['country']['CM'] = "Camerun"; -$lng['country']['CA'] = "Canada"; -$lng['country']['CV'] = "Capo Verde"; -$lng['country']['KY'] = "Isole Cayman"; -$lng['country']['CF'] = "Repubblica dell'Africa Centrale"; -$lng['country']['TD'] = "Chad"; -$lng['country']['CL'] = "Chile"; -$lng['country']['CN'] = "Cina"; -$lng['country']['CX'] = "Isola di Natale"; -$lng['country']['CC'] = "Isole Cocos (Keeling)"; -$lng['country']['CO'] = "Colombia"; -$lng['country']['KM'] = "Comoros"; -$lng['country']['CG'] = "Congo"; -$lng['country']['CD'] = "Congo, Repubblica democratica del"; -$lng['country']['CK'] = "Isole Cook"; -$lng['country']['CR'] = "Costa Rica"; -$lng['country']['CI'] = "Costa D'avorio"; -$lng['country']['HR'] = "Croazia"; -$lng['country']['CU'] = "Cuba"; -$lng['country']['CW'] = "Curacao"; -$lng['country']['CY'] = "Cipro"; -$lng['country']['CZ'] = "Repubblica Ceca"; -$lng['country']['DK'] = "Danimarca"; -$lng['country']['DJ'] = "Djibouti"; -$lng['country']['DM'] = "Dominica"; -$lng['country']['DO'] = "Repubblica Dominicana"; -$lng['country']['EC'] = "Ecuador"; -$lng['country']['EG'] = "Egitto"; -$lng['country']['SV'] = "El Salvador"; -$lng['country']['GQ'] = "Guinea Equatoriale"; -$lng['country']['ER'] = "Eritrea"; -$lng['country']['EE'] = "Estonia"; -$lng['country']['ET'] = "Etiopia"; -$lng['country']['FK'] = "Isole Falkland (Malvinas)"; -$lng['country']['FO'] = "Isole Faroe"; -$lng['country']['FJ'] = "Fiji"; -$lng['country']['FI'] = "Finlandia"; -$lng['country']['FR'] = "Francia"; -$lng['country']['GF'] = "Guiana Francese"; -$lng['country']['PF'] = "Polinesia Francese"; -$lng['country']['TF'] = "Territori Francesi del Sud"; -$lng['country']['GA'] = "Gabon"; -$lng['country']['GM'] = "Gambia"; -$lng['country']['GE'] = "Georgia"; -$lng['country']['DE'] = "Germania"; -$lng['country']['GH'] = "Ghana"; -$lng['country']['GI'] = "Gibilterra"; -$lng['country']['GR'] = "Grecia"; -$lng['country']['GL'] = "Groenlandia"; -$lng['country']['GD'] = "Grenada"; -$lng['country']['GP'] = "Guadeloupe"; -$lng['country']['GU'] = "Guam"; -$lng['country']['GT'] = "Guatemala"; -$lng['country']['GG'] = "Guernsey"; -$lng['country']['GN'] = "Guinea"; -$lng['country']['GW'] = "Guinea-Bissau"; -$lng['country']['GY'] = "Guyana"; -$lng['country']['HT'] = "Haiti"; -$lng['country']['HM'] = "Isola Heard e Isola McDonald"; -$lng['country']['VA'] = "Stato del Vaticano"; -$lng['country']['HN'] = "Honduras"; -$lng['country']['HK'] = "Hong Kong"; -$lng['country']['HU'] = "Ungheria"; -$lng['country']['IS'] = "Islanda"; -$lng['country']['IN'] = "India"; -$lng['country']['ID'] = "Indonesia"; -$lng['country']['IR'] = "Iran, Repubblica Islamica del"; -$lng['country']['IQ'] = "Iraq"; -$lng['country']['IE'] = "Irlanda"; -$lng['country']['IM'] = "Isola Man"; -$lng['country']['IL'] = "Israele"; -$lng['country']['IT'] = "ITALIA"; -$lng['country']['JM'] = "Giamaica"; -$lng['country']['JP'] = "Giappone"; -$lng['country']['JE'] = "Jersey"; -$lng['country']['JO'] = "Giordania"; -$lng['country']['KZ'] = "Kazakistan"; -$lng['country']['KE'] = "Kenya"; -$lng['country']['KI'] = "Kiribati"; -$lng['country']['KP'] = "Corea, Repubblica popolare della"; -$lng['country']['KR'] = "Corea, Repubblica della"; -$lng['country']['KW'] = "Kuwait"; -$lng['country']['KG'] = "Kyrgyzstan"; -$lng['country']['LA'] = "Lao, Repubblica popolare del"; -$lng['country']['LV'] = "Lettonia"; -$lng['country']['LB'] = "Libano"; -$lng['country']['LS'] = "Lesotho"; -$lng['country']['LR'] = "Liberia"; -$lng['country']['LY'] = "Libia"; -$lng['country']['LI'] = "Liechtenstein"; -$lng['country']['LT'] = "Lituania"; -$lng['country']['LU'] = "Lussemburgo"; -$lng['country']['MO'] = "Macao"; -$lng['country']['MK'] = "Macedonia"; -$lng['country']['MG'] = "Madagascar"; -$lng['country']['MW'] = "Malawi"; -$lng['country']['MY'] = "Malesia"; -$lng['country']['MV'] = "Maldive"; -$lng['country']['ML'] = "Mali"; -$lng['country']['MT'] = "Malta"; -$lng['country']['MH'] = "Isole Marshall"; -$lng['country']['MQ'] = "Martinique"; -$lng['country']['MR'] = "Mauritania"; -$lng['country']['MU'] = "Mauritius"; -$lng['country']['YT'] = "Mayotte"; -$lng['country']['MX'] = "Messico"; -$lng['country']['FM'] = "Micronesia, Stati Federali del"; -$lng['country']['MD'] = "Moldavia"; -$lng['country']['MC'] = "Monaco"; -$lng['country']['MN'] = "Mongolia"; -$lng['country']['ME'] = "Montenegro"; -$lng['country']['MS'] = "Montserrat"; -$lng['country']['MA'] = "Marocco"; -$lng['country']['MZ'] = "Mozambico"; -$lng['country']['MM'] = "Myanmar"; -$lng['country']['NA'] = "Namibia"; -$lng['country']['NR'] = "Nauru"; -$lng['country']['NP'] = "Nepal"; -$lng['country']['NL'] = "Olanda"; -$lng['country']['NC'] = "Nuova Caledonia"; -$lng['country']['NZ'] = "Nuova Zelanda"; -$lng['country']['NI'] = "Nicaragua"; -$lng['country']['NE'] = "Niger"; -$lng['country']['NG'] = "Nigeria"; -$lng['country']['NU'] = "Niue"; -$lng['country']['NF'] = "Isole Norfolk"; -$lng['country']['MP'] = "Isole Mariana Settentrionali"; -$lng['country']['NO'] = "Norvegia"; -$lng['country']['OM'] = "Oman"; -$lng['country']['PK'] = "Pakistan"; -$lng['country']['PW'] = "Palau"; -$lng['country']['PS'] = "Territorio Occupato della Palestina"; -$lng['country']['PA'] = "Panama"; -$lng['country']['PG'] = "Papua Nuova Guinea"; -$lng['country']['PY'] = "Paraguay"; -$lng['country']['PE'] = "Peru"; -$lng['country']['PH'] = "Filippine"; -$lng['country']['PN'] = "Pitcairn"; -$lng['country']['PL'] = "Polonia"; -$lng['country']['PT'] = "Portogallo"; -$lng['country']['PR'] = "Porto Rico"; -$lng['country']['QA'] = "Qatar"; -$lng['country']['RE'] = "Reunion"; -$lng['country']['RO'] = "Romania"; -$lng['country']['RU'] = "Russia"; -$lng['country']['RW'] = "Ruanda"; -$lng['country']['BL'] = "Saint Barthelemy"; -$lng['country']['SH'] = "Saint Helena, Ascension and Tristan Da Cunha"; -$lng['country']['KN'] = "Saint Kitts and Nevis"; -$lng['country']['LC'] = "Saint Lucia"; -$lng['country']['MF'] = "Saint Martin (French Part)"; -$lng['country']['PM'] = "Saint Pierre and Miquelon"; -$lng['country']['VC'] = "Saint Vincent and the Grenadines"; -$lng['country']['WS'] = "Samoa"; -$lng['country']['SM'] = "San Marino"; -$lng['country']['ST'] = "Sao Tome and Principe"; -$lng['country']['SA'] = "Arabia Saudita"; -$lng['country']['SN'] = "Senegal"; -$lng['country']['RS'] = "Serbia"; -$lng['country']['SC'] = "Seychelles"; -$lng['country']['SL'] = "Sierra Leone"; -$lng['country']['SG'] = "Singapore"; -$lng['country']['SX'] = "Sint Maarten (Dutch Part)"; -$lng['country']['SK'] = "Slovacchia"; -$lng['country']['SI'] = "Slovenia"; -$lng['country']['SB'] = "Isole Solomon"; -$lng['country']['SO'] = "Somalia"; -$lng['country']['ZA'] = "Africa del Sud"; -$lng['country']['GS'] = "South Georgia and the South Sandwich Islands"; -$lng['country']['ES'] = "Spagna"; -$lng['country']['LK'] = "Sri Lanka"; -$lng['country']['SD'] = "Sudan"; -$lng['country']['SR'] = "Suriname"; -$lng['country']['SJ'] = "Svalbard and Jan Mayen"; -$lng['country']['SZ'] = "Swaziland"; -$lng['country']['SE'] = "Svezia"; -$lng['country']['CH'] = "Svizzera"; -$lng['country']['SY'] = "Siria"; -$lng['country']['TW'] = "Taiwan, Provincia della Cina"; -$lng['country']['TJ'] = "Tajikistan"; -$lng['country']['TZ'] = "Tanzania"; -$lng['country']['TH'] = "Tailandia"; -$lng['country']['TL'] = "Timor-Leste"; -$lng['country']['TG'] = "Togo"; -$lng['country']['TK'] = "Tokelau"; -$lng['country']['TO'] = "Tonga"; -$lng['country']['TT'] = "Trinidad and Tobago"; -$lng['country']['TN'] = "Tunisia"; -$lng['country']['TR'] = "Turchia"; -$lng['country']['TM'] = "Turkmenistan"; -$lng['country']['TC'] = "Turks and Caicos Islands"; -$lng['country']['TV'] = "Tuvalu"; -$lng['country']['UG'] = "Uganda"; -$lng['country']['UA'] = "Ucraina"; -$lng['country']['AE'] = "Emirati Arabi Uniti"; -$lng['country']['GB'] = "Gran Bretagna"; -$lng['country']['US'] = "Stati Uniti d'America"; -$lng['country']['UM'] = "Stati Uniti, Isole Minori"; -$lng['country']['UY'] = "Uruguay"; -$lng['country']['UZ'] = "Uzbekistan"; -$lng['country']['VU'] = "Vanuatu"; -$lng['country']['VE'] = "Venezuela"; -$lng['country']['VN'] = "Vietnam"; -$lng['country']['VG'] = "Isole Vergini Brittaniche"; -$lng['country']['VI'] = "Isole Vergini, U.S."; -$lng['country']['WF'] = "Wallis and Futuna"; -$lng['country']['EH'] = "Sahara Occidentale"; -$lng['country']['YE'] = "Yemen"; -$lng['country']['ZM'] = "Zambia"; -$lng['country']['ZW'] = "Zimbabue"; -$lng['diskquota'] = 'Quota'; -$lng['serversettings']['diskquota_enabled'] = 'Quota attivita?'; -$lng['serversettings']['diskquota_repquota_path']['description'] = 'Percorso a repquota'; -$lng['serversettings']['diskquota_quotatool_path']['description'] = 'Percorso al quotatool'; -$lng['serversettings']['diskquota_customer_partition']['description'] = 'Partizione, sulla quale sono salvati i dati dei clienti'; -$lng['tasks']['CREATE_QUOTA'] = 'Setta quota al filesystem'; -$lng['error']['session_timeout'] = 'Valore troppo basso'; -$lng['error']['session_timeout_desc'] = 'Non dovresti settare il timeout della sessione ad un valore minore di 1 minuto.'; -$lng['admin']['assignedmax'] = 'Assegnato / Max'; -$lng['admin']['usedmax'] = 'Usato / Max'; -$lng['admin']['used'] = 'Usato'; -$lng['mysql']['size'] = 'Dimensione'; -$lng['error']['invalidhostname'] = 'Il nome del Host non può essere vuoto o contenere spazi'; -$lng['traffic']['http'] = 'HTTP (MiB)'; -$lng['traffic']['ftp'] = 'FTP (MiB)'; -$lng['traffic']['mail'] = 'Mail (MiB)'; -$lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Timeout Inattività'; -$lng['serversettings']['mod_fcgid']['idle_timeout']['description'] = 'Impostazione Timeout per il Mod FastCGI.'; -$lng['serversettings']['phpfpm_settings']['idle_timeout']['title'] = 'Timeout Inattività'; -$lng['serversettings']['phpfpm_settings']['idle_timeout']['description'] = 'Impostazione Timeout per PHP5 FPM FastCGI.'; -$lng['panel']['cancel'] = 'Annulla'; -$lng['admin']['speciallogwarning'] = '
AVVISO: Cambiando questa impostazione perderai tutte le vecchie statistiche per questo dominio.
'; -$lng['serversettings']['vmail_maildirname']['title'] = 'nome Maildir'; -$lng['serversettings']['vmail_maildirname']['description'] = 'cartella Maildir nell account utente. Normalmente \'Maildir\', in alcune implementazioni \'.maildir\', e direttamente nella cartella utente se lasciato vuoto.'; -$lng['tasks']['DELETE_EMAIL_DATA'] = 'Elimina i dati di posta elettronica del cliente.'; -$lng['error']['operationnotpermitted'] = 'Operazione non permessa!'; -$lng['error']['featureisdisabled'] = 'Funzionalità %s è disabilitata. Perfavore contatta il tuo fornitore di servizi.'; -$lng['serversettings']['catchall_enabled']['title'] = 'Usa Catchall'; -$lng['serversettings']['catchall_enabled']['description'] = 'Vuoi offrire ai tuoi clienti la funzionalità di catchall?'; -$lng['serversettings']['apache_24']['title'] = 'Usa impostazioni per Apache 2.4'; -$lng['serversettings']['apache_24']['description'] = 'ATTENZIONE: spunta soltanto se hai installato la versione 2.4 o superiore di Apache
altrimenti il tuo server Web non si avvierà'; -$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Percorso al file fastcgi_params'; -$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specifica il percorso al file fastcgi_params di nginx includendo il nome del file'; -$lng['serversettings']['documentroot_use_default_value']['title'] = 'Usa il nome del dominio come valore predefinito per il percorso DocumentRoot (radice dei documenti)'; -$lng['serversettings']['documentroot_use_default_value']['description'] = 'Se abilitato ed il percorso radice DocumentRoot è vuoto, il valore predefinito sarà il nome del (sotto)dominio.

Esempio:
/var/customers/nome_cliente/example.com/
/var/customers/nome_cliente/sottodominio.example.com/'; -$lng['error']['usercurrentlydeactivated'] = 'L\'utente %s è attualmente disabilitato'; -$lng['admin']['speciallogfile']['title'] = 'File file log seperato'; -$lng['admin']['speciallogfile']['description'] = 'Spunta qui per un log di accesso separato per questo dominio'; -$lng['error']['setlessthanalreadyused'] = 'Non puoi impostare dei limiti minori per \'%s\', di quanto questo utente abbia già utilizzato
'; -$lng['error']['stringmustntbeempty'] = 'Il valore per il campo %s non può essere vuoto'; -$lng['admin']['domain_editable']['title'] = 'Permetti la modifica del dominio'; -$lng['admin']['domain_editable']['desc'] = 'Se settato a si, il cliente è abilitato a modificare varie impostazioni del dominio.
Se settato su no, il cliente non può modificare nulla.'; -$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['title'] = 'Nascondi i sottodominii predefiniti nel riepilogo di configurazione PHP'; -$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['description'] = 'Se attivato i sottodomini predefiniti dei clienti non saranno visualizzati nel riepilogo della configurazione php

Nota: Questo è solo visibile se avete abilitato FCGID o PHP-FPM'; -$lng['serversettings']['passwordcryptfunc']['title'] = 'Scegli quale metodo crittografico deve essere usato per le password'; -$lng['serversettings']['systemdefault'] = 'Predefinito di sistema'; -$lng['serversettings']['panel_allow_theme_change_admin'] = 'Permetti agli amministratori di cambiare il tema'; -$lng['serversettings']['panel_allow_theme_change_customer'] = 'Permetti ai clienti di cambiare il tema'; -$lng['serversettings']['axfrservers']['title'] = 'Server AXFR'; -$lng['serversettings']['axfrservers']['description'] = 'Un elenco separato da virgole di indirizzi IP autorizzati a trasferire zone dns (AXFR).'; -$lng['panel']['ssleditor'] = 'Impostazioni SSL per questo dominio'; -$lng['admin']['ipsandports']['ssl_paste_description'] = 'Incolla il contenuto completo del tuo certificato nella casella di testo'; -$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Contenuto del certificato ssl'; -$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Contenuto del file di chiave (privata) ssl'; -$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Contenuto del file ssl CA di autorità di certificazione (opzionale)'; -$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '

Autenticazione client, imposta questo settaggio soltanto se sai di cosa si tratta.'; -$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Contenuto del file di catena di certificato (opzionale)'; -$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '

Abitualmente Bundle CA o similare, probabilmente vuoi impostare questo settaggio se hai acquistato un certificato SSL.'; -$lng['error']['sslcertificateismissingprivatekey'] = 'Devi specificare una chiave privata per il tuo certificato'; -$lng['error']['sslcertificatewrongdomain'] = 'Il certificato fornito non appartiene a questo dominio'; -$lng['error']['sslcertificateinvalidcert'] = 'Il contenuto del certificato fornito non sembra essere un certificato valido'; -$lng['error']['sslcertificateinvalidcertkeypair'] = 'La chiave privata fornita non sembra appartenere al certificato fornito'; -$lng['error']['sslcertificateinvalidca'] = 'Il certificato CA fornito non sembra essere un certificato valido'; -$lng['error']['sslcertificateinvalidchain'] = 'I dati della catena di certificato non sembrano essere un certificato valido'; -$lng['serversettings']['customerssl_directory']['title'] = 'Cartella dei certificati ssl clienti del Webserver'; -$lng['serversettings']['customerssl_directory']['description'] = 'Dove devono esssere creati i certificati ssl cliente?

NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.
'; -$lng['admin']['phpfpm.ininote'] = 'Non tutti i valori che potresti volere settare possono essere usati nella configurazione del pool php-fpm.'; -$lng['crondesc']['cron_mailboxsize'] = 'Calcolo dimensioni caselle di posta'; -$lng['domains']['ipandport_multi']['title'] = 'Indirizzi IP'; -$lng['domains']['ipandport_multi']['description'] = 'Specifica uno o più indirizzi IP per il dominio.

NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come alias-domain di un altro dominio.
'; -$lng['domains']['ipandport_ssl_multi']['title'] = 'Indirizzi IP SSL'; -$lng['domains']['ssl_redirect']['title'] = 'Reindirizzamento SSL'; -$lng['domains']['ssl_redirect']['description'] = 'Questa opzione crea un reindirizzamento per vhosts non-sll in modo che tutte le richieste vengono reindirizzate ai SSL-vhost.

praticamente una richiesta a http://dominio.tld/ ti reindirizzera a https://dominio.tld/'; - -$lng['admin']['phpinfo'] = 'PHPinfo()'; -$lng['admin']['selectserveralias'] = 'valore ServerAlias per il dominio'; -$lng['admin']['selectserveralias_desc'] = 'Scegli se froxlor deve creare un settaggio wildcard (*.dominio.tld), o un alias WWW (www.dominio.tld) o nessun alias'; -$lng['domains']['serveraliasoption_wildcard'] = 'Wildcard (*.dominio.tld)'; -$lng['domains']['serveraliasoption_www'] = 'WWW (www.dominio.tld)'; -$lng['domains']['serveraliasoption_none'] = 'Nessun alias'; -$lng['error']['givendirnotallowed'] = 'La cartella fornita nel campo %s non è permessa.'; -$lng['serversettings']['ssl']['ssl_cipher_list']['title'] = 'Configura le cifrature SSL permesse'; -$lng['serversettings']['ssl']['ssl_cipher_list']['description'] = 'Questa è una lista di cifrature che vuoi (o non vuoi) usare nelle communicazioni SSL. Per una lista delle cifrature e come includerle od escluderle, vedi le sezioni "CIPHER LIST FORMAT" e "CIPHER STRINGS" sulla man-page per le cifrature.

Il valore predefinito è:
ECDHE-RSA-AES128-SHA256:AES128-GCM-SHA256:RC4:HIGH:!MD5:!aNULL:!EDH
'; -$lng['panel']['dashboard'] = 'Cruscotto'; -$lng['panel']['assigned'] = 'Assegnato'; -$lng['panel']['available'] = 'Disponibile'; -$lng['customer']['services'] = 'Servizi'; -$lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'Cartella FastCGI IPC'; -$lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'La cartella nella quale verrano salvati i socket php-fpm dal server web.
Questa cartella deve essere leggibile dal server Web'; -$lng['panel']['news'] = 'Notizie'; -$lng['error']['sslredirectonlypossiblewithsslipport'] = 'L\'utilizzo del reindirizzamento SSL è possibile soltanto quando il dominio ha almeno una combinazione IP/porta assegnata ed abilitata SSL.'; -$lng['error']['fcgidstillenableddeadlock'] = 'FCGID è attualmente attivo.
Perfavore disattivalo prima di cambiare ad un server web diverso da Apache2'; -$lng['error']['send_report_title'] = 'Invia rapporto errori'; -$lng['error']['send_report_desc'] = 'Grazie per aver communicato questo errore, aiutandoci a migliorare froxlor.
Questa è la mail che verrà inviata agli svillupatori di froxlor:'; -$lng['error']['send_report'] = 'Invia rapporto'; -$lng['error']['send_report_error'] = 'Errore nell invio del rapporto:
%s'; -$lng['error']['notallowedtouseaccounts'] = 'Il tuo account non permette l\'utilizzo di IMAP/POP3. Non puoi aggiungere account di posta elettronica.'; -$lng['pwdreminder']['changed'] = 'La tua password è stata aggiornata con successo. Puoi accedere con le tue nuove credenziali.'; -$lng['pwdreminder']['wrongcode'] = 'Ci dispiace, il tuo codice di attivazione non esiste o è già scaduto.'; -$lng['admin']['templates']['LINK'] = 'Sostituito con il link di azzeramento password cliente.'; -$lng['pwdreminder']['choosenew'] = 'Setta la nuova password'; -$lng['serversettings']['allow_error_report_admin']['title'] = 'Permetti agli amministratori/rivenditori di inviare errori di database a Froxlor'; -$lng['serversettings']['allow_error_report_admin']['description'] = 'Attenzione: Non inviarci MAI dati personali (dei clienti)!'; -$lng['serversettings']['allow_error_report_customer']['title'] = 'Permetti ai clienti di inviare errori di database a Froxlor'; -$lng['serversettings']['allow_error_report_customer']['description'] = 'Attenzione: Non inviarci MAI dati personali (dei clienti)!'; -$lng['admin']['phpsettings']['enable_slowlog'] = 'Abilita slowlog (per dominio)'; -$lng['admin']['phpsettings']['request_terminate_timeout'] = 'Richiedi terminate-timeout'; -$lng['admin']['phpsettings']['request_slowlog_timeout'] = 'Richiedi slowlog-timeout'; -$lng['admin']['templates']['SERVER_HOSTNAME'] = 'Sostituisce il nome host del sistema (URL a froxlor)'; -$lng['admin']['templates']['SERVER_IP'] = 'Sostituisce l\'indrizzo IP predefinito del server'; -$lng['admin']['templates']['SERVER_PORT'] = 'Sostituisce la porta predefinita del server'; -$lng['admin']['templates']['DOMAINNAME'] = 'Sostituisce il sottodominio predefinito dei clienti (può essere vuoto se non viene generato)'; -$lng['admin']['show_news_feed'] = 'Mostra il feed notizie sul cruscotto dell \'amministratore'; -$lng['logger']['reseller'] = "Rivenditore"; -$lng['logger']['admin'] = "Amministratore"; -$lng['logger']['cron'] = "Cronjob"; -$lng['logger']['login'] = "Login"; -$lng['logger']['intern'] = "Interno"; -$lng['logger']['unknown'] = "Sconosciuto"; -$lng['serversettings']['mailtraffic_enabled']['title'] = "Analizza traffico posta"; -$lng['serversettings']['mailtraffic_enabled']['description'] = "Abilita l\'analisi dei log del server di posta per calcolare il traffico"; -$lng['serversettings']['mdaserver']['title'] = "tipo MDA"; -$lng['serversettings']['mdaserver']['description'] = "Tipo del Server di consegna di posta"; -$lng['serversettings']['mdalog']['title'] = "log MDA"; -$lng['serversettings']['mdalog']['description'] = "File log del Server di consegna di posta"; -$lng['serversettings']['mtaserver']['title'] = "tipo MTA"; -$lng['serversettings']['mtaserver']['description'] = "Tipo agente di trasferimento di posta"; -$lng['serversettings']['mtalog']['title'] = "log MTA"; -$lng['serversettings']['mtalog']['description'] = "File log dell\'agente di trasferimento di posta"; -$lng['panel']['ftpdesc'] = 'Descrizione FTP'; -$lng['admin']['cronsettings'] = 'Impostazioni Cronjob'; -$lng['serversettings']['system_cronconfig']['title'] = 'File di configurazione Cron'; -$lng['serversettings']['system_cronconfig']['description'] = 'Percorso al file di configurazione del servizio cron. Questo file verrà aggiornato regolarmente ed automaticamente da froxlor.
-Nota: Perfavore sii sicuro di usare lo stesso nome di file come per il cronjob principale di froxlor (predefinito: /etc/cron.d/froxlor)!

Se usi FreeBSD, qui specifica: /etc/crontab!'; -$lng['tasks']['DELETE_FTP_DATA'] = 'Elimina i dati account-ftp del cliente.'; -$lng['tasks']['REBUILD_CRON'] = 'Ricostruisci il file cron.d'; -$lng['serversettings']['system_crondreload']['title'] = 'Commando per riavviare il servizio Cron'; -$lng['serversettings']['system_crondreload']['description'] = 'Specifica il commando da eseguire per riavviare il servizio cron del tuo sistema'; -$lng['admin']['integritycheck'] = 'Validazione Database'; -$lng['admin']['integrityid'] = '#'; - -$lng['admin']['integrityname'] = 'Nome'; -$lng['admin']['integrityresult'] = 'Risultato'; -$lng['admin']['integrityfix'] = 'Risolvi problemi automaticamente'; -$lng['question']['admin_integritycheck_reallyfix'] = 'Vuoi veramente provare a risolvere i problemi di integrità del database automaticamente?'; -$lng['serversettings']['system_croncmdline']['title'] = 'Commando di esecuzione Cron (binario php)'; -$lng['serversettings']['system_croncmdline']['description'] = 'Commando per eseguire i nostri cronjob. Modificalo soltanto se sai cosa stai facendo (predefinito: "/usr/bin/nice -n 5 /usr/bin/php -q")!'; -$lng['error']['cannotdeletehostnamephpconfig'] = 'Questa configurazione PHP è utilizzata dal vhost Froxlor e non può essere eliminata.'; -$lng['error']['cannotdeletedefaultphpconfig'] = 'Questa configurazione PHP è impostata come predefinita e non può essere eliminata.'; -$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Permetti aggiornamenti automatici del database'; -$lng['serversettings']['system_cron_allowautoupdate']['description'] = '
ATTENZIONE:
Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.

l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione
'; -$lng['error']['passwordshouldnotbeusername'] = 'La password deve essere diversa dal nome utente.'; -$lng['admin']['customer_show_news_feed'] = "Mostra feed di notizie personalizzati sul cruscotto dei clienti"; -$lng['admin']['customer_news_feed_url'] = "Feed RSS- per il feed di notizie personalizzato"; -$lng['serversettings']['dns_createhostnameentry'] = "Crea la zone/config di bind per il nome host del sistema"; -$lng['serversettings']['panel_password_alpha_lower']['title'] = 'Caratteri minuscoli'; -$lng['serversettings']['panel_password_alpha_lower']['description'] = 'La Password deve contenere almeno una lettera minuscola (a-z).'; -$lng['serversettings']['panel_password_alpha_upper']['title'] = 'Caratteri maiuscoli'; -$lng['serversettings']['panel_password_alpha_upper']['description'] = 'La Password deve contenere almeno una lettere maiuscola (A-Z).'; -$lng['serversettings']['panel_password_numeric']['title'] = 'Numeri'; -$lng['serversettings']['panel_password_numeric']['description'] = 'La Password deve contenere almeno un numero (0-9).'; -$lng['serversettings']['panel_password_special_char_required']['title'] = 'Caratteri speciali'; -$lng['serversettings']['panel_password_special_char_required']['description'] = 'La Password deve contenere almeno uno dei caratteri speciali definiti nel campo sottostante.'; -$lng['serversettings']['panel_password_special_char']['title'] = 'Lista dei caratteri speciali'; -$lng['serversettings']['panel_password_special_char']['description'] = 'Uno di questi caratteri è richiesto se è attivata l\'opzione soprastante.'; -$lng['phpfpm']['use_mod_proxy']['title'] = 'Usa mod_proxy / mod_proxy_fcgi'; -$lng['phpfpm']['use_mod_proxy']['description'] = 'Attiva l\'utilizzo di php-fpm attraverso mod_proxy_fcgi. Richiede almeno apache-2.4.9'; -$lng['error']['no_phpinfo'] = 'Ci dispiace, impossibile leggere phpinfo()'; -$lng['admin']['movetoadmin'] = 'Trasferisci cliente'; -$lng['admin']['movecustomertoadmin'] = 'Trasferisci cliente all\'amministratore/rivenditore selezionato
Lascia questo vuoto per nessuna modifica.
Se l\'amministratore desiderato non appare nella lista, il suo massimale di clienti e stato ragggiunto.'; -$lng['error']['moveofcustomerfailed'] = 'Trasferimento del cliente all\'amministratore/rivenditore selezionato fallito. Considera che tutte le altre modfiche al cliente sono state applicate con successo a questa fase.

Messaggio d\'errore: %s'; -$lng['domains']['domain_import'] = 'Importa Dominii'; -$lng['domains']['import_separator'] = 'Separatore'; -$lng['domains']['import_offset'] = 'Offset'; -$lng['domains']['import_file'] = 'File CSV'; -$lng['success']['domain_import_successfully'] = 'Importato %s dominii con successo.'; -$lng['error']['domain_import_error'] = 'Il seguente errore è occorsonell \'importazione di dominii: %s'; -$lng['admin']['note'] = 'Nota'; -$lng['domains']['import_description'] = 'Per ottenere informazioni dettagliate sulla struttura del file di importazione e su come importare con successo, visita https://docs.froxlor.org/adminguide/domainimport.html'; -$lng['usersettings']['custom_notes']['title'] = 'Note personali'; -$lng['usersettings']['custom_notes']['description'] = 'Sentiti libero di inserire qualsi nota vuoi o necessiti qui. Apparirano nel riepilogo dell\'amministratore/cliente perl \'utente corrispondente.'; -$lng['usersettings']['custom_notes']['show'] = 'Mostra le tue note nel cruscotto dell\'utente'; diff --git a/lng/lng_references.php b/lng/lng_references.php deleted file mode 100644 index 2888839f..00000000 --- a/lng/lng_references.php +++ /dev/null @@ -1,43 +0,0 @@ - - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Error References Mapping (do not need to be translated) - */ -$lng['error']['myloginname'] = '\'' . $lng['login']['username'] . '\''; -$lng['error']['mypassword'] = '\'' . $lng['login']['password'] . '\''; -$lng['error']['oldpassword'] = '\'' . $lng['changepassword']['old_password'] . '\''; -$lng['error']['newpassword'] = '\'' . $lng['changepassword']['new_password'] . '\''; -$lng['error']['newpasswordconfirm'] = '\'' . $lng['changepassword']['new_password_confirm'] . '\''; -$lng['error']['myname'] = '\'' . $lng['customer']['name'] . '\''; -$lng['error']['myfirstname'] = '\'' . $lng['customer']['firstname'] . '\''; -$lng['error']['emailadd'] = '\'' . $lng['customer']['email'] . '\''; -$lng['error']['domainname'] = $lng['domains']['domainname']; - -/** - * other language-strings which need no translation - */ -$lng['domains']['ipandport_ssl_multi']['description'] = $lng['domains']['ipandport_multi']['description']; - -$lng['success']['noupdatesavail'] = $lng['update']['noupdatesavail']; -$lng['error']['autoupdate_3'] = $lng['error']['customized_version']; -$lng['menue']['logger']['logger'] = $lng['admin']['loggersystem']; - -$lng['serversettings']['default_sslvhostconf']['description'] = $lng['serversettings']['default_vhostconf']['description']; -$lng['admin']['include_ownvhostsettings'] = $lng['serversettings']['includedefault_sslvhostconf']; -$lng['error']['noemaildomainaddedyet'] = $lng['emails']['noemaildomainaddedyet']; diff --git a/lng/nl.lng.php b/lng/nl.lng.php new file mode 100644 index 00000000..fb7b057f --- /dev/null +++ b/lng/nl.lng.php @@ -0,0 +1,1158 @@ + + * @author Sander Klein + * @author Frits Letteboer + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + 'admin' => [ + 'overview' => 'Overzicht', + 'ressourcedetails' => 'Gebruikte resources', + 'systemdetails' => 'Systeem Details', + 'installedversion' => 'Geïnstalleerde Versie', + 'latestversion' => 'Laatste Versie', + 'lookfornewversion' => [ + 'clickhere' => 'zoeken via webservice', + 'error' => 'Fout tijdens lezen', + ], + 'customer' => 'Klant', + 'customers' => 'Klanten', + 'customer_add' => 'Maak klant', + 'customer_edit' => 'Bewerk klant', + 'domains' => 'Domeinen', + 'domain_add' => 'Maak domein', + 'domain_edit' => 'Bewerk domein', + 'subdomainforemail' => 'Subdomein als emaildomein', + 'admin' => 'Beheerder', + 'admins' => 'Beheerders', + 'admin_add' => 'Maak beheerder', + 'admin_edit' => 'Bewerk beheerder', + 'customers_see_all' => 'Kan alle klanten zien?', + 'domains_see_all' => 'Kan alle domeinen zien?', + 'change_serversettings' => 'Kan server instellingen aanpassen?', + 'serversettings' => 'Instellingen', + 'rebuildconf' => 'Configuratie bestanden opnieuw aanmaken', + 'stdsubdomain' => 'Standaard subdomein', + 'stdsubdomain_add' => 'Maak standard subdomein', + 'deactivated' => 'Gedeactiveerd', + 'deactivated_user' => 'Gebruiker deactiveren', + 'sendpassword' => 'Verstuur wachtwoord', + 'ownvhostsettings' => 'Eigen vHost-Instellingen', + 'configfiles' => [ + 'serverconfiguration' => 'Configuratie', + 'overview' => 'Overzicht', + 'wizard' => 'Wizard', + 'distribution' => 'Distributie', + 'service' => 'Dienst', + 'etc' => 'Overigen (Systeem)', + 'choosedistribution' => '-- Kies een distributie --', + 'chooseservice' => '-- Kies een dienst --', + 'choosedaemon' => '-- Kies een daemon --', + 'statistics' => 'Statistieken', + 'compactoverview' => 'Compacte weergave', + ], + 'templates' => [ + 'templates' => 'Sjablonen', + 'template_add' => 'Maak sjabloon', + 'template_edit' => 'Bewerk sjabloon', + 'action' => 'Actie', + 'email' => 'E-Mail', + 'subject' => 'Onderwerp', + 'mailbody' => 'Mail inhoud', + 'createcustomer' => 'Welkomst bericht voor nieuwe klanten', + 'pop_success' => 'Welkomst bericht voor e-mail nieuw account', + 'template_replace_vars' => 'Variabelen die aangepast worden in het sjabloon:', + 'FIRSTNAME' => 'Vervangen door de voornaam van de klant.', + 'NAME' => 'Vervangen door de naam van de klant.', + 'USERNAME' => 'Vervangen door de gebruikersnaam van de klant.', + 'PASSWORD' => 'Vervangen door het wachtwoord van de klant.', + 'EMAIL' => 'Vervangen door het adres van het POP3/IMAP account.', + 'TRAFFIC' => 'Wordt vervangen door aan klant toegewezen dataverkeer.', + 'TRAFFICUSED' => 'Wordt vervangen door het verbruikte dataverkeer.', + 'pop_success_alternative' => 'Welkomstmail voor nieuwe emailaccounts, gestuurd naar een alternatief emailadres', + 'EMAIL_PASSWORD' => 'Vervangen door het POP3/IMAP-wachtwoord.', + 'index_html' => 'Standaardpagina voor nieuwe mappen/domeinen', + 'SERVERNAME' => 'Wordt vervangen door de naam van de server.', + 'CUSTOMER' => 'Wordt vervangen door de inlognaam van de klant.', + 'ADMIN' => 'Wordt vervangen door de inlognaam van de beheerder.', + 'CUSTOMER_EMAIL' => 'Wordt vervangen door het e-mailadres van de klant.', + 'ADMIN_EMAIL' => 'Wordt vervangen door het e-mailadres van de beheerder.', + 'filetemplates' => 'Bestandssjablonen', + 'filecontent' => 'Bestandsinhoud', + 'new_database_by_customer' => 'Klantnotificatie wanneer een database is aangemaakt', + 'new_ftpaccount_by_customer' => 'Klantnotificatie wanneer een FTP-gebruiker is aangemaakt', + 'newdatabase' => 'Notificatie mails voor nieuwe databases', + 'newftpuser' => 'Notificatie mails voor nieuwe FTP-gebruikers', + 'CUST_NAME' => 'Naam klant', + 'DB_NAME' => 'Naam database', + 'DB_PASS' => 'Wachtwoord database', + 'DB_DESC' => 'Beschrijving database', + 'DB_SRV' => 'Database server', + 'PMA_URI' => 'URL naar phpMyAdmin (indien opgegeven)', + 'USR_NAME' => 'Gebruikersnaam FTP', + 'USR_PASS' => 'Wachtwoord FTP', + 'USR_PATH' => 'Map FTP (relatief aan docroot van klant)', + 'forgotpwd' => 'Notificatie mails voor opnieuw instellen wachtwoord', + 'password_reset' => 'Klantnotificatie voor opnieuw instellen wachtwoord', + ], + 'ipsandports' => [ + 'ipsandports' => 'IP-adressen en Poorten', + 'add' => 'Maak IP/Poort', + 'edit' => 'Bewerk IP/Poort', + 'ipandport' => 'IP/Poort', + 'ip' => 'IP', + 'port' => 'Poort', + 'create_listen_statement' => '\'Listen\'-regel genereren', + 'create_namevirtualhost_statement' => '\'NameVirtualHost\'-regel genereren', + 'create_vhostcontainer' => 'vHost-Container genereren', + 'create_vhostcontainer_servername_statement' => '\'ServerName\'-regel vHost-Container genereren', + 'enable_ssl' => 'Is dit een SSL-poort?', + 'ssl_cert_file' => 'Pad naar SSL-certificaat', + 'webserverdefaultconfig' => 'Standaarconfiguratie webserver', + 'webserverdomainconfig' => 'Domeinconfiguratie webserver', + 'webserverssldomainconfig' => 'SSL-configuratie webserver', + 'ssl_key_file' => 'Pad naar SSL keyfile', + 'ssl_ca_file' => 'Pad naar SSL CA certificaat', + 'default_vhostconf_domain' => 'Standaard VHost-instellingen voor iedere domeincontainer', + 'docroot' => [ + 'title' => 'Aangepaste docroot (leeg = verwijzing naar Froxlor)', + 'description' => 'U kunt voor deze IP/poortcombinatie een aangepaste document-root opgeven.
LET OP: Pas op wat u hier neerzet!', + ], + ], + 'memorylimitdisabled' => 'Gedeactiveerd', + 'valuemandatory' => 'Deze waarde is verplicht', + 'valuemandatorycompany' => 'De waarde "naam" en "voornaam" of "bedrijf" moet ingevoerd worden', + 'phpversion' => 'PHP-Versie', + 'phpmemorylimit' => 'PHP-Geheugen-Limiet', + 'mysqlserverversion' => 'MySQL Server Versie', + 'mysqlclientversion' => 'MySQL Client Versie', + 'accountsettings' => 'Account-instellingen', + 'panelsettings' => 'Paneel-instellingen', + 'systemsettings' => 'Systeem-instellingen', + 'webserversettings' => 'Webserver-instellingen', + 'mailserversettings' => 'Mailserver-instellingen', + 'nameserversettings' => 'Nameserver-instellingen', + 'updatecounters' => 'Gebruikte bronnen herberekenen', + 'subcanemaildomain' => [ + 'never' => 'Nooit', + 'choosableno' => 'Kiesbaar, standaard nee', + 'choosableyes' => 'Kiesbaar, standaard ja', + 'always' => 'Altijd', + ], + 'webalizersettings' => 'Instellingen voor Webalizer', + 'webalizer' => [ + 'normal' => 'Normaal', + 'quiet' => 'Stil', + 'veryquiet' => 'Geen uitvoer', + ], + 'domain_nocustomeraddingavailable' => 'Het is niet mogelijk een domein toe te voegen. U dient tenminste een klant aan te maken.', + 'loggersettings' => 'Instellingen voor logs', + 'logger' => [ + 'normal' => 'normaal', + 'paranoid' => 'paranoide', + ], + 'loggersystem' => 'Systeemlog', + 'emaildomain' => 'Emaildomein', + 'email_only' => 'Alleen email?', + 'wwwserveralias' => 'Voeg een "www." ServerAlias toe', + 'subject' => 'Onderwerp', + 'recipient' => 'Ontvanger', + 'message' => 'Bericht schrijven', + 'text' => 'Bericht', + 'sslsettings' => 'Instellingen voor SSL', + 'dkimsettings' => 'Instellingen voor DomainKeys', + 'allips' => 'Alle IP\'s', + 'awstatssettings' => 'Instellingen voor AWstats', + 'domain_dns_settings' => 'DNS-instellingen voor domein', + 'activated' => 'Geactiveerd', + 'statisticsettings' => 'Instellingen voor statistieken', + 'or' => 'of', + 'sysload' => 'Systeembelasting', + 'noloadavailable' => 'niet beschikbaar', + 'nouptimeavailable' => 'niet beschikbaar', + 'nosubject' => '(Geen onderwerp)', + 'security_settings' => 'Beveiliging', + 'know_what_youre_doing' => 'Verander dit alleen wanneer u zeker weet wat u doet!', + 'show_version_login' => [ + 'title' => 'Toon versie van Froxlor bij het inloggen', + 'description' => 'Toont de versie van Froxlor in de voettekst van de inlogpagina', + ], + 'show_version_footer' => [ + 'title' => 'Toon versie van Froxlor in de voettekst', + 'description' => 'Toont de versie van Froxlor in de voettekst op de rest van de pagina\'s', + ], + 'froxlor_graphic' => [ + 'title' => 'Kopgrafiek voor Froxlor', + 'description' => 'Afbeelding die getoond wordt in de kop', + ], + 'phpsettings' => [ + 'title' => 'PHP Configuratie', + 'description' => 'Korte omschrijven', + 'actions' => 'Actie\'s', + 'activedomains' => 'Wordt gebruikt door domein(en)', + 'notused' => 'Configuratie niet in gebruik', + 'editsettings' => 'Instellingen voor PHP aanpassen', + 'addsettings' => 'Nieuwe instellingen voor PHP aanmaken', + 'viewsettings' => 'Instellingen voor PHP weergeven', + 'phpinisettings' => 'Instellingen in php.ini', + 'addnew' => 'Nieuwe instellingen aanmaken', + 'binary' => 'PHP Uitvoerbaar bestand', + 'file_extensions' => 'Bestandsextensies', + 'file_extensions_note' => '(zonder punt, gescheiden door spaties)', + ], + 'misc' => 'Diversen', + 'phpconfig' => [ + 'template_replace_vars' => 'Variabelen die worden vervangen in de instellingen', + 'pear_dir' => 'Wordt vervangen door de globale pear-map.', + 'open_basedir_c' => 'Voegt een ; (puntkomma) toe om open_basedir in- of uit te schakelen', + 'open_basedir' => 'Wordt vervangen door de open_basedir-instellingen voor het domein.', + 'tmp_dir' => 'Wordt vervangen door de tijdelijke map voor dit domein', + 'open_basedir_global' => 'Wordt vervangen door de globale waarde van het pad dat wordt toegevoegd aan de open_basedir.', + 'customer_email' => 'Wordt vervangen door het e-mailadres van de klant van het domein.', + 'admin_email' => 'Wordt vervangen door het e-mailadres van de beheerder van het domein.', + 'domain' => 'Wordt vervangen door het domein.', + 'customer' => 'Wordt vervangen door de loginnaam van de eigenaar van het domein.', + 'admin' => 'Wordt vervangen door de loginnaam van de beheerder van het domein.', + ], + 'expert_settings' => 'Instellingen voor experts!', + 'mod_fcgid_starter' => [ + 'title' => 'Aantal PHP-processen voor dit domein. (Leeg betekent standaardinstellingen.)', + ], + 'phpserversettings' => 'PHP Instellingen', + 'mod_fcgid_maxrequests' => [ + 'title' => 'Maximaal aantal PHP verzoeken voor dit domein (leeg geldt als standaardwaarde)', + ], + 'spfsettings' => 'SPF-instellingen domein', + 'specialsettingsforsubdomains' => 'Speciale instellingen toepassen op alle subdomeinen (*.example.com)', + 'accountdata' => 'Accountgegevens', + 'contactdata' => 'Contactgegevens', + 'servicedata' => 'Ondersteuningsgegevens', + 'newerversionavailable' => 'Er is een nieuwe versie van Froxlor beschikbaar', + 'cron' => [ + 'cronsettings' => 'Instellingen cron-taken', + 'add' => 'Cron-taak toevoegen', + ], + 'cronjob_edit' => 'Cron-taak aanpassen', + 'warning' => 'WAARSCHUWING - Let op!', + 'lastlogin_succ' => 'Laatste login', + 'ftpserver' => 'FTP Server', + 'ftpserversettings' => 'Instellingen FTP-server', + 'webserver_user' => 'Gebruikersnaam webserver', + 'webserver_group' => 'Groepnaam webserver', + 'perlenabled' => 'Perl ingeschakeld', + 'fcgid_settings' => 'FCGID', + 'mod_fcgid_user' => 'Lokale gebruiker voor FCGID (Froxlor vhost)', + 'mod_fcgid_group' => 'Lokale groep voor FCGID (Froxlor vhost)', + 'perl_settings' => 'Perl/CGI', + 'notgiven' => '[niet opgegeven]', + 'store_defaultindex' => 'Standaard indexbestand opslaan in map klant', + 'phpfpm_settings' => 'PHP-FPM', + ], + 'changepassword' => [ + 'old_password' => 'Oud wachtwoord', + 'new_password' => 'Nieuw wachtwoord', + 'new_password_confirm' => 'Nieuw wachtwoord (bevestigen)', + 'new_password_ifnotempty' => 'Nieuw wachtwoord (leeg = niet veranderen)', + 'also_change_ftp' => ' wijzig ook het wachtwoord van het hoofd FTP account', + 'also_change_stats' => ' wijzig ook het wachtwoord van de statistieken', + ], + 'cron' => [ + 'cronname' => 'naam cron-taak', + 'lastrun' => 'laatst uitgevoerd', + 'interval' => 'interval', + 'isactive' => 'actief', + 'description' => 'beschrijving', + 'changewarning' => 'Het aanpassen van de ze waarden kunnen van negatieve invloed zijn op het gedrag van Froxlor en haar geautomatiseerde taken.
Pas deze waarden alleen aan wanneer u *zeer zeker* bent van wat u doet.', + ], + 'crondesc' => [ + 'cron_unknown_desc' => 'geen beschrijving opgegeven', + 'cron_tasks' => 'aanmaken configuratiebestanden', + 'cron_legacy' => 'oude cron-taak', + 'cron_traffic' => 'berekenen verkeersgegevens', + ], + 'cronjob' => [ + 'cronjobsettings' => 'Instellingen cron-taak', + 'cronjobinterval' => 'Interval uitvoeren', + ], + 'cronjobs' => [ + 'notyetrun' => 'Nog niet uitgevoerd', + ], + 'cronmgmt' => [ + 'seconds' => 'seconden', + 'minutes' => 'minuten', + 'hours' => 'uren', + 'days' => 'days', + 'weeks' => 'weken', + 'months' => 'maanden', + ], + 'customer' => [ + 'name' => 'Naam', + 'firstname' => 'Voornaam', + 'company' => 'Bedrijfsnaam', + 'street' => 'Straat', + 'zipcode' => 'Postcode', + 'city' => 'Plaats', + 'phone' => 'Telefoonnummer', + 'fax' => 'Faxnummer', + 'email' => 'Email', + 'customernumber' => 'Klant ID', + 'diskspace' => 'Webruimte (MB)', + 'traffic' => 'Verkeer (GB)', + 'emails' => 'E-mail-Adressen', + 'subdomains' => 'Sub-Domein(en)', + 'domains' => 'Domein(en)', + 'title' => 'Titel', + 'country' => 'Land', + 'email_quota' => 'quotem voor e-mail', + 'email_imap' => 'E-mail IMAP', + 'email_pop3' => 'E-mail POP3', + 'mail_quota' => 'Mailquotum', + 'sendinfomail' => 'Stuur gegevens naar mij via e-mail', + ], + 'dkim' => [ + 'dkim_prefix' => [ + 'title' => 'Prefix', + 'description' => 'Geef het pad naar de DKIM RSA-files alsook naar de configuratie van de Milter-plugin', + ], + 'dkim_domains' => [ + 'title' => 'Bestandsnaam domeinen', + 'description' => 'Bestandsnaam van het DKIM Domains-parameter zoals aangegeven in de configuratie van dkim-milter', + ], + 'dkim_dkimkeys' => [ + 'title' => 'KeyList filename', + 'description' => 'Bestandsnaam van het DKIM KeyList-parameter zoals aangegeven in de configuratie van dkim-milter', + ], + 'dkimrestart_command' => [ + 'title' => 'Herstart-commando voor Milter', + 'description' => 'Geef het commando om de milter-plugin te herstarten', + ], + 'use_dkim' => [ + 'title' => 'Activeer ondersteuning voor DKIM?', + 'description' => 'Wilt u gebruikmaken van Domain Keys (DKIM) systeem?', + ], + 'dkim_algorithm' => [ + 'title' => 'Toegestane hash-algoritmen', + 'description' => 'Toegestane hash-algoritmen, kies "Alle" voor alle algoritmen of 1 of meerdere van onderstaande', + ], + 'dkim_servicetype' => 'Type services', + 'dkim_keylength' => [ + 'title' => 'Lengte sleutel', + 'description' => 'Let op: Indien u deze waarde wijzigt, dient u allen geheime en publieke sleutels in "%s" te verwijderen', + ], + 'dkim_notes' => [ + 'title' => 'Notities voor DKIM', + 'description' => 'Notities die van belang kunnen zijn voor mensen, bijvoorbeeld een URL als http://www.dnswatch.info. Geen enkel programma zal deze informatie verwerken. Deze informatie dient schaars te zijn gezien de beperkte ruimte in DNS. Dit is bedoeld voor beheerders, niet voor eindgebruikers.', + ], + ], + 'dns' => [ + 'destinationip' => 'IP domein', + 'standardip' => 'Standaard server IP', + 'a_record' => 'A-record (IPv6 optioneel)', + 'cname_record' => 'CNAME-record', + 'mxrecords' => 'MX-records', + 'standardmx' => 'Standaard server MX-record', + 'mxconfig' => 'Aangepaste MX-records', + 'priority10' => 'Prioriteit 10', + 'priority20' => 'Prioriteit 20', + 'txtrecords' => 'TXT-records', + 'txtexample' => 'Voorbeeld (SPF-regel):
v=spf1 ip4:xxx.xxx.xx.0/23 -all', + ], + 'domain' => [ + 'openbasedirpath' => 'OpenBasedir-pad', + 'docroot' => 'Pad van bovenstaand veld', + 'homedir' => 'Home directory', + ], + 'domains' => [ + 'description' => 'Hier kunt u nieuwe (sub-) domeinen maken en de paden aanpassen.
Het systeem heeft een paar minuten nodig om de wijzigingen door te voeren na iedere varandering.', + 'domainsettings' => 'Domein instellingen', + 'domainname' => 'Domeinnaam', + 'subdomain_add' => 'Maak subdomein', + 'subdomain_edit' => 'Bewerk (sub)domein', + 'wildcarddomain' => 'Maak als wildcarddomein?', + 'aliasdomain' => 'Alias voor domein', + 'noaliasdomain' => 'Geen alias domein', + 'hasaliasdomains' => 'Heeft alias domein(en)', + 'statstics' => 'Gebruiksstatistieken', + 'isassigneddomain' => 'Is toegewezen domein', + 'add_date' => 'Toegevoegd aan Froxlor', + 'registration_date' => 'Toegevoegd aan register', + 'topleveldomain' => 'Top-Level-Domein', + 'associated_with_domain' => 'Toegekend', + 'aliasdomains' => 'Alternatieve domeinnamen', + 'redirectifpathisurl' => 'Doorverwijzingscode (standaard: leegt)', + 'redirectifpathisurlinfo' => 'U dient deze alleen op te geven indien u een URL als pad hebt opgegeven', + 'issubof' => 'Dit domein is een subdomein van een ander domein', + 'issubofinfo' => 'U dient het correcte domein op te geven indien u een subdomein als volledig domein wilt (bijvoorbeeld als u "www.domain.tld" wilt gebruiken, dan geeft u hier "domain.tld")', + 'nosubtomaindomain' => 'Geen subdomein van volledig domein', + ], + 'emails' => [ + 'description' => 'Hier kunt u e-mail adressen maken en wijzigen.
Een account is net als een brievenbus voor uw huis. Als iemand u mail stuurt wordt dit op uw account bezorgd.

Om uw emails te downloaden moet u het volgende instellen in uw mailprogramma: (De schuingedrukte gegevens moeten gewijzigd worden in wat u ingegeven heeft!)
Servernaam: Domeinnaam
Gebruikersnaam: Account naam / E-mailadres
Wachtwoord: het door u ingegeven wachtwoord', + 'emailaddress' => 'E-mailadres', + 'emails_add' => 'Maak nieuw e-mailadres', + 'emails_edit' => 'Bewerk e-mailadres', + 'catchall' => 'Catchall', + 'iscatchall' => 'Definieer als catchall-adres?', + 'account_add' => 'Maak nieuw account', + 'account_delete' => 'Verwijder account', + 'from' => 'Van', + 'to' => 'Aan', + 'forwarder_add' => 'Maak forwarder', + 'alternative_emailaddress' => 'Alternatief emailadres', + 'quota' => 'Quotum', + 'noquota' => 'Geen quotum', + 'updatequota' => 'Quotum aanpassen', + 'quota_edit' => 'E-mailquotum aanpassen', + 'noemaildomainaddedyet' => 'U hebt nog geen (email-)domein gekoppeld aan uw account.', + ], + 'error' => [ + 'error' => 'Fout', + 'directorymustexist' => 'De map %s bestaat niet. Maak hem eerst aan met uw FTP client.', + 'filemustexist' => 'Het bestand %s bestaat niet.', + 'allresourcesused' => 'U heeft al uw resources al gebruikt.', + 'domains_cantdeletemaindomain' => 'U kunt een domein dat gebruikt wordt als email-domein niet verwijderen.', + 'domains_canteditdomain' => 'U kunt dit domein niet aanpassen. Dit is door de admin onbruikbaar gemaakt.', + 'domains_cantdeletedomainwithemail' => 'U kunt een domein dat gebruikt wordt als email-domein niet verwijderen. Verwijder eerst alle e-mail adressen.', + 'firstdeleteallsubdomains' => 'U moet eerst alle subdomeinen verwijderen voor u een wildcard domein kunt maken.', + 'youhavealreadyacatchallforthisdomain' => 'U heeft al een catchall voor dit domein aangemaakt.', + 'ftp_cantdeletemainaccount' => 'U kunt uw hoofd FTP account niet verwijderen', + 'login' => 'De door u ingegeven gebruikersnaam en wachtwoord zijn verkeerd. Probeer opnieuw!', + 'login_blocked' => 'Dit account is inactief vanwege teveel login fouten.
Probeer het nog eens over %s seconden.', + 'notallreqfieldsorerrors' => 'U heeft niet alle velden goed, of helemaal niet ingevuld.', + 'oldpasswordnotcorrect' => 'Het oude wachtwoord is niet correct.', + 'youcantallocatemorethanyouhave' => 'U kunt niet meer resources gebruiken dan die u bezit.', + 'mustbeurl' => 'U heeft geen goed of compleet URL ingegeven (bijv. http://eenserver.com/error404.htm)', + 'invalidpath' => 'U heeft geen goed URL ingegeven (misschien een probleem met dirlisting?)', + 'stringisempty' => 'Geen waarde in invoerveld', + 'stringiswrong' => 'Verkeerde waarde in invoerveld', + 'newpasswordconfirmerror' => 'Het nieuwe wachtwoord en de bevestiging zijn niet gelijk', + 'loginnameexists' => 'Loginnaam %s bestaat al', + 'emailiswrong' => 'E-mailadres %s bevat illegale karakters of is niet compleet', + 'loginnameiswrong' => 'Loginnaam %s bevat illegale karakters', + 'userpathcombinationdupe' => 'Combinatie van Gebruikersnaam en Pad bestaat reeds', + 'patherror' => 'Generale Fou! Pad kan niet leeg zijn', + 'errordocpathdupe' => 'Optie voor pad %s bestaat reeds', + 'adduserfirst' => 'Maak klant eerst aan, aub', + 'domainalreadyexists' => 'Het domein %s is al aan een klant toegewezen', + 'nolanguageselect' => 'Geen taal geselecteerd.', + 'nosubjectcreate' => 'U moet een onderwerp ingeven voor dit e-mail sjabloon.', + 'nomailbodycreate' => 'U moet een tekst ingeven voor dit e-mail sjabloon.', + 'templatenotfound' => 'Sjabloon niet gevonden.', + 'alltemplatesdefined' => 'U kunt niet meer sjablonen definiëren, alle talen worden al ondersteund.', + 'wwwnotallowed' => 'www is niet toegestaan voor subdomeinen.', + 'subdomainiswrong' => 'Het subdomein %s bevat illegale karakters.', + 'domaincantbeempty' => 'De domeinnaam kan niet leeg zijn.', + 'domainexistalready' => 'Het domein %s bestaat reeds.', + 'domainisaliasorothercustomer' => 'Het geselecteerde alias domein verwijst naar zichzelf of is van een andere gebruiker.', + 'emailexistalready' => 'Het e-mail adres %s bestaat reeds.', + 'maindomainnonexist' => 'Het hoofd-domein %s bestaat niet.', + 'destinationnonexist' => 'Maak uw forwarder in het veld \'Destination\' alstublieft.', + 'destinationalreadyexistasmail' => 'De forwarder naar %s bestaat reeds als actief e-mail adres.', + 'destinationalreadyexist' => 'U heeft al een forwarder die verwijst naar %s .', + 'destinationiswrong' => 'De forwarder naar %s bevat illegale karakter(s) of is niet compleet.', + 'ipstillhasdomains' => 'De IP/Port combinatie die u verwijderen wilt heeft nog domeinen toegewezen, wijs deze opnieuw to aan andere IP/Poort combinaties voordat u deze IP/Poort combinatie verwijderd.', + 'cantdeletedefaultip' => 'U kunt de standaard reseller IP/Poort combinatie niet verwijderen, maak eerst een andere IP/Port combinatie standaard voor reseller voor dat u deze IP/Port combinatie verwijderd.', + 'cantdeletesystemip' => 'U kunt het laatste IP/Poort combinatie van het systeem niet verwijderen, maak eerste een andere IP/Port combinatie aan voor het systeem of wijzig het IP-adres van het systeem.', + 'myipaddress' => '\'IP\'', + 'myport' => '\'Poort\'', + 'myipdefault' => 'U moet een IP/Poort combinatie selecteren die standaard moet worden.', + 'myipnotdouble' => 'Deze IP/Poort combinatie bestaat reeds.', + 'cantchangesystemip' => 'U kunt het laatste system IP niet wijzigen, maak eerst een nieuwe IP/Poort combinatie aan of wijzig het ip-adres van het systeem.', + 'sessiontimeoutiswrong' => 'Alleen numerieke "Session Timeout" zijn toegestaan.', + 'maxloginattemptsiswrong' => 'Alleen numerieke "Maximaal aantal inlogpogingen" zijn toegestaan.', + 'deactivatetimiswrong' => 'Alleen numerieke "Deactiveringstijd" zijn toegestaan.', + 'accountprefixiswrong' => 'Het "Klant voorvoegsel" is verkeerd.', + 'mysqlprefixiswrong' => 'Het "SQL voorvoegsel" is verkeerd.', + 'ftpprefixiswrong' => 'Het "FTP voorvoegsel" is verkeerd.', + 'ipiswrong' => 'Het "IP-Adres" is verkeerd. Alleen een geldig ip-adres is toegestaan.', + 'vmailuidiswrong' => 'Het "Mails-uid" is verkeerd. Alleen een numeriek UID is toegestaan.', + 'vmailgidiswrong' => 'Het "Mails-gid" is verkeerd. Alleen een numeriek GID is toegestaan.', + 'adminmailiswrong' => 'Het "Afzender-adres" is verkeerd. Alleen geldige e-mail adressen zijn toegestaan.', + 'pagingiswrong' => 'Het aantal "Vermeldingen per pagina" is verkeerd. Alleen numerieke karakters zijn toegestaan.', + 'phpmyadminiswrong' => 'De phpMyAdmin-link is niet een geldige link.', + 'webmailiswrong' => 'De WebMail-link is niet een geldige link.', + 'webftpiswrong' => 'De WebFTP-link is niet een geldige link.', + 'stringformaterror' => 'De waarde voor het veld "%s" is niet in het verwachte formaat.', + 'loginnameissystemaccount' => 'U kunt geen accounts aanmaken die gelijk zijn aan systeem accounts (bijvoorbeeld beginnend met "%s"). Kies een andere accountnaam aub.', + 'youcantdeleteyourself' => 'U kunt uw eigen account, omwille van veiligheidsredenen, niet verwijderen.', + 'youcanteditallfieldsofyourself' => 'Opmerking: U kunt, om veiligheidsredenen, niet alle velden van uw account aanpassen.', + 'documentrootexists' => 'De map "%s" voor deze klant bestaat reeds. Verwijder deze map alvorens het account aan te maken.', + 'formtokencompromised' => 'Het verzoek lijkt te zijn gecompromitteerd. U bent veiligheidshalve uitgelogd.', + 'logerror' => 'Log-Fout: %s', + 'nomessagetosend' => 'U hebt geen bericht opgegeven.', + 'norecipientsgiven' => 'U hebt geen ontvanger opgegeven', + 'errorsendingmail' => 'Het versturen van het bericht naar "%s" is mislukt', + 'cannotreaddir' => 'De map "%s" kan niet gelezen worden', + 'invalidip' => '%s is een ongeldig IP-adres', + 'invalidmysqlhost' => 'Ongeldig adres voor MySQL-host: %s', + 'cannotuseawstatsandwebalizeratonetime' => 'U kunt Webalizer en AWstats niet tegelijkertijd gebruiken. Kies een van de twee.', + 'cannotwritetologfile' => 'Kan logbestand %s niet openen om naartoe te schrijven', + 'vmailquotawrong' => 'Het quotum dient een positief getal te zijn.', + 'allocatetoomuchquota' => 'U probeerde %s MB Quotum toe te kennen, maar u heeft niet voldoende over.', + 'missingfields' => 'Niet alle vereiste velden zijn ingevuld.', + 'accountnotexisting' => 'Het opgegeven e-mailaccount bestaat niet.', + 'nopermissionsorinvalidid' => 'U hebt geen toestemming om deze instellingen te wijzigen, of u hebt een ongeldig ID opgegeven.', + 'phpsettingidwrong' => 'Een configuratie voor PHP met dit ID bestaat niet', + 'descriptioninvalid' => 'De omschrijving is te kort, te lang of bevat ongeldige karakters.', + 'info' => 'Informatie', + 'filecontentnotset' => 'Het bestand mag niet leeg zijn!', + 'index_file_extension' => 'Het achtervoegsel dient tussen de 1 en 6 tekens lang te zijn. Het mag alleen tekens zal a-z, A-Z en 0-9 bevatten.', + 'customerdoesntexist' => 'De gekozen klant bestaat niet.', + 'admindoesntexist' => 'De gekozen beheerder bestaat niet.', + 'ipportdoesntexist' => 'De kozen combinatie poort/IP-adres bestaat niet.', + 'admin_domain_emailsystemhostname' => 'De naam van de server kan niet gebruikt worden als domein voor e-mail.', + 'usernamealreadyexists' => 'De gebruikersnaam %s is reeds in gebruik.', + 'errorwhensaving' => 'Fout tijdens opslaan veld %s', + 'hiddenfieldvaluechanged' => 'De waarde van het verborgen veld "%s" is gewijzigd tijdens het aanpassen van de instellingen.

Dit is normaliter geen groot probleem maar heeft wel verhinderd dat de instellingen niet zijn opgeslagen.', + 'notrequiredpasswordlength' => 'Het opgegeven wachtwoord is te kort. Geef tenminste %s tekens op.', + 'overviewsettingoptionisnotavalidfield' => 'Woops, a field that should be displayed as an option in the settings-overview is not an excepted type. You can blame the developers for this. This should not happen!', + 'pathmaynotcontaincolon' => 'Het opgegeven pad mag geen dubbele punt (":") bevatten. Geef een correct pad op.', + 'exception' => '%s', + 'notrequiredpasswordcomplexity' => 'Er is niet voldaan aan de complexiteit voor het wachtwoord (regex: %s)', + 'stringerrordocumentnotvalidforlighty' => 'Een tekenreeks als ErrorDocument werkt niet in lighttpd. Geef een pad naar een bestand', + 'urlerrordocumentnotvalidforlighty' => 'Een tekenreeks als ErrorDocument werkt niet in lighttpd. Geef een pad naar een bestand', + 'intvaluetoolow' => 'Het opgegeven nummer is te laag (veld %s)', + 'intvaluetoohigh' => 'Het opgegeven nummer is te hoog (veld %s)', + 'phpfpmstillenabled' => 'PHP-FPM is op dit moment actief. Schakel dit eerst uit voordat u FCGID inschakelt', + 'fcgidstillenabled' => 'FCGID is op dit moment actief. Schakel dit eerst uit voordat u PHP-FPM inschakelt', + ], + 'extras' => [ + 'description' => 'Hier kunt u wat extra instellingen doen zoals map beveiliging.
Het systeem heeft enkele minuten nodig om elke wijziging door te voeren.', + 'directoryprotection_add' => 'Map beveiliging toevoegen', + 'view_directory' => 'map inhoud laten zien', + 'pathoptions_add' => 'Pad opties toevoegen', + 'directory_browsing' => 'map inhoud browsen', + 'pathoptions_edit' => 'Pad opties bewerken', + 'errordocument404path' => 'URL naar Foutdocument 404', + 'errordocument403path' => 'URL naar Foutdocument 403', + 'errordocument500path' => 'URL naar Foutdocument 500', + 'errordocument401path' => 'URL naar Foutducument 401', + 'execute_perl' => 'perl/CGI uitvoeren', + 'htpasswdauthname' => 'Reden voor authenticatie (AuthName)', + 'directoryprotection_edit' => 'mapbeveiliging aanpassen', + ], + 'ftp' => [ + 'description' => 'Hier kunt u nieuwe FTP accounts maken of bestaande accounts wijzigen.
De wijzigingen worden direct doorgevoerd en het account kan direct gebruikt worden.', + 'account_add' => 'Maak nieuw account', + 'account_edit' => 'FTP account aanpassen', + 'editpassdescription' => 'Nieuw wachtwoord of leeg voor het oude wachtwoord.', + ], + 'index' => [ + 'customerdetails' => 'Klant Details', + 'accountdetails' => 'Account Details', + ], + 'logger' => [ + 'date' => 'Datum', + 'type' => 'Type', + 'action' => 'Actie', + 'user' => 'Gebruiker', + 'truncate' => 'Log legen', + ], + 'login' => [ + 'username' => 'Gebruikersnaam', + 'password' => 'Wachtwoord', + 'language' => 'Taal', + 'login' => 'Inloggen', + 'logout' => 'Uitloggen', + 'profile_lng' => 'Profiel taal', + 'forgotpwd' => 'Wachtwoord vergeten?', + 'presend' => 'Wachtwoord opnieuw instellen', + 'email' => 'E-mailadres', + 'remind' => 'Mijn wachtwoord opnieuw instellen', + 'usernotfound' => 'Gebruiker niet gevonden!', + 'backtologin' => 'Terug naar inlogpagina', + ], + 'mails' => [ + 'pop_success' => [ + 'mailbody' => 'Hallo,\\n\\nUw mail account {EMAIL}\\nis succesvol aangemaakt.\\n\\nDit is een automatisch verstuurde\\ne-mail, beantwoord deze niet AUB!\\n\\nMet vriendelijke groet, uw beheerder', + 'subject' => 'Mail account succesvol aangemaakt', + ], + 'createcustomer' => [ + 'mailbody' => 'Hallo {FIRSTNAME} {NAME},\\n\\nhierbij uw account informatie:\\n\\nGebruikersnaam: {USERNAME}\\nWachtwoord: {PASSWORD}\\n\\nMet vriendelijke groet,\\nuw beheerder', + 'subject' => 'Account informatie', + ], + 'pop_success_alternative' => [ + 'mailbody' => 'Hallo,\\n\\nuw mailaccount {EMAIL}\\nis met succes opgezet.\\nUw wachtwoord is {PASSWORD}.\\n\\nDit is een automatisch gegenereerde\\ne-mail, u kunt hierop niet antwoorden!\\n\\nMet vriendelijk groet, uw beheerder', + 'subject' => 'Mailaccount actief gemaakt', + ], + 'password_reset' => [ + 'subject' => 'Wachtwoord opnieuw instellen', + 'mailbody' => 'Hallo {USERNAME},\\n\\nuw wachtwoord voor Froxlor is opnieuw ingesteld!\\nHet nieuwe wachtwoord is: {LINK}\\n\\nMet vriendelijke groet,\\nuw beheerder', + ], + 'new_database_by_customer' => [ + 'subject' => '[Froxlor] Nieuwe database aangemaakt', + 'mailbody' => 'Geachte {CUST_NAME}, + +u hebt zojuist een nieuwe database aangemaakt. Hier zijn nogmaals de ingevoerde gegevens: + +Naam database: {DB_NAME} +Wachtwoord: {DB_PASS} +Beschrijving: {DB_DESC} +Hostnaam database: {DB_SRV} +phpMyAdmin: {PMA_URI} +Met vriendelijke groet, uw beheerder', + ], + 'new_ftpaccount_by_customer' => [ + 'subject' => 'Nieuwe FTP-gebruiker aangemaakt', + 'mailbody' => 'Geachte {CUST_NAME}, + +u hebt zojuist een nieuwe FTP-gebruiker aangemaakt. Hier is de opgegeven informatie: + +Gebruikersnaam: {USR_NAME} +Wachtwoord: {USR_PASS} +Pad: {USR_PATH} + +Met vriendelijke groet, uw beheerder', + ], + ], + 'menu' => [ + 'message' => 'Berichten', + ], + 'menue' => [ + 'main' => [ + 'main' => 'Main', + 'changepassword' => 'Wijzig wachtwoord', + 'changelanguage' => 'Wijzig taal', + 'username' => 'Ingelogd als: ', + ], + 'email' => [ + 'emails' => 'Adressen', + ], + 'domains' => [ + 'domains' => 'Domeinen', + 'settings' => 'Instellingen', + ], + 'extras' => [ + 'directoryprotection' => 'Map beveiliging', + 'pathoptions' => 'pad opties', + ], + 'traffic' => [ + 'traffic' => 'Dataverkeer', + 'current' => 'Deze maand', + ], + 'phpsettings' => [ + 'maintitle' => 'PHP Configuratie\'s', + ], + ], + 'message' => [ + 'norecipients' => 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn', + ], + 'mysql' => [ + 'databasename' => 'gebruiker/database naam', + 'databasedescription' => 'database omschrijving', + 'database_create' => 'Maak database', + 'description' => 'Hier kunt u MySQL-Databases maken en wijzigen.
De wijzigingen worden direct gemaakt en de database kan direkt gebruikt worden.
In het menu dat links staat vind u de tool phpMyAdmin welke u kunt gebruiken om uw database makkelijk te beheren.

Om gebruikt te maken van uw database in uw eigen php programmas kunt u de volgende instellingen gebruiken: (De gegeven in italics moeten aangepast worden in wat u ingevoerd heeft!)
Hostnaam:
Gebruikersnaam: Databasenaam
Wachtwoord: het wachtwoord dat u gekozen heeft
Database: Databasenaam', + ], + 'panel' => [ + 'edit' => 'bewerken', + 'delete' => 'verwijderen', + 'create' => 'nieuw', + 'save' => 'opslaan', + 'yes' => 'ja', + 'no' => 'nee', + 'emptyfornochanges' => 'leeg laten voor huidige instelling', + 'emptyfordefault' => 'leeg laten voor de standaard instellingen', + 'path' => 'Pad', + 'toggle' => 'In- of uitschalen', + 'next' => 'volgende', + 'dirsmissing' => 'De opgegeven map bestaat niet.', + 'urloverridespath' => 'URL (Vervangt path)', + 'pathorurl' => 'Pad of URL', + 'ascending' => 'oplopend', + 'descending' => 'aflopend', + 'search' => 'Zoeken', + 'used' => 'gebruikt', + 'translator' => 'Vertaler', + 'reset' => 'wijzigingen verwerpen', + 'pathDescription' => 'Indien de map niet bestaat wordt deze automatisch aangemaakt.

Indien u wilt doorverwijzen naar een ander domein dient deze te beginnen met http:// of https://', + 'back' => 'Back', + 'reseller' => 'wederverkoper', + 'admin' => 'beheerder', + 'customer' => 'klant(en)', + 'send' => 'verzenden', + 'nosslipsavailable' => 'Er zijn op dit moment geen SSL IP/poorten beschikbaar', + 'backtooverview' => 'Terug naar overzicht', + 'dateformat' => 'YYYY-MM-DD', + 'dateformat_function' => 'Y-m-d', + 'timeformat_function' => 'H:i:s', + 'default' => 'Standaard', + 'never' => 'Nooit', + 'active' => 'Actief', + 'please_choose' => 'Maak een keuze', + 'allow_modifications' => 'Aanpassingen toestaan', + 'megabyte' => 'MegaByte', + 'not_supported' => 'Wordt niet ondersteund in: ', + 'view' => 'weergeven', + 'toomanydirs' => 'Teveel submappen. Er wordt teruggevallen op handmatige invoer.', + 'abort' => 'Afbreken', + 'not_activated' => 'niet actief', + 'off' => 'uit', + 'options' => 'opties', + 'neverloggedin' => 'Nog niet ingelogd', + 'descriptionerrordocument' => 'Kan een URL, pad naar een bestand of een tekenreeks zijn die is omsloten door " "
Laat leeg voor de standaardwaarde.', + 'unlock' => 'ontgrendelen', + ], + 'pwdreminder' => [ + 'success' => 'Wachtwoord opnieuw ingesteld.
U ontvangt spoedig een e-mail met uw nieuwe wachtwoord.', + 'notallowed' => 'Het opnieuw instellen van wachtwoorden is uitgeschakeld', + ], + 'question' => [ + 'question' => 'Beveiligingsvraag', + 'admin_customer_reallydelete' => 'Weet u zeker dat u de klant %s wilt verwijderen? Dit kan niet ongedaan worden gemaakt!', + 'admin_domain_reallydelete' => 'Weet u zeker dat u het domein %s wilt verwijderen?', + 'admin_domain_reallydisablesecuritysetting' => 'Weet u echt heel zeker dat deze beveiligingsinstellingen wilt deactiveren (OpenBasedir)?', + 'admin_admin_reallydelete' => 'Weet u zeker dat u de admin %s verwijderen wilt? Iedere klant en domein zal worden toegewezen aan de hoofd administrator.', + 'admin_template_reallydelete' => 'Weet u zeker dat u het sjabloon \'%s\' verwijderen wilt?', + 'domains_reallydelete' => 'Weet u zeker dat u het domein %s verwijderen wilt?', + 'email_reallydelete' => 'Weet u zeker dat u het e-mail adres %s verwijderen wilt?', + 'email_reallydelete_account' => 'Weet u zeker dat het e-mail account van %s verwijderen wilt?', + 'email_reallydelete_forwarder' => 'Weet u zeker dat u de forwarder %s verwijderen wilt?', + 'extras_reallydelete' => 'Weet u zeker dat u de map beveiliging voor de map %s verwijderen wilt?', + 'extras_reallydelete_pathoptions' => 'Weet u zeker dat u de pad-opties voor %s verwijderen wilt?', + 'ftp_reallydelete' => 'Weet u zeker dat u het FTP account %s verwijderen wilt?', + 'mysql_reallydelete' => 'Weet u zeker dat u de database %s verwijderen wilt? Dit kan niet ongedaan gemaakt worden!', + 'admin_configs_reallyrebuild' => 'Weet u zeker dat u de configuratie bestanden voor Apache en Bind opnieuw wilt opbouwen?', + 'admin_ip_reallydelete' => 'Weet u zeker dat u het IP adres %s verwijderen wilt?', + 'admin_domain_reallydocrootoutofcustomerroot' => 'Weet u zeker dat u de document root voor dit domein niet in de klant-root van de klant wil hebben?', + 'admin_counters_reallyupdate' => 'Weet u zeker dat u gebruikte bronnen wilt herberekenen?', + 'admin_cleartextmailpws_reallywipe' => 'Weet u zeker dat u alle onversleutelde wachtwoorden wilt verwijderen? Deze opdracht is niet terug te draaien!', + 'logger_reallytruncate' => 'Weet u zeker dat u de tabel "%s" wilt legen?', + 'admin_quotas_reallywipe' => 'Weet u zeker dat u alle quota wilt verwijderen? Dit is niet terug te draaien!', + 'admin_quotas_reallyenforce' => 'Weet u zeker dat u quota wilt afdwingen? Dit is niet terug te draaien!', + 'phpsetting_reallydelete' => 'Weet u zeker dat u deze instellingen wilt verwijderen? Alle domeinen die deze configuratie gebruiken zullen terugvallen op de standaardinstellingen.', + 'remove_subbutmain_domains' => 'Verwijder ook domeinen die als volledige domeinen zijn opgegeven maar een subdomein zijn van dit domein?', + 'customer_reallyunlock' => 'Weet u zeker dat u klant %s? wilt ontgrendelen', + ], + 'serversettings' => [ + 'session_timeout' => [ + 'title' => 'Sessie Timeout', + 'description' => 'Hoe lang moet een gebruiker inactief zijn voor dat de sessie ongeldig wordt (seconden)?', + ], + 'accountprefix' => [ + 'title' => 'Klant Voorvoegsel', + 'description' => 'Welk voorvoegsel moet een klant account hebben?', + ], + 'mysqlprefix' => [ + 'title' => 'SQL Voorvoegsel', + 'description' => 'Welk voorvoegsel moet een mysql account hebben?', + ], + 'ftpprefix' => [ + 'title' => 'FTP Voorvoegsel', + 'description' => 'Welk voorvoegsel dienen nieuwe FTP-accounts te krijgen?
Indien u dit wijzigt, dient ook de query voor Quota in het configuratiebestand van de FTP-server aan te passen! ', + ], + 'documentroot_prefix' => [ + 'title' => 'Document map', + 'description' => 'Waar zullen alle gegeven opgeslagen worden?', + ], + 'logfiles_directory' => [ + 'title' => 'Logfiles map', + 'description' => 'Waar zullen alle log-file opgeslagen worden?', + ], + 'ipaddress' => [ + 'title' => 'IP-Adres', + 'description' => 'Wat is het IP-adres van deze server?', + ], + 'hostname' => [ + 'title' => 'Hostnaam', + 'description' => 'Wat is de hostnaam van deze server?', + ], + 'apachereload_command' => [ + 'title' => 'Apache reload commando', + 'description' => 'Wat is het commando op apache te herladen?', + ], + 'bindconf_directory' => [ + 'title' => 'Bind configuratie map', + 'description' => 'Waar staan de bind configuratie bestanden?', + ], + 'bindreload_command' => [ + 'title' => 'Bind reload commando', + 'description' => 'Wat is het command om bind te herladen?', + ], + 'vmail_uid' => [ + 'title' => 'Mails-Uid', + 'description' => 'Welk UserID moeten de e-mails hebben?', + ], + 'vmail_gid' => [ + 'title' => 'Mails-Gid', + 'description' => 'Welke GroupID moeten e-mails hebben?', + ], + 'vmail_homedir' => [ + 'title' => 'Mails-Homedir', + 'description' => 'Waar moeten alle e-mail opgeslagen worden?', + ], + 'adminmail' => [ + 'title' => 'Afzender', + 'description' => 'Wat is de afzender voor e-mail verstuurd vanuit het Panel?', + ], + 'phpmyadmin_url' => [ + 'title' => 'phpMyAdmin URL', + 'description' => 'Wat is de URL die verwijst naar phpMyAdmin? (moet beginnen met http://)', + ], + 'webmail_url' => [ + 'title' => 'WebMail URL', + 'description' => 'Wat is de URL die verwijst naar WebMail? (moet beginnen met http://)', + ], + 'webftp_url' => [ + 'title' => 'WebFTP URL', + 'description' => 'Wat is de URL die verwijst naar WebFTP? (moet beginnen met http://)', + ], + 'language' => [ + 'description' => 'Wat is uw standaard server taal?', + ], + 'maxloginattempts' => [ + 'title' => 'Maximaal aantal inlog pogingen', + 'description' => 'Maximaal aantal inlog pogingen voor het account gedeactiveerd wordt.', + ], + 'deactivatetime' => [ + 'title' => 'Deactiveringstijd', + 'description' => 'Tijd (in seconden) dat een account gedeactiveerd wordt na te veel inlogpogingen.', + ], + 'pathedit' => [ + 'title' => 'Manier van Pad ingeven', + 'description' => 'Moet het pad geselecteerd worden met een \'dropdown\' menu of met een invoerveld?', + ], + 'paging' => [ + 'title' => 'Vermeldingen per pagina', + 'description' => 'Hoeveel vermeldingen er getoond moeten worden per pagina? (0 = alles laten zien)', + ], + 'defaultip' => [ + 'title' => 'Standaard IP/Poort', + 'description' => 'Wat is de standaard IP/Poort combinatie?', + ], + 'phpappendopenbasedir' => [ + 'title' => 'Pad dat toegevoegd wordt aan OpenBasedir', + 'description' => 'Deze paden (gescheiden door dubbele punten) zullen worden toegevoegd aan het OpenBasedir-statement in iedere vhost-container.', + ], + 'natsorting' => [ + 'title' => 'Gebruik een natuurlijke manier van sorteren', + 'description' => 'Lijsten worden gesorteerd zoals web1 -> web2 -> web11 in plaats van web1 -> web11 -> web2.', + ], + 'deactivateddocroot' => [ + 'title' => 'Pad naar webinhoud voor gedeactiveerde gebruikers', + 'description' => 'Wanneer een gebruiker geactiveerd is, wordt dit pad gebruikt voor zijn/haar webinhoud.', + ], + 'mailpwcleartext' => [ + 'title' => 'Sla het wachtwoord ook onversleuteld op in de database', + 'description' => 'Indien ingesteld op JA worden wachtwoorden in klare tekst opgeslagen in de database (zichtbaar voor iedereen die toegang heeft tot de tabel mail_users). Activeer dit alleen wanneer u gebruik gaat maken van SASL!', + 'removelink' => 'Klik hier om alle onversleutelde wachtwoorden uit de database te verwijderen', + ], + 'ftpdomain' => [ + 'title' => 'FTP accounts @domein', + 'description' => 'Kunnen klanten FTP-accounts in de vorm gebruiker@domein aanmaken?', + ], + 'mod_fcgid' => [ + 'title' => 'PHP insluiten via mod_fcgid/suexec', + 'description' => 'Gebruik mod_fcgid/suexec/libnss_mysql om PHP uit te voeren onder het gebruikersaccount.
Dit vereist een aangepaste configuratie van de webserver. Alle volgende optie\'s zijn alleen geldig wanneer deze module actief is.', + 'configdir' => [ + 'title' => 'Configuratiemap', + 'description' => 'Waar dienen alle configuratiebestanden voor FCGID te worden opgeslagen? Indien u geen aangepaste versie van SuExec gebruikt, zoals gebruikelijk is, dient dit pad onder /var/www/ te liggen', + ], + 'tmpdir' => [ + 'title' => 'Map voor tijdelijke bestanden', + 'description' => 'Waar dienen de tijdelijke mappen te worden opgeslagen?', + ], + 'starter' => [ + 'title' => 'Processen per domein', + 'description' => 'Hoeveel processen moeten gestart/toegestaan worden per domein? De waarde 0 wordt aangeraden, aangezien PHP zelf het aantal processen goed kan inschatten.', + ], + 'wrapper' => [ + 'title' => 'Wrapper in vhosts', + 'description' => 'Hoe moet de wrapper ingesloten worden in vhosts?', + ], + 'peardir' => [ + 'title' => 'Globale PEAR-mappen', + 'description' => 'Welke PEAR-mappen dienen te worden ingesloten in elke php.ini? Bij meerdere mappen dienen deze te worden gescheiden door dubbele punten.', + ], + 'maxrequests' => [ + 'title' => 'Maximaal aantal verzoeken per domein', + 'description' => 'Toegestane aantal verzoeken per domein', + ], + 'defaultini' => 'Standaard PHP-configuratie voor nieuwe domeinen', + 'defaultini_ownvhost' => 'Standaard configuratie voor Froxlor-vHost', + ], + 'sendalternativemail' => [ + 'title' => 'Gebruik alternatief emailadres', + 'description' => 'Stuur het wachtwoord naar een ander adres dan het adres dat opgegeven werd tijdens het aanmaken van het emailadres.', + ], + 'apacheconf_vhost' => [ + 'title' => 'Bestands-/mapnaam voor vhost-configuratie webserver', + 'description' => 'Waar dient het vhost-configuratiebestand opgeslagen te worden? U kunt hier zowel een bestand (alle configuratie\'s in 1 bestand) of een map (apart bestand voor iedere configuratie) opgeven.', + ], + 'apacheconf_diroptions' => [ + 'title' => 'Bestands-/mapnaam voor diroptions-configuratie webserver', + 'description' => 'Waar dient het diroptions-configuratiebestand opgeslagen te worden? U kunt hier zowel een bestand (alle configuratie\'s in 1 bestand) of een map (apart bestand voor iedere configuratie) opgeven.', + ], + 'apacheconf_htpasswddir' => [ + 'title' => 'Mapnaam htpasswd-bestanden webserver', + 'description' => 'Waar dienen de htpasswd-bestanden, voor beveiligde toegang, opgeslagen te worden?', + ], + 'mysql_access_host' => [ + 'title' => 'Toegangshosts voor MySQL', + 'description' => 'Een door komma\'s gescheiden lijst met hosts waarvandaan gebruikers verbinding mogen maken met de MySQL-server.', + ], + 'webalizer_quiet' => [ + 'title' => 'Uitvoer Webalizer', + 'description' => 'Informatieniveau van Webalizer', + ], + 'logger' => [ + 'enable' => 'Logs in-/uitgeschakeld', + 'severity' => 'Logniveau', + 'types' => [ + 'title' => 'Log-type(s)', + 'description' => 'Om meerdere types te selecteren, houd u CTRL ingedrukt terwijl u selecteert.
Beschikbare types zijn: syslog, bestand, mysql', + ], + 'logfile' => 'Pad naar logfile, inclusief bestandsnaam', + 'logcron' => 'Cronjobs loggen', + 'logcronoption' => [ + 'never' => 'Nooit', + 'once' => 'Eenmalig', + 'always' => 'Altijd', + ], + ], + 'ssl' => [ + 'openssl_cnf' => 'Standaardinstellingen certificaat', + ], + 'default_vhostconf' => [ + 'title' => 'Standaard vhost-instellingen', + 'description' => 'De inhoud van dit veld wordt rechtstreeks in de vhost-container geplaatst. N.B.: Deze code wordt niet op fouten gecontroleerd. In geval van fouten kan het zijn dat de webserver niet meer start!', + ], + 'decimal_places' => 'Aantal getallen achter de komma in uitvoer dataverkeer', + 'webalizer_enabled' => 'Webalizer activeren', + 'awstats_enabled' => 'AWstats activeren', + 'selfdns' => [ + 'title' => 'Instellingen voor klantdomein', + ], + 'selfdnscustomer' => [ + 'title' => 'Klanten toestaan de DNS-instellingen van het domein te wijzigen', + ], + 'unix_names' => [ + 'title' => 'Gebruik gebruikersnamen die compatible zijn met UNIX', + 'description' => 'Staat het gebruik van - en _ in gebruikersnaam toe, indien ingesteld op Nee', + ], + 'allow_password_reset' => [ + 'title' => 'Klanten toestaan hun wachtwoord opnieuw in te stellen', + 'description' => 'Klanten kunnen hun wachtwoorden opnieuw instellen. Het nieuwe wachtwoord wordt hen per e-mail toegestuurd.', + ], + 'allow_password_reset_admin' => [ + 'title' => 'Beheerders/wederverkopers toestaan hun wachtwoorden opnieuw in te stellen.', + 'description' => 'Beheerders/wederverkopers kunnen hun wachtwoorden opnieuw instellen. Het nieuwe wachtwoord wordt hen per e-mail toegestuurd.', + ], + 'mail_quota' => [ + 'title' => 'Quotum voor mailbox', + 'description' => 'Het standaard quotum voor nieuwe mailboxen (MegaByte).', + ], + 'mail_quota_enabled' => [ + 'title' => 'Gebruik mailbox-quota voor mailboxen', + 'description' => 'Activeert het gebruik van quota voor mailboxen. Standaard is Nee, aangezien dit verdere configuratie vereist.', + 'removelink' => 'Klik hier om alle quota van mailbox te verwijderen.', + 'enforcelink' => 'Klik hier om het standaard quotum af te dwingen voor alle accounts.', + ], + 'index_file_extension' => [ + 'description' => 'Welk achtervoegsel moet gebruikt worden voor het indexbestand? Dit achtervoegsel wordt gebruikt wanneer een van de beheerders een eigen indexsjabloon heeft gemaakt.', + 'title' => 'Achtervoegsel van het indexbestand in nieuwe mappen voor klanten.', + ], + 'session_allow_multiple_login' => [ + 'title' => 'Meerdere logins toestaan', + 'description' => 'Indien dit is ingeschakeld kan een klant meerdere malen tegelijkertijd inloggen.', + ], + 'panel_allow_domain_change_admin' => [ + 'title' => 'Het verplaatsen van domeinen tussen beheerders toestaan', + 'description' => 'Indien actief, kunt u een domein toewijzen aan een andere beheerder.
Let op: Indien een klant niet is toegewezen aan de beheerder van het domein, kan de betreffende beheerde alle domeinen van deze klant zien!', + ], + 'panel_allow_domain_change_customer' => [ + 'title' => 'Het verplaatsen van domeinen tussen klanten toestaan', + 'description' => 'Indien actief, kunt u de klant van een domein veranderen.
Let op: Froxlor zal niet het pad aanpassen. Dit kan ervoor zorgen dat het domein onbruikbaar wordt!', + ], + 'cron' => [ + 'debug' => [ + 'title' => 'Foutopsporing cronscript', + 'description' => 'Activeer dit om het lockbestand te bewaren nadat de cron-taak is afgehandeld, zodat het gerbuikt kan worden voor het opsporen van fouten.
Let op:Het vastzetten van het lockbestand kan ervoor zorgen dat de volgende cron-taak niet naar behoren functioneert.', + ], + ], + 'specialsettingsforsubdomains' => [ + 'description' => 'Indien "Ja" zullen deze aangepaste VHost-instellingen worden toegepast op alle subdomeinen.', + ], + 'panel_password_min_length' => [ + 'title' => 'Minimumlengte wachtwoord', + 'description' => 'Hier kunt u een minimumlengte voor wachtwoorden opgeven. \'0\' betekent geen minimumlengte.', + ], + 'system_store_index_file_subs' => [ + 'title' => 'Standaard indexbestand ook plaatsen in nieuwe submappen', + 'description' => 'Indien actief wordt dit bestand automatisch geplaatst in nieuw aangemaakte submappen (indien deze nog niet bestaat).', + ], + 'adminmail_return' => [ + 'title' => 'Reply-To adres', + 'description' => 'Geef een e-mailadres dat gebruikt wordt als antwoord-aan adres voor mails die verzonden worden door het paneel.', + ], + 'adminmail_defname' => 'Panel e-mail sender name', + 'stdsubdomainhost' => [ + 'title' => 'Standaarddomein voor klanten', + 'description' => 'Welke hostnaam dient gebruikt te worden voor standaard subdomeinen voor klanten. Indien leeg zal de naam van het systeem gebruikt worden.', + ], + 'awstats_path' => 'Pad naar \'awstats_buildstaticpages.pl\' van AWStats', + 'awstats_conf' => 'AWStats configuratiepad', + 'defaultttl' => 'Standaard TTL voor domeinen in seconden (standaard \'604800\' = 1 week)', + 'defaultwebsrverrhandler_enabled' => 'Standaard foutdocumenten voor alle klanten activeren', + 'defaultwebsrverrhandler_err401' => [ + 'title' => 'Bestand/URL voor foutcode 401', + 'description' => '
Wordt niet ondersteund in: lighttpd
', + ], + 'defaultwebsrverrhandler_err403' => [ + 'title' => 'Bestand/URL voor foutcode 403', + 'description' => '
Wordt niet ondersteund in: lighttpd
', + ], + 'defaultwebsrverrhandler_err404' => 'Bestand/URL voor foutcode 404', + 'defaultwebsrverrhandler_err500' => [ + 'title' => 'Bestand/URL voor foutcode 500', + 'description' => '
Wordt niet ondersteund in: lighttpd
', + ], + 'ftpserver' => [ + 'desc' => 'Indien PureFTPD geselecteerd is, worden .ftpquota bestanden dagelijks aangemaakt en/of bijgewerkt', + ], + 'customredirect_enabled' => [ + 'title' => 'Klanten toestaan doorverwijzingen te maken', + 'description' => 'Klanten toestaan de HTTP-statuscode aan te passen die voor doorverwijzingen gebruikt worden', + ], + 'customredirect_default' => [ + 'title' => 'Standaard doorverwijzing', + 'description' => 'Kies de standaard doorverwijzingscode indien de klant dit zelf niet gedaan heeft', + ], + 'mail_also_with_mxservers' => 'Maak mail-, imap-, pop3- en smtp-"A record" ook wanneer MX-Servers zijn ingesteld', + 'froxlordirectlyviahostname' => 'Froxlor is direct toegankelijk via hostnaam', + 'panel_password_regex' => [ + 'title' => 'Reguliere expressie voor wachtwoorden', + 'description' => 'Hier kunt u een reguliere expressie opgeven voor de complexiteit van wachtwoorden.
Leeg betekent geen speciale complexiteit', + ], + 'perl_path' => [ + 'title' => 'Pad naar Perl', + 'description' => 'Alleen relevant voor lighttpd. Standaard is /usr/bin/perl', + ], + 'mod_fcgid_ownvhost' => [ + 'title' => 'FCGID inschakelen voor de VHost voor Froxlor', + 'description' => 'Indien ingeschakeld wordt Froxlor ook uitgevoerd onder een lokale gebruiker
Let op:Dit vereist handmatige configuratie, zie FCGID - handbook', + ], + 'perl' => [ + 'suexecworkaround' => [ + 'title' => 'Om SuExec heenwerken (Geldt alleen voor Apache)', + 'description' => 'Schakel dit alleen in indien de documentmappen van klanten niet in het pad van Apache SuExec vallen.
Indien ingeschakeld zal Froxlor een symbolische link maken voor het pad waarvoor Perl actief is + /cgi-bin/.
Merk op dat Perl dan alleen werkt in de submap /cgi-bin/ en niet in de map zelf (zoals het werkt zonder deze oplossing!)', + ], + 'suexeccgipath' => [ + 'title' => 'Pad naar symbolische links naar Perl-mappen van klanten', + 'description' => 'U dient dit alleen op te geven indien "Om SuExec heenwerken" actief is.
LET OP: Zorg ervoor dat deze map onder het pad van SuExec valt, anders is deze oplossing waardeloos', + ], + ], + 'awstats_awstatspath' => 'Pad naar AWStats \'awstats.pl\'', + 'awstats_icons' => [ + 'title' => 'Pad naar iconen AWstats icons', + 'description' => 'bijvoorbeeld /usr/share/awstats/htdocs/icon/', + ], + 'login_domain_login' => 'Login met domeinen toestaan', + 'nginx_php_backend' => [ + 'title' => 'Nginx PHP backend', + 'description' => 'dit is waar het PHP-proces luistert naar verzoeken van nginx, kan een unix socket van ip:poort combinatie zijn', + ], + 'phpreload_command' => [ + 'title' => 'Commando voor het herladen van PHP', + 'description' => 'wordt gebruikt om de PHP backend opnieuw te laden, indien actief
Standaard: leeg', + ], + 'phpfpm' => 'php-fpm inschakelen', + 'phpfpm_settings' => [ + 'configdir' => 'Configuratiemap van php-fpm', + 'reload' => 'Commando voor het herstarten van php-fpm', + 'pm' => 'Process manager control (pm)', + 'max_children' => [ + 'title' => 'Het aantal subprocessen', + 'description' => 'Het aantal subprocessen dat gestart wordt indien PM is ingesteld op \'statisch\' en het maximum aantal subprocessen wanneer PM is ingesteld op \'dynamisch\'
Gelijk aan PHP_FCGI_CHILDREN', + ], + 'start_servers' => [ + 'title' => 'Het aantal subprocessen bij het starten', + 'description' => 'Noot: Wordt alleen gebruikt indien PM is ingesteld op \'dynamisch\'', + ], + 'min_spare_servers' => [ + 'title' => 'Het gewenste minimum aantal vrije subprocessen', + 'description' => 'Noot: Wordt alleen gebruikt indien PM is ingesteld op \'dynamisch\'
Noot: Verplicht wanneer PM ingesteld is op \'dynamisch\'', + ], + 'max_spare_servers' => [ + 'title' => 'THet gewenste minimum aantal vrije subprocessen', + 'description' => 'Noot: Wordt alleen gebruikt indien PM is ingesteld op \'dynamisch\'
Noot: Verplicht wanneer PM ingesteld is op \'dynamisch\'', + ], + 'max_requests' => [ + 'title' => 'Verzoeken voor subproces voordat het opnieuw gestart wordt', + 'description' => 'Voor het eindeloos verwerken kunt u deze waarde instellen op \'0\'. Gelijk aan PHP_FCGI_MAX_REQUESTS.', + ], + ], + ], + 'spf' => [ + 'use_spf' => 'SPF voor domeinen activeren?', + 'spf_entry' => 'SPF regel voor alle domeinen', + ], + 'success' => [ + 'messages_success' => 'Bericht verzonden naar ontvangers %s', + 'success' => 'Informatie', + 'clickheretocontinue' => 'Klik hier om verder te gaan', + 'settingssaved' => 'De instellingen zijn opgeslagen.', + ], + 'tasks' => [ + 'outstanding_tasks' => 'Uitstaande cron-taken', + 'REBUILD_VHOST' => 'Bezig met opnieuw opbouwen van de configuratie van de webserver', + 'CREATE_HOME' => 'Klant met naam %loginname% wordt toegevoegd', + 'REBUILD_DNS' => 'Opnieuw opbouwen bind-configuratie', + 'CREATE_FTP' => 'Map aanmaken voor nieuwe FTP-gebruiker', + 'DELETE_CUSTOMER_FILES' => 'Verwijderen klantbestanden van %loginname%', + 'noneoutstanding' => 'Er zijn op dit moment geen uitstaande taken voor Froxlor', + ], + 'traffic' => [ + 'month' => 'Maand', + 'day' => 'Dag', + 'months' => [ + 1 => 'Januari', + 2 => 'Februari', + 3 => 'Maart', + 4 => 'April', + 5 => 'Mei', + 6 => 'Juni', + 7 => 'Juli', + 8 => 'Augustus', + 9 => 'September', + 10 => 'Oktober', + 11 => 'November', + 12 => 'December', + ], + 'mb' => 'Datavekeer (MB)', + 'distribution' => 'FTP | HTTP | Mail', + 'sumhttp' => 'Samenvatting HTTP-verkeer in', + 'sumftp' => 'Samenvatting FTP-verkeer in', + 'summail' => 'Samenvatting Mail-verkeer in', + ], + 'translator' => 'Sander Klein/Frits Letteboer', + 'update' => [ + 'updateinprogress_onlyadmincanlogin' => 'Een nieuwere versie van Froxlor is geinstalleerd maar is nog niet geconfigureerd.
Alleen de beheerder kan inloggen en de update voltooien.', + 'update' => 'Froxlor Update', + 'proceed' => 'Verdergaan', + 'update_information' => [ + 'part_a' => 'De bestanden van Froxlor zijn bijgewerkt naar versie %newversion. De geinstalleerde versie is %curversion.', + 'part_b' => '

Klanten kunnen niet inloggen totdat de update voltooid is.
Verdergaan?', + ], + 'noupdatesavail' => 'U gebruikt reeds de meest recente versie van Froxlor.', + ], +]; diff --git a/lng/portugues.lng.php b/lng/portugues.lng.php deleted file mode 100644 index f6f7acb6..00000000 --- a/lng/portugues.lng.php +++ /dev/null @@ -1,745 +0,0 @@ - - * @author Thiago Goncalves de Castro - * @author Rafael Andrade - * @author Froxlor Team - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Global - */ -$lng['translator'] = 'Ricardo Luiz Costa, Rafael Andrade, Thiago Goncalves de Castro'; -$lng['panel']['edit'] = 'Editar'; -$lng['panel']['delete'] = 'Deletar'; -$lng['panel']['create'] = 'Criar'; -$lng['panel']['save'] = 'Salvar'; -$lng['panel']['yes'] = 'Sim'; -$lng['panel']['no'] = 'Não'; -$lng['panel']['emptyfornochanges'] = 'Sair sem salvar'; -$lng['panel']['emptyfordefault'] = 'Restaurar padrão'; -$lng['panel']['path'] = 'Caminho'; -$lng['panel']['toggle'] = 'Toggle'; -$lng['panel']['next'] = 'Próximo'; -$lng['panel']['dirsmissing'] = 'Directório não disponível ou ilegível'; - -/** - * Login - */ - -$lng['login']['username'] = 'Usuário'; -$lng['login']['password'] = 'Senha'; -$lng['login']['language'] = 'Idioma'; -$lng['login']['login'] = 'Login'; -$lng['login']['logout'] = 'Sair'; -$lng['login']['profile_lng'] = 'Idioma padrão'; - -/** - * Customer - */ - -$lng['customer']['documentroot'] = 'Diretório home'; -$lng['customer']['name'] = 'Sobrenome'; -$lng['customer']['firstname'] = 'Primeiro nome'; -$lng['customer']['company'] = 'Empresa'; -$lng['customer']['street'] = 'Endereço'; -$lng['customer']['zipcode'] = 'CEP'; -$lng['customer']['city'] = 'Cidade'; -$lng['customer']['phone'] = 'Telefone'; -$lng['customer']['fax'] = 'Fax'; -$lng['customer']['email'] = 'E-mail'; -$lng['customer']['customernumber'] = 'Cliente ID'; -$lng['customer']['diskspace'] = 'Espaço de disco (MB)'; -$lng['customer']['traffic'] = 'Tráfego (GB)'; -$lng['customer']['mysqls'] = 'Bancos de dados-MySQL'; -$lng['customer']['emails'] = 'Endereços de e-mail'; -$lng['customer']['accounts'] = 'Contas de e-mail'; -$lng['customer']['forwarders'] = 'Redirecionamentos de e-mail'; -$lng['customer']['ftps'] = 'Contas de FTP'; -$lng['customer']['subdomains'] = 'Sub-Domínio(s)'; -$lng['customer']['domains'] = 'Domínio(s)'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Principal'; -$lng['menue']['main']['changepassword'] = 'Trocar senha'; -$lng['menue']['main']['changelanguage'] = 'Trocar idioma'; -$lng['menue']['email']['email'] = 'E-mail'; -$lng['menue']['email']['emails'] = 'Endereços'; -$lng['menue']['email']['webmail'] = 'WebMail'; -$lng['menue']['mysql']['mysql'] = 'MySQL'; -$lng['menue']['mysql']['databases'] = 'Banco de dados'; -$lng['menue']['mysql']['phpmyadmin'] = 'phpMyAdmin'; -$lng['menue']['domains']['domains'] = 'Domínios'; -$lng['menue']['domains']['settings'] = 'Configurações'; -$lng['menue']['ftp']['ftp'] = 'FTP'; -$lng['menue']['ftp']['accounts'] = 'Contas'; -$lng['menue']['ftp']['webftp'] = 'WebFTP'; -$lng['menue']['extras']['extras'] = 'Extras'; -$lng['menue']['extras']['directoryprotection'] = 'Diretório protegido'; -$lng['menue']['extras']['pathoptions'] = 'Opções de caminhos'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Detalhes dos Clientes'; -$lng['index']['accountdetails'] = 'Detalhes das Contas'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Senha atual'; -$lng['changepassword']['new_password'] = 'Nova senha'; -$lng['changepassword']['new_password_confirm'] = 'Repita a nova senha'; -$lng['changepassword']['new_password_ifnotempty'] = 'Nova senha (em branco = não alterar)'; -$lng['changepassword']['also_change_ftp'] = ' trocar tambem a senha da conta principal de FTP'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Aqui você pode criar (sub-)domínios e alterar seu destino.
O sistema irá levar algum tempo para aplicar as novas configurações depois de salvas.'; -$lng['domains']['domainsettings'] = 'Configurar Domínio'; -$lng['domains']['domainname'] = 'Nome do domínio'; -$lng['domains']['subdomain_add'] = 'Criar Sub-domínio'; -$lng['domains']['subdomain_edit'] = 'Editar (sub)domínio'; -$lng['domains']['wildcarddomain'] = 'Criar um wildcarddomain?'; -$lng['domains']['aliasdomain'] = 'Aliás para o domínio'; -$lng['domains']['noaliasdomain'] = 'Não domínio do aliás'; - -/** - * E-mails - */ - -$lng['emails']['description'] = 'Aqui você pode criar e alterer seus e-mails.
Uma conta é como uma caixa de correio na frente de sua casa. Quando alguem envia para você um e-mail, ele é colocado nesta conta.

Para baixar seus e-mails use as seguintes configurações no seu propraga de e-mails favorito: (Os dados em italico devem ser substituidos pelo equivalente da conta que você criou!)
Hostname: Nome de seu domínio
Usuário: Nome da conta / Endereço de e-mail
Senha: a senha que você escolheu'; -$lng['emails']['emailaddress'] = 'Endereços de e-mail'; -$lng['emails']['emails_add'] = 'Criar e-mail'; -$lng['emails']['emails_edit'] = 'Editar e-mail'; -$lng['emails']['catchall'] = 'Pega tudo'; -$lng['emails']['iscatchall'] = 'Definir como endereço pega tudo?'; -$lng['emails']['account'] = 'Conta'; -$lng['emails']['account_add'] = 'Criar conta'; -$lng['emails']['account_delete'] = 'Excluir conta'; -$lng['emails']['from'] = 'Origem'; -$lng['emails']['to'] = 'Destino'; -$lng['emails']['forwarders'] = 'Redirecionamentos'; -$lng['emails']['forwarder_add'] = 'Criar redirecionamento'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Aqui você pode criar e alterar suas contas de FTP.
As alterações são instantâneas e podem ser utilizadas imediatamente depois de salvas.'; -$lng['ftp']['account_add'] = 'Criar conta'; - -/** - * MySQL - */ - -$lng['mysql']['description'] = 'Aqui você pode criar e alterar seus bancos de dados MySQL.
As alterações são instantâneas e podem ser utilizadas imediatamente depois de salvas.
No menu do lado esquerdo você pode encontrar a ferramenta phpMyAdmin e com ela facilmente administrar seus bancos de dados.

Para usar seu banco de dados com scripts em PHP use as seguintes configurações: (Os dados em italico devem ser substituidos pelo equivalente do banco de dados que você criou!)
Hostname:
Usuario: Nome do banco de dadose
Senha: a senha que você escolheu
Banco de dados: Nome do banco de dados'; -$lng['mysql']['databasename'] = 'Usuario / Nome do banco de dados'; -$lng['mysql']['databasedescription'] = 'Descrição do banco de dados'; -$lng['mysql']['database_create'] = 'Criar banco de dados'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Aqui você pode adicoionar alguns recursos extras, como por exemplo um diretório protegido.
O sistema ira precisar de algum tempo para aplicar suas alterações depois de salvas.'; -$lng['extras']['directoryprotection_add'] = 'Adicionar diretório pretogido'; -$lng['extras']['view_directory'] = 'Mostrar conteúdo do diretório'; -$lng['extras']['pathoptions_add'] = 'Adicionar opções de caminho'; -$lng['extras']['directory_browsing'] = 'Pesquizar conteúdo de diretório'; -$lng['extras']['pathoptions_edit'] = 'Esitar opções de caminhos'; -$lng['extras']['errordocument404path'] = 'URL para página de erro 404'; -$lng['extras']['errordocument403path'] = 'URL para página de erro 403'; -$lng['extras']['errordocument500path'] = 'URL para página de erro 500'; -$lng['extras']['errordocument401path'] = 'URL para página de erro 401'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Erro'; -$lng['error']['directorymustexist'] = 'O diretório %s deve existir. Por favor crie ele primeiro com seu programa de FTP.'; -$lng['error']['filemustexist'] = 'O arquivo %s deve existir.'; -$lng['error']['allresourcesused'] = 'Você já usou todos os seus recursos.'; -$lng['error']['domains_cantdeletemaindomain'] = 'Você não pode deletar um domínio que esta sendo usado como email-domain.'; -$lng['error']['domains_canteditdomain'] = 'Você não pode editar este domínio. Ele foi desabilitado pelo administrador.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'Você não pode deletar um domínio que é usado como email-domain. Delete todos as contas de e-mail primeiro.'; -$lng['error']['firstdeleteallsubdomains'] = 'Você deve deletar todos subdomínios antes de poder criar um wildcard domain.'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'Você já definiu uma conta pega tudo para este domínio.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'Você não pode deletar a conta principal de FTP'; -$lng['error']['login'] = 'O usuário ou senha digitados, não estão corretos. Por favor tente novamente!'; -$lng['error']['login_blocked'] = 'Esta conta está suspensa por exceder as tentativas de login permitidas.
Por favor tente novamente em %s segundos.'; -$lng['error']['notallreqfieldsorerrors'] = 'Você não preencheu todos os campos ou preencheu algum campo incorretamente.'; -$lng['error']['oldpasswordnotcorrect'] = 'A senha antiga não confere.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'Você não pode alocar mais recursos do que você mesmo possui.'; -$lng['error']['mustbeurl'] = 'Você não digitou uma URL válida (ex. http://seudominio.com/erro404.htm)'; -$lng['error']['invalidpath'] = 'Optou por um URL não válido (eventuais problemas na lista do directório)'; -$lng['error']['stringisempty'] = 'Faltando informação no campo'; -$lng['error']['stringiswrong'] = 'Erro na informação do campo'; -$lng['error']['newpasswordconfirmerror'] = 'A nova senha e a confirmação não conferem'; -$lng['error']['mydomain'] = '\'Domínio\''; -$lng['error']['mydocumentroot'] = '\'Documento principal\''; -$lng['error']['loginnameexists'] = 'Login %s já existe'; -$lng['error']['emailiswrong'] = 'E-mail %s contém caracteres inválidos ou está incompleto'; -$lng['error']['loginnameiswrong'] = 'Login %s contém caracteres inválidos'; -$lng['error']['loginnameiswrong2'] = 'Login contém muitos caracteres. Somente %s caracteres são aceitos.'; -$lng['error']['userpathcombinationdupe'] = 'Usuario e caminho já existem'; -$lng['error']['patherror'] = 'Erro geral! o caminho não pode ficar em branco'; -$lng['error']['errordocpathdupe'] = 'Opção de caminho %s já existe'; -$lng['error']['adduserfirst'] = 'Por favor crie um cliente primeiro'; -$lng['error']['domainalreadyexists'] = 'O domínio %s já está apontado para outro cliente'; -$lng['error']['nolanguageselect'] = 'Nenhum idioma selecionado.'; -$lng['error']['nosubjectcreate'] = 'Você deve definir um nome para este e-mail template.'; -$lng['error']['nomailbodycreate'] = 'Você deve definir o texto para este e-mail template.'; -$lng['error']['templatenotfound'] = 'Template não encontrado.'; -$lng['error']['alltemplatesdefined'] = 'Você não pode definir mais templates, todos idiomas já suportados.'; -$lng['error']['wwwnotallowed'] = 'www não é permitido como nome de subdomínio.'; -$lng['error']['subdomainiswrong'] = 'O subdomínio %s contém caracteres inválidos.'; -$lng['error']['domaincantbeempty'] = 'O nome do domínio não pode estar vazio.'; -$lng['error']['domainexistalready'] = 'O domínio %s já existe.'; -$lng['error']['domainisaliasorothercustomer'] = 'O domínio-alias escolhido é ele próprio um domínio-alias ou este pertence a um outro cliente.'; -$lng['error']['emailexistalready'] = 'O E-mail %s já existe.'; -$lng['error']['maindomainnonexist'] = 'O domínio principal %s não existe.'; -$lng['error']['destinationnonexist'] = 'Por favor crie seu redirecionamento no campo \'Destino\'.'; -$lng['error']['destinationalreadyexistasmail'] = 'O redirecionamento %s já existe como uma conta de e-mail.'; -$lng['error']['destinationalreadyexist'] = 'Você já definiu um redirecionamento para %s .'; -$lng['error']['destinationiswrong'] = 'O redirecionamento %s contém caracteres inválidos ou incompletos.'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Pergunta de segurança'; -$lng['question']['admin_customer_reallydelete'] = 'Você realmente deseja deletar o cliente %s? Este comando não poderá ser cancelado!'; -$lng['question']['admin_domain_reallydelete'] = 'Você realmente deseja deletar o domínio %s?'; -$lng['question']['admin_domain_reallydisablesecuritysetting'] = 'Você realmente deseja desativar estas configurações de segurança (OpenBasedir)?'; -$lng['question']['admin_admin_reallydelete'] = 'Você realmente deseja deletar o administrador %s? Todos clientes e domínios serão realocados para o administrador principal.'; -$lng['question']['admin_template_reallydelete'] = 'Você realmente deseja deletar o template \'%s\'?'; -$lng['question']['domains_reallydelete'] = 'Você realmente deseja deletar o domínio %s?'; -$lng['question']['email_reallydelete'] = 'Você realmente deseja deletar o e-mail %s?'; -$lng['question']['email_reallydelete_account'] = 'Você realmente deseja deletar a conta de e-mail %s?'; -$lng['question']['email_reallydelete_forwarder'] = 'Você realmente deseja deletar o redirecionamento %s?'; -$lng['question']['extras_reallydelete'] = 'Você realmente deseja deletar a proteção do diretório %s?'; -$lng['question']['extras_reallydelete_pathoptions'] = 'Você realmente deseja deletar o caminho %s?'; -$lng['question']['ftp_reallydelete'] = 'Você realmente deseja deletar a conta de FTP %s?'; -$lng['question']['mysql_reallydelete'] = 'Você realmente deseja deletar o banco de dados %s? Este comando não poderá ser cancelado!'; -$lng['question']['admin_configs_reallyrebuild'] = 'Está certo que quer deixar reconfigurar os ficheiros de configuração de Apache e Bind?'; -$lng['question']['admin_customer_alsoremovefiles'] = 'Remover arquivos do usuário também?'; -$lng['question']['admin_customer_alsoremovemail'] = 'Remover todos os dados de e-mail do sistema de arquivos?'; -$lng['question']['admin_customer_alsoremoveftphomedir'] = 'Remover o diretório home do usuário FTP?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['mailbody'] = 'Olá,\n\n sua conta de e-mail {EMAIL}\n foi criada com sucesso.\n\nEsta é uma mensagem automática\neMail, por favor não responda!\n\nAtenciosamente, Equipe de desenvolvimento do Froxlor'; -$lng['mails']['pop_success']['subject'] = 'Conta de e-mail criada com sucesso!'; -$lng['mails']['createcustomer']['mailbody'] = 'Olá {FIRSTNAME} {NAME},\n\nseguem os detalhes de sua nova conta de e-mail:\n\nUsuario: {USERNAME}\nSenha: {PASSWORD}\n\nObrigado,\nEquipe de desenvolvimento do Froxlor'; -$lng['mails']['createcustomer']['subject'] = 'Informações da conta'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Visão geral'; -$lng['admin']['ressourcedetails'] = 'Recursos usados'; -$lng['admin']['systemdetails'] = 'Detalhes do sistema'; -$lng['admin']['froxlordetails'] = 'Detalhes do Froxlor'; -$lng['admin']['installedversion'] = 'Versão instalada'; -$lng['admin']['latestversion'] = 'Ultima Versão'; -$lng['admin']['lookfornewversion']['clickhere'] = 'procurar pela internet'; -$lng['admin']['lookfornewversion']['error'] = 'Erro de leitura'; -$lng['admin']['resources'] = 'Recursos'; -$lng['admin']['customer'] = 'Cliente'; -$lng['admin']['customers'] = 'Clientes'; -$lng['admin']['customer_add'] = 'Criar cliente'; -$lng['admin']['customer_edit'] = 'Editar cliente'; -$lng['admin']['domains'] = 'Domínios'; -$lng['admin']['domain_add'] = 'Criar domínio'; -$lng['admin']['domain_edit'] = 'Editar domínio'; -$lng['admin']['subdomainforemail'] = 'Subdomínio como "emaildomains"'; -$lng['admin']['admin'] = 'Administrador'; -$lng['admin']['admins'] = 'Administradores'; -$lng['admin']['admin_add'] = 'Criar administrador'; -$lng['admin']['admin_edit'] = 'Editar administrador'; -$lng['admin']['customers_see_all'] = 'Mostrar todos os clientes'; -$lng['admin']['domains_see_all'] = 'Mostrar todos os domínios'; -$lng['admin']['change_serversettings'] = 'Alterar configuraççes do servidor?'; -$lng['admin']['server'] = 'Sistema'; -$lng['admin']['serversettings'] = 'Configurações'; -$lng['admin']['rebuildconf'] = 'Escrever de novo os configs'; -$lng['admin']['stdsubdomain'] = 'Subdomínio padrão'; -$lng['admin']['stdsubdomain_add'] = 'Criar Subdomínio padrão'; -$lng['admin']['phpenabled'] = 'PHP Habilitado'; -$lng['admin']['deactivated'] = 'Desativado'; -$lng['admin']['deactivated_user'] = 'Desativar usuário'; -$lng['admin']['sendpassword'] = 'Enviar senha'; -$lng['admin']['ownvhostsettings'] = 'Own vHost-Settings'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Configurações'; -$lng['admin']['templates']['templates'] = 'Templates'; -$lng['admin']['templates']['template_add'] = 'Adicionar template'; -$lng['admin']['templates']['template_edit'] = 'Editar template'; -$lng['admin']['templates']['action'] = 'Ação'; -$lng['admin']['templates']['email'] = 'E-Mail'; -$lng['admin']['templates']['subject'] = 'Assunto'; -$lng['admin']['templates']['mailbody'] = 'Mensagem'; -$lng['admin']['templates']['createcustomer'] = 'E-mail de boas-vindas para novos clientes'; -$lng['admin']['templates']['pop_success'] = 'E-mail de boas-vindas para nova conta de e-mail'; -$lng['admin']['templates']['template_replace_vars'] = 'Variaveis para serem substituidas no template:'; -$lng['admin']['templates']['FIRSTNAME'] = 'Altere para o primeiro nome do cliente.'; -$lng['admin']['templates']['NAME'] = 'Altere para o nome do cliente.'; -$lng['admin']['templates']['USERNAME'] = 'Altere para nome da conta do cliente.'; -$lng['admin']['templates']['PASSWORD'] = 'Altere com a senha da conta do cliente.'; -$lng['admin']['templates']['EMAIL'] = 'Altere com os dados do servidor POP3/IMAP.'; - -/** - * Serversettings - */ - -$lng['serversettings']['session_timeout']['title'] = 'Tempo esgotado'; -$lng['serversettings']['session_timeout']['description'] = 'Quanto tempo o usuario deve estar inativo para ser desconectado (segundos)?'; -$lng['serversettings']['accountprefix']['title'] = 'Prefixo do cliente'; -$lng['serversettings']['accountprefix']['description'] = 'Qual o prefixo "customeraccounts" deve ter?'; -$lng['serversettings']['mysqlprefix']['title'] = 'SQL Prefixo'; -$lng['serversettings']['mysqlprefix']['description'] = 'Qual prefixo as contas mysql devem ter?'; -$lng['serversettings']['ftpprefix']['title'] = 'FTP Prefixo'; -$lng['serversettings']['ftpprefix']['description'] = 'Qual prefixo as contas de FTP devem ter?'; -$lng['serversettings']['documentroot_prefix']['title'] = 'Diretório de documentação'; -$lng['serversettings']['documentroot_prefix']['description'] = 'Aonde os documentos dever ser gravados?'; -$lng['serversettings']['logfiles_directory']['title'] = 'Diretório de LOG'; -$lng['serversettings']['logfiles_directory']['description'] = 'Aonde os arquivos de log dever ser gravados?'; -$lng['serversettings']['ipaddress']['title'] = 'Endereços de IP'; -$lng['serversettings']['ipaddress']['description'] = 'Quais os Endereços IP deste servidor?'; -$lng['serversettings']['hostname']['title'] = 'Hostname'; -$lng['serversettings']['hostname']['description'] = 'Qual o Hostname deste servidor?'; -$lng['serversettings']['apachereload_command']['title'] = 'Comando de reiniciar o Apache'; -$lng['serversettings']['apachereload_command']['description'] = 'Qual o comando para reiniciar o apache?'; -$lng['serversettings']['bindenable']['title'] = 'Habilitar Servidor de Nomes'; -$lng['serversettings']['bindenable']['description'] = 'Aqui o servidor de nomes pode ser habilitado ou desabilitado globalmente.'; -$lng['serversettings']['bindconf_directory']['title'] = 'Diretório de configuração do Bind'; -$lng['serversettings']['bindconf_directory']['description'] = 'Aonde estão os arquivos de configuração do bind?'; -$lng['serversettings']['bindreload_command']['title'] = 'Comando de reiniciar o Bind'; -$lng['serversettings']['bindreload_command']['description'] = 'Qual o comando para reiniciar o bind?'; -$lng['serversettings']['vmail_uid']['title'] = 'Mails-Uid'; -$lng['serversettings']['vmail_uid']['description'] = 'Qual UserID os e-mails devem ter?'; -$lng['serversettings']['vmail_gid']['title'] = 'Mails-Gid'; -$lng['serversettings']['vmail_gid']['description'] = 'Qual GroupID os e-mails devem ter?'; -$lng['serversettings']['vmail_homedir']['title'] = 'Mails-Homedir'; -$lng['serversettings']['vmail_homedir']['description'] = 'Aonde os e-mails devem ser gravados?'; -$lng['serversettings']['adminmail']['title'] = 'Remetente'; -$lng['serversettings']['adminmail']['description'] = 'Qual o remetente dos e-mails enviados pelo painel?'; -$lng['serversettings']['phpmyadmin_url']['title'] = 'phpMyAdmin URL'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'Qual a URL do phpMyAdmin? (deve iniciar com http://)'; -$lng['serversettings']['webmail_url']['title'] = 'WebMail URL'; -$lng['serversettings']['webmail_url']['description'] = 'Qual a URL do WebMail? (deve iniciar com http://)'; -$lng['serversettings']['webftp_url']['title'] = 'WebFTP URL'; -$lng['serversettings']['webftp_url']['description'] = 'Qual a URL do WebFTP? (deve iniciar com http://)'; -$lng['serversettings']['language']['description'] = 'Qual o idioma padrão do servidor?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Tentativas maximas de Login'; -$lng['serversettings']['maxloginattempts']['description'] = 'Tentativas maximas de Login para a conta ser desativada.'; -$lng['serversettings']['deactivatetime']['title'] = 'Tempo que a conta deve permanecer desativada'; -$lng['serversettings']['deactivatetime']['description'] = 'Tempo (sec.) qua a conta permanece desativada depois de muitas tentativas de login.'; -$lng['serversettings']['pathedit']['title'] = 'File-Método de entrada'; -$lng['serversettings']['pathedit']['description'] = 'A escolha do file tem que ser feita através do Dropdown-Menu ou pode ser feita manualmente?'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['serversettings']['paging']['title'] = 'Entradas por pagina'; -$lng['serversettings']['paging']['description'] = 'Quantas entradas devem ser mostradas por pagina? (0 = desabilitar paginas)'; -$lng['error']['ipstillhasdomains'] = 'O IP/Porta que você quer deletar ainda possui domínios associados e eles, por favor altere o IP/Porta destes domínios antes de deletá-los.'; -$lng['error']['cantdeletedefaultip'] = 'Você não pode deletar o IP/Porta padrão do revendedor, por favor defina outro IP/Porta como padrão antes deletar o IP/Porta desejado'; -$lng['error']['cantdeletesystemip'] = 'Você não pode deletar o IP do sistema, nem criar uma nova combinação IP/Porta para o sistema ou trocar o IP do sistema.'; -$lng['error']['myipaddress'] = '\'IP\''; -$lng['error']['myport'] = '\'Porta\''; -$lng['error']['myipdefault'] = 'Você precisa selecionar o IP/Porta que será padrão.'; -$lng['error']['myipnotdouble'] = 'Esta combinação IP/Porta já existe.'; -$lng['question']['admin_ip_reallydelete'] = 'Você realmente deseja deletar este endereço IP?'; -$lng['admin']['ipsandports']['ipsandports'] = 'IPs e Portas'; -$lng['admin']['ipsandports']['add'] = 'Adicionar IP/Porta'; -$lng['admin']['ipsandports']['edit'] = 'Editar IP/Porta'; -$lng['admin']['ipsandports']['ipandport'] = 'IP/Porta'; -$lng['admin']['ipsandports']['ip'] = 'IP'; -$lng['admin']['ipsandports']['port'] = 'Porta'; -$lng['error']['cantchangesystemip'] = 'Você não pode mudar o último sistema IP, para criar uma outra combinação nova de IP/Port para o sistema IP ou para mudar o sistema IP'; -$lng['question']['admin_domain_reallydocrootoutofcustomerroot'] = 'É você certo, você quer a raiz do original para este domínio, não estando dentro do customerroot do cliente?'; -$lng['error']['loginnameissystemaccount'] = 'Você não pode criar os clientes que são similares aos systemaccounts. Incorpore por favor um outro accountname.'; -$lng['domain']['docroot'] = 'trajeto da linha acima de'; -$lng['domain']['homedir'] = 'diretório da casa'; -$lng['admin']['valuemandatory'] = 'Este valor é imperativo.'; -$lng['admin']['valuemandatorycompany'] = 'Qualquer um "nome" e "nome" o "companhia" deve ser enchido.'; -$lng['admin']['webserver'] = 'Servidor Web'; -$lng['serversettings']['nameservers']['title'] = 'Servidores DNS'; -$lng['serversettings']['mxservers']['title'] = 'Servidores de Email'; -$lng['serversettings']['mxservers']['description'] = 'Uma lista separada por vírgulas que contém o numero de prioridade e o hostname separados por um espaço (por exemplo: \'mx.example.com 10 \'), contendo os servidores mx.'; -$lng['error']['admin_domain_emailsystemhostname'] = 'Desculpe. Você não pode usar o hostname do servidor como domínio de email'; -$lng['admin']['memorylimitdisabled'] = 'Desabilitado'; -$lng['domain']['openbasedirpath'] = 'Caminho do OpenBaseDir'; -$lng['menue']['main']['username'] = 'Logado como'; -$lng['panel']['urloverridespath'] = 'URL (Caminho Completo)'; -$lng['panel']['pathorurl'] = 'Caminho ou URL'; -$lng['error']['sessiontimeoutiswrong'] = 'Apenas numeros "Timeout da sessão" permitido.'; -$lng['error']['maxloginattemptsiswrong'] = 'Apenas numero "Tentativa maxima de Login" permitido.'; -$lng['error']['deactivatetimiswrong'] = 'Apenas numero "Desativar Tempo" permitido.'; -$lng['error']['accountprefixiswrong'] = 'O "Prefixo" está errado.'; -$lng['error']['mysqlprefixiswrong'] = 'O "Prefixo SQL" está errado.'; -$lng['error']['ftpprefixiswrong'] = 'O "Prefixo FTP" está errado.'; -$lng['error']['ipiswrong'] = 'O "Endereço-IP" está errado. Apenas um Endereço-IP válido é permitido.'; -$lng['error']['vmailuidiswrong'] = 'O "UID do E-mail" Está errado. Só é permitido um número de ID.'; -$lng['error']['vmailgidiswrong'] = 'O "GID do E-mail" Está errado. Só é permitido um número de ID.'; -$lng['error']['adminmailiswrong'] = 'O "Endereço de Envio" está errado. Apenas um endereço de e-mail válido é permitido.'; -$lng['error']['pagingiswrong'] = 'O "Entradas por páginas"-value está errado. Somente caracteres númericos são permitidos.'; -$lng['error']['phpmyadminiswrong'] = 'O caminho para o phpMyAmin não é válido'; -$lng['error']['webmailiswrong'] = 'O caminho para o Webmail não é válido'; -$lng['error']['webftpiswrong'] = 'O caminho para o WebFTP não é válido'; -$lng['domains']['hasaliasdomains'] = 'Possui alinhas de domínio(s)'; -$lng['serversettings']['defaultip']['title'] = 'IP/Porta Padrão'; -$lng['serversettings']['defaultip']['description'] = 'Qual é a IP/Porta Padrão?'; -$lng['domains']['statstics'] = 'Estatísticas de Uso'; -$lng['panel']['ascending'] = 'Crescente'; -$lng['panel']['descending'] = 'Decrescente'; -$lng['panel']['search'] = 'Procurar'; -$lng['panel']['used'] = 'Usado'; -$lng['panel']['translator'] = 'Tradutor'; -$lng['error']['stringformaterror'] = 'O valor par ao campo "%s" não esta no formato correto.'; -$lng['admin']['serversoftware'] = 'Servidor de Software'; -$lng['admin']['phpversion'] = 'Versão do PHP'; -$lng['admin']['phpmemorylimit'] = 'Memória Limite do PHP'; -$lng['admin']['mysqlserverversion'] = 'Versão do MySQL Server'; -$lng['admin']['mysqlclientversion'] = 'Versão do MySQL Client'; -$lng['admin']['webserverinterface'] = 'Interface do Servidor Web'; -$lng['domains']['isassigneddomain'] = 'É um domínio assinado'; -$lng['serversettings']['phpappendopenbasedir']['title'] = 'Caminho para adicionar OpenBasedir'; -$lng['serversettings']['phpappendopenbasedir']['description'] = 'Estes caminhos (separados por dois pontos) serão acrescentados ao OpenBasedir em cada vhost.'; -$lng['error']['youcantdeleteyourself'] = 'Você não pode apagar você mesmo por motivos de segurança'; -$lng['error']['youcanteditallfieldsofyourself'] = 'Nota: Você não pode editar todos os campos de sua própria conta por motivos de segurança'; -$lng['serversettings']['natsorting']['title'] = 'Usar classificação natural na visualização'; -$lng['serversettings']['natsorting']['description'] = 'Ordenar listas como: web1 -> web2 -> web11 ao invéz de web1 -> web11 -> web2.'; -$lng['serversettings']['deactivateddocroot']['title'] = 'Docroots desativado para usuários'; -$lng['serversettings']['deactivateddocroot']['description'] = 'Quando um usuário estiver desativado, esse caminho é usado como seu docroot. Deixe em branco para não criar um vhost a todos.'; -$lng['panel']['reset'] = 'Descartar Mudanças'; -$lng['admin']['accountsettings'] = 'Configurações de Conta'; -$lng['admin']['panelsettings'] = 'Painel de Controle'; -$lng['admin']['systemsettings'] = 'Configurações do Sistema'; -$lng['admin']['webserversettings'] = 'Configurações do WebServer'; -$lng['admin']['mailserversettings'] = 'Configurações do Servidor de Email'; -$lng['admin']['nameserversettings'] = 'Configurações dos Servidores de Nomes'; -$lng['admin']['updatecounters'] = 'Recalcular utilização de recursos'; -$lng['question']['admin_counters_reallyupdate'] = 'Você deseja recalcular os recursos utilizados?'; -$lng['panel']['pathDescription'] = 'Se o diretório não existir, será criado automaticamente'; -$lng['admin']['templates']['TRAFFIC'] = 'Substituído com o tráfego, o que foi atribuído ao cliente.'; -$lng['admin']['templates']['TRAFFICUSED'] = 'Substituído com o tráfego, que foi esgotado pela cliente.'; -$lng['admin']['subcanemaildomain']['never'] = 'Nunca'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'Escolhe, default não'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'Escolher, default sim'; -$lng['admin']['subcanemaildomain']['always'] = 'Sempre'; -$lng['changepassword']['also_change_stats'] = 'Troca a senha das estatísticas'; -$lng['serversettings']['mailpwcleartext']['title'] = 'Salva as senhas de usuários sempre criptografia no banco de dados'; -$lng['serversettings']['mailpwcleartext']['description'] = 'Se você selecionar sim, todas as senhas serão guardadas descriptografadas (Poderá ser lido por todos com acesso ao banco de dados ) na tabela mail_users-table. Somente ative essa opção se você realmente precise!'; -$lng['serversettings']['mailpwcleartext']['removelink'] = 'Clique aqui para limpar todas as senhas não criptografadas da tabela
Você realmente deseja limpar todas as senhas não encriptadas a partir da tabela mail_users? Isto não pode ser revertido!'; -$lng['admin']['configfiles']['overview'] = 'Visão Geral'; -$lng['admin']['configfiles']['wizard'] = 'Assistente'; -$lng['admin']['configfiles']['distribution'] = 'Distribuição'; -$lng['admin']['configfiles']['service'] = 'Serviço'; -$lng['admin']['configfiles']['daemon'] = 'Daemon'; -$lng['admin']['configfiles']['http'] = 'Servidor Web (HTTP)'; -$lng['admin']['configfiles']['dns'] = 'Servidor de Nomes (DNS)'; -$lng['admin']['configfiles']['mail'] = 'Servidor de Emails (POP3/IMAP)'; -$lng['admin']['configfiles']['smtp'] = 'Servidor de Emails (SMTP)'; -$lng['admin']['configfiles']['ftp'] = 'Servidor FTP'; -$lng['admin']['configfiles']['etc'] = 'Outros (Sistema)'; -$lng['admin']['configfiles']['choosedistribution'] = 'Escolha uma distribuição'; -$lng['admin']['configfiles']['chooseservice'] = 'Escolha um serviço'; -$lng['admin']['configfiles']['choosedaemon'] = 'Escolha um daemon'; -$lng['serversettings']['ftpdomain']['title'] = 'Contas FTP @domínio'; -$lng['serversettings']['ftpdomain']['description'] = 'Clientes podem criar contas de FTP user@domíniodocliente?'; -$lng['panel']['back'] = 'Volta'; -$lng['serversettings']['mod_fcgid']['title'] = 'Incluir PHP via mod_fcgid/suexec'; -$lng['serversettings']['mod_fcgid']['description'] = 'Use mod_fcgid/suexec/libnss_mysql to run PHP with the corresponding useraccount.
This needs a special Apache configuration. All following options are only valid if the module is enabled.'; -$lng['serversettings']['sendalternativemail']['title'] = 'Utilize endereço de e-mail alternativo'; -$lng['serversettings']['sendalternativemail']['description'] = 'Enviar e-mail a senha para um endereço diferente durante uma criação de conta de e-mail'; -$lng['emails']['alternative_emailaddress'] = 'Endereço de E-mail alternativo'; -$lng['mails']['pop_success_alternative']['mailbody'] = 'Oi,\n\nSua conta de email {EMAIL}\nfoi configurada corretamente.\nSua senha é{PASSWORD}.\n\nEmail criado automaticamente\n, Por favor não responda!\n\nCumprimentos, Equipe Froxlor.'; -$lng['mails']['pop_success_alternative']['subject'] = 'Conta de email criada com sucesso'; -$lng['admin']['templates']['pop_success_alternative'] = 'Bem-vindo para novas contas e-mail enviado ao endereço alternativo'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Substituído a senha da conta POP3/IMAP.'; -$lng['error']['documentrootexists'] = 'O Diretório "%s" já existe para este usuario. Por favor remova-o e depois tente novamente.'; -$lng['serversettings']['apacheconf_vhost']['title'] = 'Arquivo/Diretório de configurações do Apache Vhost'; -$lng['serversettings']['apacheconf_vhost']['description'] = 'Onde as configuração de Vhost devem ser guardadas? Você pode especificar um arquivo (todos os vhosts em um arquivo) ou diretório (cada vhost com seu próprio arquivo) aqui.'; -$lng['serversettings']['apacheconf_diroptions']['title'] = 'Configuração de diretório do Apache Arquivo/Nome do Diretório.'; -$lng['serversettings']['apacheconf_diroptions']['description'] = 'Quando as opções de configuração de diretório deve ser armazenada? Você poderia especificar um arquivo (todas as opções em um arquivo) ou diretório ( cada opção no seu próprio arquivo).'; -$lng['serversettings']['apacheconf_htpasswddir']['title'] = 'Apache htpasswd dirname'; -$lng['serversettings']['apacheconf_htpasswddir']['description'] = 'Onde deve ser o diretório de arquivos htpasswd?'; -$lng['error']['formtokencompromised'] = 'O Pedido parece estar correto. Por motivos de segurança você está desconectado.'; -$lng['serversettings']['mysql_access_host']['title'] = 'Hosts de Acesso MySQL'; -$lng['serversettings']['mysql_access_host']['description'] = 'Uma lista separada por vírgulas de hosts a partir do qual os utilizadores devem ter a possibilidade de conectar-se ao MySQL-Server.'; -$lng['admin']['ipsandports']['create_listen_statement'] = 'Criar instrução de escuta'; -$lng['admin']['ipsandports']['create_namevirtualhost_statement'] = 'Criar instrução de NameVirtualHost'; -$lng['admin']['ipsandports']['create_vhostcontainer'] = 'Criar vHost-Container'; -$lng['admin']['ipsandports']['create_vhostcontainer_servername_statement'] = 'Criar instrução de ServerName no vHost-Container'; -$lng['admin']['webalizersettings'] = 'Configurações do Webalizer'; -$lng['admin']['webalizer']['normal'] = 'Normal'; -$lng['admin']['webalizer']['quiet'] = 'Quieto'; -$lng['admin']['webalizer']['veryquiet'] = 'Sem Saída'; -$lng['serversettings']['webalizer_quiet']['title'] = 'Saida do Webalizer'; -$lng['serversettings']['webalizer_quiet']['description'] = 'Modo verbose do webalizer'; -$lng['admin']['domain_nocustomeraddingavailable'] = 'Não adicionar um domínio corretamente. Você primeiro precisa adicionar um cliente.'; -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Diretório de configuração'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Aonde todos os arquivos de configuração do fcgid vão ser guardados? Se você não utiliza um binário compilado, está é uma situação normal, deve estar dentro de /var/www/'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Diretório Temporário'; -$lng['menue']['traffic']['traffic'] = 'Tráfego'; -$lng['menue']['traffic']['current'] = 'Mês corrente'; -$lng['traffic']['month'] = "Mês"; -$lng['traffic']['day'] = "Diariamente"; -$lng['traffic']['months'][1] = "Janeiro"; -$lng['traffic']['months'][2] = "Fevereiro"; -$lng['traffic']['months'][3] = "Março"; -$lng['traffic']['months'][4] = "Abril"; -$lng['traffic']['months'][5] = "Maio"; -$lng['traffic']['months'][6] = "Junho"; -$lng['traffic']['months'][7] = "Julho"; -$lng['traffic']['months'][8] = "Agosto"; -$lng['traffic']['months'][9] = "Setembro"; -$lng['traffic']['months'][10] = "Outubro"; -$lng['traffic']['months'][11] = "Novembro"; -$lng['traffic']['months'][12] = "Dezembro"; -$lng['traffic']['mb'] = "Tráfego (MB)"; -$lng['traffic']['distribution'] = 'FTP | HTTP | E-Mail'; -$lng['traffic']['sumhttp'] = 'Resumo Tráfego de HTTP em'; -$lng['traffic']['sumftp'] = 'Resumo Tráfego de FTP em'; -$lng['traffic']['summail'] = 'Resumo Tráfego de HTTP em'; -$lng['admin']['loggersettings'] = 'Configurações de Logs'; -$lng['serversettings']['logger']['enable'] = 'Habilitar/Desabilitar Logs'; -$lng['serversettings']['logger']['severity'] = 'Nível de Logs'; -$lng['admin']['logger']['normal'] = 'normal'; -$lng['admin']['logger']['paranoid'] = 'paranóico'; -$lng['serversettings']['logger']['types']['title'] = 'Tipos de Log(s)'; -$lng['serversettings']['logger']['types']['description'] = 'Especificar tipos de logs separados por vírgula.
Tipos de lógs disponíveis: syslog, file, mysql'; -$lng['serversettings']['logger']['logfile'] = 'Caminho do Arquivo de Log incluindo nome de arquivo'; -$lng['error']['logerror'] = 'Log-Erro: %s'; -$lng['serversettings']['logger']['logcron'] = 'Logar tarefas do cron'; -$lng['serversettings']['logger']['logcronoption']['never'] = 'Nunca'; -$lng['serversettings']['logger']['logcronoption']['once'] = 'Uma vez'; -$lng['serversettings']['logger']['logcronoption']['always'] = 'Sempre'; -$lng['question']['logger_reallytruncate'] = 'Você realmente deseja dividir a tabela "%s"?'; -$lng['admin']['loggersystem'] = 'Sistema-Log'; -$lng['logger']['date'] = 'Data'; -$lng['logger']['type'] = 'Tipo'; -$lng['logger']['action'] = 'Ação'; -$lng['logger']['user'] = 'Usuário'; -$lng['logger']['truncate'] = 'Log Vazio'; -$lng['serversettings']['ssl']['openssl_cnf'] = 'Padrão para criar o arquivo de certificado'; -$lng['panel']['reseller'] = 'Revenda'; -$lng['panel']['admin'] = 'Administrador'; -$lng['panel']['customer'] = 'Cliente(s)'; -$lng['error']['nomessagetosend'] = 'Você não entrou com uma mensagem'; -$lng['error']['norecipientsgiven'] = 'Você não especificou um destinatário'; -$lng['admin']['emaildomain'] = 'Domínio de Email'; -$lng['admin']['email_only'] = 'Somente Email?'; -$lng['admin']['wwwserveralias'] = 'Adicionar um "www." ServerAlias'; -$lng['admin']['ipsandports']['enable_ssl'] = 'Esta é uma porta SSL?'; -$lng['admin']['ipsandports']['ssl_cert_file'] = 'Caminho para o certificado SSL'; -$lng['panel']['send'] = 'Enviar'; -$lng['admin']['subject'] = 'Assunto'; -$lng['admin']['recipient'] = 'Destinatário'; -$lng['admin']['message'] = 'Escrever uma mensagem'; -$lng['admin']['text'] = 'Mensagem'; -$lng['menu']['message'] = 'Mensagens'; -$lng['error']['errorsendingmail'] = 'A mensagem para "%s" falhou'; -$lng['error']['cannotreaddir'] = 'Não é possível ler o diretório "%s"'; -$lng['success']['messages_success'] = 'Mensagens enviadas para %s destinatários com sucesso'; -$lng['message']['norecipients'] = 'Email não enviado porque não tem destinatário no banco de dados'; -$lng['admin']['sslsettings'] = 'Configuração de SSL'; -$lng['cronjobs']['notyetrun'] = 'Ainda não está rodando'; -$lng['serversettings']['default_vhostconf']['title'] = 'Configuração de Vhost padrão'; -$lng['serversettings']['default_vhostconf']['description'] = 'O conteúdo deste campo será incluído a cada novo vhost criado. Atenção: O código será checado para algum erro. Se contiver erros, o apache pode não iniciar mais'; -$lng['emails']['quota'] = 'Quota'; -$lng['emails']['noquota'] = 'Sem quota'; -$lng['emails']['updatequota'] = 'Atualizar'; -$lng['serversettings']['mail_quota']['title'] = 'Quota de Email'; -$lng['serversettings']['mail_quota']['description'] = 'Quota default para novas caixas criadas'; -$lng['serversettings']['mail_quota_enabled']['title'] = 'Usar quota para clientes'; -$lng['serversettings']['mail_quota_enabled']['description'] = 'Ative para usar cotas em caixas de email. Padrão é Não visto que requer uma configuração especial.'; -$lng['serversettings']['mail_quota_enabled']['removelink'] = 'Clique aqui para limpar todas as quotas para as contas de email.'; -$lng['question']['admin_quotas_reallywipe'] = 'Você realmente deseja limpar todas as quotas na tabela mail_users? Isto não pode ser revertido'; -$lng['error']['vmailquotawrong'] = 'A tamanho da quota deve ser entre 1 e 999'; -$lng['customer']['email_quota'] = 'E-mail Quota'; -$lng['customer']['email_imap'] = 'E-mail IMAP'; -$lng['customer']['email_pop3'] = 'E-mail POP3'; -$lng['customer']['mail_quota'] = 'Quota de Email'; -$lng['error']['invalidip'] = 'Endereço de IP Inválido: %s'; -$lng['serversettings']['decimal_places'] = 'Número de casas decimais no tráfego / espaço de paginas web'; -$lng['admin']['dkimsettings'] = 'Configurações de Chave de Domínios'; -$lng['dkim']['dkim_prefix']['title'] = 'Prefixo'; -$lng['dkim']['dkim_prefix']['description'] = 'Por favor, especifique o caminho para o os arquivos DKIM RSA, bem como para os arquivos de configuração para o plugin Milter'; -$lng['dkim']['dkim_domains']['title'] = 'Nome de arquivo de domínios'; -$lng['dkim']['dkim_domains']['description'] = 'Nome do Arquivo dos Domínios do DKIM, parâmetro especificado na configuração do dkim-Milter'; -$lng['dkim']['dkim_dkimkeys']['title'] = 'Nome de arquivo de chaves'; -$lng['dkim']['dkim_dkimkeys']['description'] = 'Nome do ArquivoDKIM KeyList do parâmetro especificado na configuração dkim-Milter'; -$lng['dkim']['dkimrestart_command']['title'] = 'Comando para reiniciar o Milter'; -$lng['dkim']['dkimrestart_command']['description'] = 'Por favor especifique um comando para reiniciar o DKIM Milter'; -$lng['admin']['caneditphpsettings'] = 'Pode alterar as configurações PHP relacionadas com o domínio?'; -$lng['admin']['allips'] = 'Todos os IPs'; -$lng['panel']['nosslipsavailable'] = 'Não existem atualmente IP SSL / Porta para este servidor.'; -$lng['dkim']['use_dkim']['title'] = 'Ativar suporte para DKIM?'; -$lng['dkim']['use_dkim']['description'] = 'Você deseja usar o sistema de chaves de domínio (DKIM) ?'; -$lng['error']['invalidmysqlhost'] = 'Endereço de servidor MySQL inválido: %s'; -$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'Você não pode ativar Webalizer e Awstats ao mesmo tempo, por favor, escolha uma delas'; -$lng['serversettings']['webalizer_enabled'] = 'Ativar estatísticas webalizer'; -$lng['serversettings']['awstats_enabled'] = 'Ativar estatísticas awstats'; -$lng['admin']['awstatssettings'] = 'Configurações Awtats'; -$lng['admin']['domain_dns_settings'] = 'Configurações de DNS'; -$lng['dns']['destinationip'] = 'Domínio IP'; -$lng['dns']['standardip'] = 'IP padrão do servidor'; -$lng['dns']['a_record'] = 'Gravar-A(Opcional IPV6)'; -$lng['dns']['cname_record'] = 'Gravar-CNAME'; -$lng['dns']['mxrecords'] = 'Definir entradas MX'; -$lng['dns']['standardmx'] = 'Servidor MX padrão'; -$lng['dns']['mxconfig'] = 'Registros MX personalizados'; -$lng['dns']['priority10'] = 'Prioridade 10'; -$lng['dns']['priority20'] = 'Prioridade 20'; -$lng['dns']['txtrecords'] = 'Difinir entradas TXT'; -$lng['dns']['txtexample'] = 'Exemplo (Entrada-SPF):
v=spf1 ip4:xxx.xxx.xx.0/23 -all'; -$lng['serversettings']['selfdns']['title'] = 'Configurações DNS-Domiio personalizadas'; -$lng['serversettings']['selfdnscustomer']['title'] = 'Aceita clientes para editar configurações de DNS'; -$lng['admin']['activated'] = 'Ativado'; -$lng['admin']['statisticsettings'] = 'Configurações de Estatísticas'; -$lng['admin']['or'] = 'ou'; -$lng['serversettings']['unix_names']['title'] = 'Usar nomes compatíveis com UNIX'; -$lng['serversettings']['unix_names']['description'] = 'Aceita você usar - and _ em nomes de usuários se Noestiver marcado'; -$lng['error']['cannotwritetologfile'] = 'Não pode abrir arquivo de log %s para escrita'; -$lng['admin']['sysload'] = 'Carga do Sistema'; -$lng['admin']['noloadavailable'] = 'Não disponível'; -$lng['admin']['nouptimeavailable'] = 'Não disponível'; -$lng['panel']['backtooverview'] = 'Voltar para Visão Geral'; -$lng['admin']['nosubject'] = '(Sem Assunto)'; -$lng['admin']['configfiles']['statistics'] = 'Estatísticas'; -$lng['login']['forgotpwd'] = 'Perdeu sua senha?'; -$lng['login']['presend'] = 'Resetar senha'; -$lng['login']['email'] = 'Endereço de E-mail'; -$lng['login']['remind'] = 'Resetar minha senha'; -$lng['login']['usernotfound'] = 'Úsuario não encontrado'; -$lng['mails']['password_reset']['subject'] = 'Reset de Senha'; -$lng['mails']['password_reset']['mailbody'] = 'Oi {USERNAME},\n\nsua senha do Froxlor foi resetada!\nA nova senha é: {LINK}\n\nObrigado,\nequipe Froxlor'; -$lng['pwdreminder']['success'] = 'Redefinição de senha com sucesso.
Você agora deve receber um e-mail com sua nova senha.'; -$lng['serversettings']['allow_password_reset']['title'] = 'Aceita reset de senha por clientes'; -$lng['pwdreminder']['notallowed'] = 'Reset de senhas está desativado'; -$lng['customer']['title'] = 'Título'; -$lng['customer']['country'] = 'País'; -$lng['panel']['dateformat'] = 'AAAA-MM-DD'; -$lng['panel']['dateformat_function'] = 'A-m-d'; -$lng['panel']['timeformat_function'] = 'H:i:S'; -$lng['panel']['default'] = 'Padrão'; -$lng['panel']['never'] = 'Nunca'; -$lng['panel']['active'] = 'Ativo'; -$lng['panel']['please_choose'] = 'Por favor escolha'; -$lng['panel']['allow_modifications'] = 'Aceita alteraçoes'; -$lng['domains']['add_date'] = 'Adicionado no Froxlor'; -$lng['domains']['registration_date'] = 'Adicionado no Registro'; -$lng['domains']['topleveldomain'] = 'Top-Level-Domain'; -$lng['admin']['accountdata'] = 'Data da Conta'; -$lng['admin']['contactdata'] = 'Data de Contato'; -$lng['admin']['servicedata'] = 'Data de Serviço'; -$lng['serversettings']['allow_password_reset']['description'] = 'Os clientes podem redefinir sua senha e serão enviadas para seu endereço de e-mail'; -$lng['serversettings']['allow_password_reset_admin']['title'] = 'Ativa reset de senhas pelos administradores'; -$lng['serversettings']['allow_password_reset_admin']['description'] = 'Admins / Revendedor pode redefinir sua senha e a nova senha será enviada para seu endereço de e-mail'; -$lng['panel']['not_supported'] = 'Não suportado em:'; -$lng['error']['missingfields'] = 'Nem todos os campos necessários estavam no campo.'; -$lng['error']['accountnotexisting'] = 'Esta conta não existe.'; -$lng['admin']['security_settings'] = 'Opções de Segurança'; -$lng['admin']['know_what_youre_doing'] = 'Somente altere, se você sabe o que está fazendo'; -$lng['admin']['show_version_login']['title'] = 'Mostrar versão do Froxlor no login'; -$lng['admin']['show_version_login']['description'] = 'Mostar a versão do Froxlor no rodapé da página de login'; -$lng['admin']['show_version_footer']['title'] = 'Mostar versão do Froxlor no rodapé'; -$lng['admin']['show_version_footer']['description'] = 'Mostar a versão do Froxlor no rodapé do resto das páginas'; -$lng['admin']['froxlor_graphic']['title'] = 'Cabeçalho gráfico do Froxlor'; -$lng['admin']['froxlor_graphic']['description'] = 'Quais gráficos devem aparece no topor'; -$lng['menue']['phpsettings']['maintitle'] = 'Configurações do PHP'; -$lng['admin']['phpsettings']['title'] = 'Configurações do PHP'; -$lng['admin']['phpsettings']['description'] = 'Descrição'; -$lng['admin']['phpsettings']['actions'] = 'Ações'; -$lng['admin']['phpsettings']['activedomains'] = 'Em uso pelo(s) domínio(s)'; -$lng['admin']['phpsettings']['notused'] = 'Configuração não está em uso'; -$lng['admin']['misc'] = 'Variados'; -$lng['admin']['phpsettings']['editsettings'] = 'Alterar Configuração do PHP'; -$lng['admin']['phpsettings']['addsettings'] = 'Criar novas configurações do PHP'; -$lng['admin']['phpsettings']['viewsettings'] = 'Visualizar Configuração do PHP'; -$lng['admin']['phpsettings']['phpinisettings'] = 'Configurações do php.ini'; -$lng['error']['nopermissionsorinvalidid'] = 'Você não tem permissões suficientes para alterar essa configuração ou um ID inválido foi dado.'; -$lng['panel']['view'] = 'Visualizar'; -$lng['question']['phpsetting_reallydelete'] = 'Você realmente deseja apagar esta configuração? Todos os domínios que atualmente utilizam esta configuração serão alterada para a configuração padrão.'; -$lng['admin']['phpsettings']['addnew'] = 'Criar novas configurações'; -$lng['error']['phpsettingidwrong'] = 'Não existe uma configuração de PHP para este ID'; -$lng['error']['descriptioninvalid'] = 'A descrição é muito curta, muito longa ou contém caracteres ilegais'; -$lng['error']['info'] = 'Informações'; -$lng['admin']['phpconfig']['template_replace_vars'] = 'As variáveis que serão substituídas nas Configurações'; -$lng['admin']['phpconfig']['pear_dir'] = 'Serão substituídos com a definição global para o diretório pear.'; -$lng['admin']['phpconfig']['open_basedir'] = 'Serão substituídos com a definição do domínio open_basedir.'; -$lng['admin']['phpconfig']['tmp_dir'] = 'Substituído com o diretório temporário do domínio.'; -$lng['admin']['phpconfig']['open_basedir_global'] = 'Serão substituídos com o valor global do caminho que será anexado ao open_basedir.'; -$lng['admin']['phpconfig']['customer_email'] = 'Serão substituídos com o endereço de e-mail do cliente que é dono desse domínio.'; -$lng['admin']['phpconfig']['admin_email'] = 'Serão substituídos por e-mail do administrador quem possui esse domínio.'; -$lng['admin']['phpconfig']['domain'] = 'Serão substituídos com o domínio.'; -$lng['admin']['phpconfig']['customer'] = 'Será substituída pelo nome do login do cliente que é dono desse domínio.'; -$lng['admin']['phpconfig']['admin'] = 'Será substituída pelo nome de login do administrador que possui esse domínio.'; -$lng['login']['backtologin'] = 'Voltar ao Login'; -$lng['serversettings']['mod_fcgid']['starter']['title'] = 'Processos por domínio'; -$lng['serversettings']['mod_fcgid']['starter']['description'] = 'Quantos processos devem ser iniciadas / permitidas por domínio? O valor 0 é recomendado. O PHP irá então gerir a quantidade de processos.'; -$lng['serversettings']['mod_fcgid']['wrapper']['title'] = 'Wrapper in Vhosts'; -$lng['serversettings']['mod_fcgid']['wrapper']['description'] = 'Como os wrapper vão ser incluídos nos vhosts'; -$lng['serversettings']['mod_fcgid']['tmpdir']['description'] = 'Aonde os arquivos temporários devem ser guardados'; -$lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Diretórios globais do PEAR'; -$lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Diretórios globais do PEAR que deverão ser substituídos em cada configuração php.ini? Diferentes diretórios devem ser separados por dois pontos.'; -$lng['admin']['templates']['index_html'] = 'Indice de arquivo recém-criado no diretório de cliente'; -$lng['admin']['templates']['SERVERNAME'] = 'Substitua pelo nome do servidor.'; -$lng['admin']['templates']['CUSTOMER'] = 'Substitua pelo login do cliente.'; -$lng['admin']['templates']['ADMIN'] = 'Substitua pelo login do admin.'; -$lng['admin']['templates']['CUSTOMER_EMAIL'] = 'Substitua pelo endereço de email do cliente.'; -$lng['admin']['templates']['ADMIN_EMAIL'] = 'Substitua pelo endereço de email do administrador.'; -$lng['admin']['templates']['filetemplates'] = 'Modelo de Arquivo'; -$lng['admin']['templates']['filecontent'] = 'Conteúdo do Arquivo'; -$lng['error']['filecontentnotset'] = 'O arquivo não pode ser vazio'; -$lng['serversettings']['index_file_extension']['description'] = 'Qual extensão deve ser utilizada para o índice no arquivo recém-criado no diretório do cliente? Esta extensão será utilizado, se você ou um de seus administradores criou o seu próprio índice no arquivo modelo.'; -$lng['serversettings']['index_file_extension']['title'] = 'Extensão do arquivo recém-criado no Ãndice do diretório do cliente.'; -$lng['error']['index_file_extension'] = 'A extensão do índice do arquivo deve ficar entre 1 e 6 caracteres. A prorrogação só pode conter caracteres como az, AZ e 0-9'; -$lng['admin']['expert_settings'] = 'Configurações Avançadas'; -$lng['admin']['mod_fcgid_starter']['title'] = 'Processos PHP para este domínio (vazio para usar valor padrão)'; -$lng['error']['customerdoesntexist'] = 'O cliente que você escolheu não existe'; -$lng['error']['admindoesntexist'] = 'O administrador que você escolheu não existe'; -$lng['serversettings']['session_allow_multiple_login']['title'] = 'Ativa login múltiplo'; -$lng['serversettings']['session_allow_multiple_login']['description'] = 'Se ativado um usuário pode ter múltiplos logins'; -$lng['serversettings']['panel_allow_domain_change_admin']['title'] = 'Ativa mover domínios entre admins'; -$lng['serversettings']['panel_allow_domain_change_admin']['description'] = 'If activated you can change the admin of a domain at domainsettings.
Attention: If a customer isn\'t assigned to the same admin as the domain, the admin can see every other domain of that customer!'; -$lng['serversettings']['panel_allow_domain_change_customer']['title'] = 'Ativa mover domínios entre clientes'; -$lng['serversettings']['panel_allow_domain_change_customer']['description'] = 'Se ativado você pode trocar o cliente de um domínio para administração de outro.
Attention: Froxlor não troca nenhum caminho. Isto pode fazer com que domínios parem de funcionar'; -$lng['domains']['associated_with_domain'] = 'Associado'; -$lng['domains']['aliasdomains'] = 'Encaminhamento de domínios'; -$lng['error']['ipportdoesntexist'] = 'A combinação de IP/Porta que você escolheu não existe'; -$lng['admin']['phpserversettings'] = 'Configuração do PHP'; -$lng['admin']['phpsettings']['binary'] = 'Binário do PHP'; -$lng['admin']['phpsettings']['file_extensions'] = 'Extensões de arquivos'; -$lng['admin']['phpsettings']['file_extensions_note'] = '(Sem pontos, separados por espaços)'; -$lng['admin']['mod_fcgid_maxrequests']['title'] = 'Máximo de requisições php para este domínio (vazio para valor default)'; -$lng['serversettings']['mod_fcgid']['maxrequests']['title'] = 'Máximo de solicitações por Domínio'; -$lng['serversettings']['mod_fcgid']['maxrequests']['description'] = 'Quantas solicitações serão aceitas por domínio?'; diff --git a/lng/pt.lng.php b/lng/pt.lng.php new file mode 100644 index 00000000..529a9957 --- /dev/null +++ b/lng/pt.lng.php @@ -0,0 +1,909 @@ + + * @author Ricardo Luiz Costa + * @author Thiago Goncalves de Castro + * @author Rafael Andrade + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + 'admin' => [ + 'overview' => 'Visão geral', + 'ressourcedetails' => 'Recursos usados', + 'systemdetails' => 'Detalhes do sistema', + 'froxlordetails' => 'Detalhes do Froxlor', + 'installedversion' => 'Versão instalada', + 'latestversion' => 'Ultima Versão', + 'lookfornewversion' => [ + 'clickhere' => 'procurar pela internet', + 'error' => 'Erro de leitura', + ], + 'resources' => 'Recursos', + 'customer' => 'Cliente', + 'customers' => 'Clientes', + 'customer_add' => 'Criar cliente', + 'customer_edit' => 'Editar cliente', + 'domains' => 'Domínios', + 'domain_add' => 'Criar domínio', + 'domain_edit' => 'Editar domínio', + 'subdomainforemail' => 'Subdomínio como "emaildomains"', + 'admin' => 'Administrador', + 'admins' => 'Administradores', + 'admin_add' => 'Criar administrador', + 'admin_edit' => 'Editar administrador', + 'customers_see_all' => 'Mostrar todos os clientes', + 'domains_see_all' => 'Mostrar todos os domínios', + 'change_serversettings' => 'Alterar configuraççes do servidor?', + 'server' => 'Sistema', + 'serversettings' => 'Configurações', + 'rebuildconf' => 'Escrever de novo os configs', + 'stdsubdomain' => 'Subdomínio padrão', + 'stdsubdomain_add' => 'Criar Subdomínio padrão', + 'phpenabled' => 'PHP Habilitado', + 'deactivated' => 'Desativado', + 'deactivated_user' => 'Desativar usuário', + 'sendpassword' => 'Enviar senha', + 'ownvhostsettings' => 'Own vHost-Settings', + 'configfiles' => [ + 'serverconfiguration' => 'Configurações', + 'overview' => 'Visão Geral', + 'wizard' => 'Assistente', + 'distribution' => 'Distribuição', + 'service' => 'Serviço', + 'daemon' => 'Daemon', + 'http' => 'Servidor Web (HTTP)', + 'dns' => 'Servidor de Nomes (DNS)', + 'mail' => 'Servidor de Emails (POP3/IMAP)', + 'smtp' => 'Servidor de Emails (SMTP)', + 'ftp' => 'Servidor FTP', + 'etc' => 'Outros (Sistema)', + 'choosedistribution' => 'Escolha uma distribuição', + 'chooseservice' => 'Escolha um serviço', + 'choosedaemon' => 'Escolha um daemon', + 'statistics' => 'Estatísticas', + ], + 'templates' => [ + 'templates' => 'Templates', + 'template_add' => 'Adicionar template', + 'template_edit' => 'Editar template', + 'action' => 'Ação', + 'email' => 'E-Mail', + 'subject' => 'Assunto', + 'mailbody' => 'Mensagem', + 'createcustomer' => 'E-mail de boas-vindas para novos clientes', + 'pop_success' => 'E-mail de boas-vindas para nova conta de e-mail', + 'template_replace_vars' => 'Variaveis para serem substituidas no template:', + 'FIRSTNAME' => 'Altere para o primeiro nome do cliente.', + 'NAME' => 'Altere para o nome do cliente.', + 'USERNAME' => 'Altere para nome da conta do cliente.', + 'PASSWORD' => 'Altere com a senha da conta do cliente.', + 'EMAIL' => 'Altere com os dados do servidor POP3/IMAP.', + 'TRAFFIC' => 'Substituído com o tráfego, o que foi atribuído ao cliente.', + 'TRAFFICUSED' => 'Substituído com o tráfego, que foi esgotado pela cliente.', + 'pop_success_alternative' => 'Bem-vindo para novas contas e-mail enviado ao endereço alternativo', + 'EMAIL_PASSWORD' => 'Substituído a senha da conta POP3/IMAP.', + 'index_html' => 'Indice de arquivo recém-criado no diretório de cliente', + 'SERVERNAME' => 'Substitua pelo nome do servidor.', + 'CUSTOMER' => 'Substitua pelo login do cliente.', + 'ADMIN' => 'Substitua pelo login do admin.', + 'CUSTOMER_EMAIL' => 'Substitua pelo endereço de email do cliente.', + 'ADMIN_EMAIL' => 'Substitua pelo endereço de email do administrador.', + 'filetemplates' => 'Modelo de Arquivo', + 'filecontent' => 'Conteúdo do Arquivo', + ], + 'ipsandports' => [ + 'ipsandports' => 'IPs e Portas', + 'add' => 'Adicionar IP/Porta', + 'edit' => 'Editar IP/Porta', + 'ipandport' => 'IP/Porta', + 'ip' => 'IP', + 'port' => 'Porta', + 'create_listen_statement' => 'Criar instrução de escuta', + 'create_namevirtualhost_statement' => 'Criar instrução de NameVirtualHost', + 'create_vhostcontainer' => 'Criar vHost-Container', + 'create_vhostcontainer_servername_statement' => 'Criar instrução de ServerName no vHost-Container', + 'enable_ssl' => 'Esta é uma porta SSL?', + 'ssl_cert_file' => 'Caminho para o certificado SSL', + ], + 'valuemandatory' => 'Este valor é imperativo.', + 'valuemandatorycompany' => 'Qualquer um "nome" e "nome" o "companhia" deve ser enchido.', + 'webserver' => 'Servidor Web', + 'memorylimitdisabled' => 'Desabilitado', + 'serversoftware' => 'Servidor de Software', + 'phpversion' => 'Versão do PHP', + 'phpmemorylimit' => 'Memória Limite do PHP', + 'mysqlserverversion' => 'Versão do MySQL Server', + 'mysqlclientversion' => 'Versão do MySQL Client', + 'webserverinterface' => 'Interface do Servidor Web', + 'accountsettings' => 'Configurações de Conta', + 'panelsettings' => 'Painel de Controle', + 'systemsettings' => 'Configurações do Sistema', + 'webserversettings' => 'Configurações do WebServer', + 'mailserversettings' => 'Configurações do Servidor de Email', + 'nameserversettings' => 'Configurações dos Servidores de Nomes', + 'updatecounters' => 'Recalcular utilização de recursos', + 'subcanemaildomain' => [ + 'never' => 'Nunca', + 'choosableno' => 'Escolhe, default não', + 'choosableyes' => 'Escolher, default sim', + 'always' => 'Sempre', + ], + 'webalizersettings' => 'Configurações do Webalizer', + 'webalizer' => [ + 'normal' => 'Normal', + 'quiet' => 'Quieto', + 'veryquiet' => 'Sem Saída', + ], + 'domain_nocustomeraddingavailable' => 'Não adicionar um domínio corretamente. Você primeiro precisa adicionar um cliente.', + 'loggersettings' => 'Configurações de Logs', + 'logger' => [ + 'normal' => 'normal', + 'paranoid' => 'paranóico', + ], + 'loggersystem' => 'Sistema-Log', + 'emaildomain' => 'Domínio de Email', + 'email_only' => 'Somente Email?', + 'wwwserveralias' => 'Adicionar um "www." ServerAlias', + 'subject' => 'Assunto', + 'recipient' => 'Destinatário', + 'message' => 'Escrever uma mensagem', + 'text' => 'Mensagem', + 'sslsettings' => 'Configuração de SSL', + 'dkimsettings' => 'Configurações de Chave de Domínios', + 'caneditphpsettings' => 'Pode alterar as configurações PHP relacionadas com o domínio?', + 'allips' => 'Todos os IPs', + 'awstatssettings' => 'Configurações Awtats', + 'domain_dns_settings' => 'Configurações de DNS', + 'activated' => 'Ativado', + 'statisticsettings' => 'Configurações de Estatísticas', + 'or' => 'ou', + 'sysload' => 'Carga do Sistema', + 'noloadavailable' => 'Não disponível', + 'nouptimeavailable' => 'Não disponível', + 'nosubject' => '(Sem Assunto)', + 'accountdata' => 'Data da Conta', + 'contactdata' => 'Data de Contato', + 'servicedata' => 'Data de Serviço', + 'security_settings' => 'Opções de Segurança', + 'know_what_youre_doing' => 'Somente altere, se você sabe o que está fazendo', + 'show_version_login' => [ + 'title' => 'Mostrar versão do Froxlor no login', + 'description' => 'Mostar a versão do Froxlor no rodapé da página de login', + ], + 'show_version_footer' => [ + 'title' => 'Mostar versão do Froxlor no rodapé', + 'description' => 'Mostar a versão do Froxlor no rodapé do resto das páginas', + ], + 'froxlor_graphic' => [ + 'title' => 'Cabeçalho gráfico do Froxlor', + 'description' => 'Quais gráficos devem aparece no topor', + ], + 'phpsettings' => [ + 'title' => 'Configurações do PHP', + 'description' => 'Descrição', + 'actions' => 'Ações', + 'activedomains' => 'Em uso pelo(s) domínio(s)', + 'notused' => 'Configuração não está em uso', + 'editsettings' => 'Alterar Configuração do PHP', + 'addsettings' => 'Criar novas configurações do PHP', + 'viewsettings' => 'Visualizar Configuração do PHP', + 'phpinisettings' => 'Configurações do php.ini', + 'addnew' => 'Criar novas configurações', + 'binary' => 'Binário do PHP', + 'file_extensions' => 'Extensões de arquivos', + 'file_extensions_note' => '(Sem pontos, separados por espaços)', + ], + 'misc' => 'Variados', + 'phpconfig' => [ + 'template_replace_vars' => 'As variáveis que serão substituídas nas Configurações', + 'pear_dir' => 'Serão substituídos com a definição global para o diretório pear.', + 'open_basedir' => 'Serão substituídos com a definição do domínio open_basedir.', + 'tmp_dir' => 'Substituído com o diretório temporário do domínio.', + 'open_basedir_global' => 'Serão substituídos com o valor global do caminho que será anexado ao open_basedir.', + 'customer_email' => 'Serão substituídos com o endereço de e-mail do cliente que é dono desse domínio.', + 'admin_email' => 'Serão substituídos por e-mail do administrador quem possui esse domínio.', + 'domain' => 'Serão substituídos com o domínio.', + 'customer' => 'Será substituída pelo nome do login do cliente que é dono desse domínio.', + 'admin' => 'Será substituída pelo nome de login do administrador que possui esse domínio.', + ], + 'expert_settings' => 'Configurações Avançadas', + 'mod_fcgid_starter' => [ + 'title' => 'Processos PHP para este domínio (vazio para usar valor padrão)', + ], + 'phpserversettings' => 'Configuração do PHP', + 'mod_fcgid_maxrequests' => [ + 'title' => 'Máximo de requisições php para este domínio (vazio para valor default)', + ], + ], + 'changepassword' => [ + 'old_password' => 'Senha atual', + 'new_password' => 'Nova senha', + 'new_password_confirm' => 'Repita a nova senha', + 'new_password_ifnotempty' => 'Nova senha (em branco = não alterar)', + 'also_change_ftp' => ' trocar tambem a senha da conta principal de FTP', + 'also_change_stats' => 'Troca a senha das estatísticas', + ], + 'cronjobs' => [ + 'notyetrun' => 'Ainda não está rodando', + ], + 'customer' => [ + 'documentroot' => 'Diretório home', + 'name' => 'Sobrenome', + 'firstname' => 'Primeiro nome', + 'company' => 'Empresa', + 'street' => 'Endereço', + 'zipcode' => 'CEP', + 'city' => 'Cidade', + 'phone' => 'Telefone', + 'fax' => 'Fax', + 'email' => 'E-mail', + 'customernumber' => 'Cliente ID', + 'diskspace' => 'Espaço de disco (MB)', + 'traffic' => 'Tráfego (GB)', + 'mysqls' => 'Bancos de dados-MySQL', + 'emails' => 'Endereços de e-mail', + 'accounts' => 'Contas de e-mail', + 'forwarders' => 'Redirecionamentos de e-mail', + 'ftps' => 'Contas de FTP', + 'subdomains' => 'Sub-Domínio(s)', + 'domains' => 'Domínio(s)', + 'email_quota' => 'E-mail Quota', + 'email_imap' => 'E-mail IMAP', + 'email_pop3' => 'E-mail POP3', + 'mail_quota' => 'Quota de Email', + 'title' => 'Título', + 'country' => 'País', + ], + 'dkim' => [ + 'dkim_prefix' => [ + 'title' => 'Prefixo', + 'description' => 'Por favor, especifique o caminho para o os arquivos DKIM RSA, bem como para os arquivos de configuração para o plugin Milter', + ], + 'dkim_domains' => [ + 'title' => 'Nome de arquivo de domínios', + 'description' => 'Nome do Arquivo dos Domínios do DKIM, parâmetro especificado na configuração do dkim-Milter', + ], + 'dkim_dkimkeys' => [ + 'title' => 'Nome de arquivo de chaves', + 'description' => 'Nome do ArquivoDKIM KeyList do parâmetro especificado na configuração dkim-Milter', + ], + 'dkimrestart_command' => [ + 'title' => 'Comando para reiniciar o Milter', + 'description' => 'Por favor especifique um comando para reiniciar o DKIM Milter', + ], + 'use_dkim' => [ + 'title' => 'Ativar suporte para DKIM?', + 'description' => 'Você deseja usar o sistema de chaves de domínio (DKIM) ?', + ], + ], + 'dns' => [ + 'destinationip' => 'Domínio IP', + 'standardip' => 'IP padrão do servidor', + 'a_record' => 'Gravar-A(Opcional IPV6)', + 'cname_record' => 'Gravar-CNAME', + 'mxrecords' => 'Definir entradas MX', + 'standardmx' => 'Servidor MX padrão', + 'mxconfig' => 'Registros MX personalizados', + 'priority10' => 'Prioridade 10', + 'priority20' => 'Prioridade 20', + 'txtrecords' => 'Difinir entradas TXT', + 'txtexample' => 'Exemplo (Entrada-SPF):
v=spf1 ip4:xxx.xxx.xx.0/23 -all', + ], + 'domain' => [ + 'docroot' => 'trajeto da linha acima de', + 'homedir' => 'diretório da casa', + 'openbasedirpath' => 'Caminho do OpenBaseDir', + ], + 'domains' => [ + 'description' => 'Aqui você pode criar (sub-)domínios e alterar seu destino.
O sistema irá levar algum tempo para aplicar as novas configurações depois de salvas.', + 'domainsettings' => 'Configurar Domínio', + 'domainname' => 'Nome do domínio', + 'subdomain_add' => 'Criar Sub-domínio', + 'subdomain_edit' => 'Editar (sub)domínio', + 'wildcarddomain' => 'Criar um wildcarddomain?', + 'aliasdomain' => 'Aliás para o domínio', + 'noaliasdomain' => 'Não domínio do aliás', + 'hasaliasdomains' => 'Possui alinhas de domínio(s)', + 'statstics' => 'Estatísticas de Uso', + 'isassigneddomain' => 'É um domínio assinado', + 'add_date' => 'Adicionado no Froxlor', + 'registration_date' => 'Adicionado no Registro', + 'topleveldomain' => 'Top-Level-Domain', + 'associated_with_domain' => 'Associado', + 'aliasdomains' => 'Encaminhamento de domínios', + ], + 'emails' => [ + 'description' => 'Aqui você pode criar e alterer seus e-mails.
Uma conta é como uma caixa de correio na frente de sua casa. Quando alguem envia para você um e-mail, ele é colocado nesta conta.

Para baixar seus e-mails use as seguintes configurações no seu propraga de e-mails favorito: (Os dados em italico devem ser substituidos pelo equivalente da conta que você criou!)
Hostname: Nome de seu domínio
Usuário: Nome da conta / Endereço de e-mail
Senha: a senha que você escolheu', + 'emailaddress' => 'Endereços de e-mail', + 'emails_add' => 'Criar e-mail', + 'emails_edit' => 'Editar e-mail', + 'catchall' => 'Pega tudo', + 'iscatchall' => 'Definir como endereço pega tudo?', + 'account' => 'Conta', + 'account_add' => 'Criar conta', + 'account_delete' => 'Excluir conta', + 'from' => 'Origem', + 'to' => 'Destino', + 'forwarders' => 'Redirecionamentos', + 'forwarder_add' => 'Criar redirecionamento', + 'alternative_emailaddress' => 'Endereço de E-mail alternativo', + 'quota' => 'Quota', + 'noquota' => 'Sem quota', + 'updatequota' => 'Atualizar', + ], + 'error' => [ + 'error' => 'Erro', + 'directorymustexist' => 'O diretório %s deve existir. Por favor crie ele primeiro com seu programa de FTP.', + 'filemustexist' => 'O arquivo %s deve existir.', + 'allresourcesused' => 'Você já usou todos os seus recursos.', + 'domains_cantdeletemaindomain' => 'Você não pode deletar um domínio que esta sendo usado como email-domain.', + 'domains_canteditdomain' => 'Você não pode editar este domínio. Ele foi desabilitado pelo administrador.', + 'domains_cantdeletedomainwithemail' => 'Você não pode deletar um domínio que é usado como email-domain. Delete todos as contas de e-mail primeiro.', + 'firstdeleteallsubdomains' => 'Você deve deletar todos subdomínios antes de poder criar um wildcard domain.', + 'youhavealreadyacatchallforthisdomain' => 'Você já definiu uma conta pega tudo para este domínio.', + 'ftp_cantdeletemainaccount' => 'Você não pode deletar a conta principal de FTP', + 'login' => 'O usuário ou senha digitados, não estão corretos. Por favor tente novamente!', + 'login_blocked' => 'Esta conta está suspensa por exceder as tentativas de login permitidas.
Por favor tente novamente em %s segundos.', + 'notallreqfieldsorerrors' => 'Você não preencheu todos os campos ou preencheu algum campo incorretamente.', + 'oldpasswordnotcorrect' => 'A senha antiga não confere.', + 'youcantallocatemorethanyouhave' => 'Você não pode alocar mais recursos do que você mesmo possui.', + 'mustbeurl' => 'Você não digitou uma URL válida (ex. http://seudominio.com/erro404.htm)', + 'invalidpath' => 'Optou por um URL não válido (eventuais problemas na lista do directório)', + 'stringisempty' => 'Faltando informação no campo', + 'stringiswrong' => 'Erro na informação do campo', + 'newpasswordconfirmerror' => 'A nova senha e a confirmação não conferem', + 'mydomain' => '\'Domínio\'', + 'mydocumentroot' => '\'Documento principal\'', + 'loginnameexists' => 'Login %s já existe', + 'emailiswrong' => 'E-mail %s contém caracteres inválidos ou está incompleto', + 'loginnameiswrong' => 'Login %s contém caracteres inválidos', + 'loginnameiswrong2' => 'Login contém muitos caracteres. Somente %s caracteres são aceitos.', + 'userpathcombinationdupe' => 'Usuario e caminho já existem', + 'patherror' => 'Erro geral! o caminho não pode ficar em branco', + 'errordocpathdupe' => 'Opção de caminho %s já existe', + 'adduserfirst' => 'Por favor crie um cliente primeiro', + 'domainalreadyexists' => 'O domínio %s já está apontado para outro cliente', + 'nolanguageselect' => 'Nenhum idioma selecionado.', + 'nosubjectcreate' => 'Você deve definir um nome para este e-mail template.', + 'nomailbodycreate' => 'Você deve definir o texto para este e-mail template.', + 'templatenotfound' => 'Template não encontrado.', + 'alltemplatesdefined' => 'Você não pode definir mais templates, todos idiomas já suportados.', + 'wwwnotallowed' => 'www não é permitido como nome de subdomínio.', + 'subdomainiswrong' => 'O subdomínio %s contém caracteres inválidos.', + 'domaincantbeempty' => 'O nome do domínio não pode estar vazio.', + 'domainexistalready' => 'O domínio %s já existe.', + 'domainisaliasorothercustomer' => 'O domínio-alias escolhido é ele próprio um domínio-alias ou este pertence a um outro cliente.', + 'emailexistalready' => 'O E-mail %s já existe.', + 'maindomainnonexist' => 'O domínio principal %s não existe.', + 'destinationnonexist' => 'Por favor crie seu redirecionamento no campo \'Destino\'.', + 'destinationalreadyexistasmail' => 'O redirecionamento %s já existe como uma conta de e-mail.', + 'destinationalreadyexist' => 'Você já definiu um redirecionamento para %s .', + 'destinationiswrong' => 'O redirecionamento %s contém caracteres inválidos ou incompletos.', + 'ipstillhasdomains' => 'O IP/Porta que você quer deletar ainda possui domínios associados e eles, por favor altere o IP/Porta destes domínios antes de deletá-los.', + 'cantdeletedefaultip' => 'Você não pode deletar o IP/Porta padrão do revendedor, por favor defina outro IP/Porta como padrão antes deletar o IP/Porta desejado', + 'cantdeletesystemip' => 'Você não pode deletar o IP do sistema, nem criar uma nova combinação IP/Porta para o sistema ou trocar o IP do sistema.', + 'myipaddress' => '\'IP\'', + 'myport' => '\'Porta\'', + 'myipdefault' => 'Você precisa selecionar o IP/Porta que será padrão.', + 'myipnotdouble' => 'Esta combinação IP/Porta já existe.', + 'cantchangesystemip' => 'Você não pode mudar o último sistema IP, para criar uma outra combinação nova de IP/Port para o sistema IP ou para mudar o sistema IP', + 'loginnameissystemaccount' => 'Você não pode criar os clientes que são similares aos systemaccounts. Incorpore por favor um outro accountname.', + 'admin_domain_emailsystemhostname' => 'Desculpe. Você não pode usar o hostname do servidor como domínio de email', + 'sessiontimeoutiswrong' => 'Apenas numeros "Timeout da sessão" permitido.', + 'maxloginattemptsiswrong' => 'Apenas numero "Tentativa maxima de Login" permitido.', + 'deactivatetimiswrong' => 'Apenas numero "Desativar Tempo" permitido.', + 'accountprefixiswrong' => 'O "Prefixo" está errado.', + 'mysqlprefixiswrong' => 'O "Prefixo SQL" está errado.', + 'ftpprefixiswrong' => 'O "Prefixo FTP" está errado.', + 'ipiswrong' => 'O "Endereço-IP" está errado. Apenas um Endereço-IP válido é permitido.', + 'vmailuidiswrong' => 'O "UID do E-mail" Está errado. Só é permitido um número de ID.', + 'vmailgidiswrong' => 'O "GID do E-mail" Está errado. Só é permitido um número de ID.', + 'adminmailiswrong' => 'O "Endereço de Envio" está errado. Apenas um endereço de e-mail válido é permitido.', + 'pagingiswrong' => 'O "Entradas por páginas"-value está errado. Somente caracteres númericos são permitidos.', + 'phpmyadminiswrong' => 'O caminho para o phpMyAmin não é válido', + 'webmailiswrong' => 'O caminho para o Webmail não é válido', + 'webftpiswrong' => 'O caminho para o WebFTP não é válido', + 'stringformaterror' => 'O valor par ao campo "%s" não esta no formato correto.', + 'youcantdeleteyourself' => 'Você não pode apagar você mesmo por motivos de segurança', + 'youcanteditallfieldsofyourself' => 'Nota: Você não pode editar todos os campos de sua própria conta por motivos de segurança', + 'documentrootexists' => 'O Diretório "%s" já existe para este usuario. Por favor remova-o e depois tente novamente.', + 'formtokencompromised' => 'O Pedido parece estar correto. Por motivos de segurança você está desconectado.', + 'logerror' => 'Log-Erro: %s', + 'nomessagetosend' => 'Você não entrou com uma mensagem', + 'norecipientsgiven' => 'Você não especificou um destinatário', + 'errorsendingmail' => 'A mensagem para "%s" falhou', + 'cannotreaddir' => 'Não é possível ler o diretório "%s"', + 'vmailquotawrong' => 'A tamanho da quota deve ser entre 1 e 999', + 'invalidip' => 'Endereço de IP Inválido: %s', + 'invalidmysqlhost' => 'Endereço de servidor MySQL inválido: %s', + 'cannotuseawstatsandwebalizeratonetime' => 'Você não pode ativar Webalizer e Awstats ao mesmo tempo, por favor, escolha uma delas', + 'cannotwritetologfile' => 'Não pode abrir arquivo de log %s para escrita', + 'missingfields' => 'Nem todos os campos necessários estavam no campo.', + 'accountnotexisting' => 'Esta conta não existe.', + 'nopermissionsorinvalidid' => 'Você não tem permissões suficientes para alterar essa configuração ou um ID inválido foi dado.', + 'phpsettingidwrong' => 'Não existe uma configuração de PHP para este ID', + 'descriptioninvalid' => 'A descrição é muito curta, muito longa ou contém caracteres ilegais', + 'info' => 'Informações', + 'filecontentnotset' => 'O arquivo não pode ser vazio', + 'index_file_extension' => 'A extensão do índice do arquivo deve ficar entre 1 e 6 caracteres. A prorrogação só pode conter caracteres como az, AZ e 0-9', + 'customerdoesntexist' => 'O cliente que você escolheu não existe', + 'admindoesntexist' => 'O administrador que você escolheu não existe', + 'ipportdoesntexist' => 'A combinação de IP/Porta que você escolheu não existe', + ], + 'extras' => [ + 'description' => 'Aqui você pode adicoionar alguns recursos extras, como por exemplo um diretório protegido.
O sistema ira precisar de algum tempo para aplicar suas alterações depois de salvas.', + 'directoryprotection_add' => 'Adicionar diretório pretogido', + 'view_directory' => 'Mostrar conteúdo do diretório', + 'pathoptions_add' => 'Adicionar opções de caminho', + 'directory_browsing' => 'Pesquizar conteúdo de diretório', + 'pathoptions_edit' => 'Esitar opções de caminhos', + 'errordocument404path' => 'URL para página de erro 404', + 'errordocument403path' => 'URL para página de erro 403', + 'errordocument500path' => 'URL para página de erro 500', + 'errordocument401path' => 'URL para página de erro 401', + ], + 'ftp' => [ + 'description' => 'Aqui você pode criar e alterar suas contas de FTP.
As alterações são instantâneas e podem ser utilizadas imediatamente depois de salvas.', + 'account_add' => 'Criar conta', + ], + 'index' => [ + 'customerdetails' => 'Detalhes dos Clientes', + 'accountdetails' => 'Detalhes das Contas', + ], + 'logger' => [ + 'date' => 'Data', + 'type' => 'Tipo', + 'action' => 'Ação', + 'user' => 'Usuário', + 'truncate' => 'Log Vazio', + ], + 'login' => [ + 'username' => 'Usuário', + 'password' => 'Senha', + 'language' => 'Idioma', + 'login' => 'Login', + 'logout' => 'Sair', + 'profile_lng' => 'Idioma padrão', + 'forgotpwd' => 'Perdeu sua senha?', + 'presend' => 'Resetar senha', + 'email' => 'Endereço de E-mail', + 'remind' => 'Resetar minha senha', + 'usernotfound' => 'Úsuario não encontrado', + 'backtologin' => 'Voltar ao Login', + ], + 'mails' => [ + 'pop_success' => [ + 'mailbody' => 'Olá,\\n\\n sua conta de e-mail {EMAIL}\\n foi criada com sucesso.\\n\\nEsta é uma mensagem automática\\neMail, por favor não responda!\\n\\nAtenciosamente, Equipe de desenvolvimento do Froxlor', + 'subject' => 'Conta de e-mail criada com sucesso!', + ], + 'createcustomer' => [ + 'mailbody' => 'Olá {FIRSTNAME} {NAME},\\n\\nseguem os detalhes de sua nova conta de e-mail:\\n\\nUsuario: {USERNAME}\\nSenha: {PASSWORD}\\n\\nObrigado,\\nEquipe de desenvolvimento do Froxlor', + 'subject' => 'Informações da conta', + ], + 'pop_success_alternative' => [ + 'mailbody' => 'Oi,\\n\\nSua conta de email {EMAIL}\\nfoi configurada corretamente.\\nSua senha é{PASSWORD}.\\n\\nEmail criado automaticamente\\n, Por favor não responda!\\n\\nCumprimentos, Equipe Froxlor.', + 'subject' => 'Conta de email criada com sucesso', + ], + 'password_reset' => [ + 'subject' => 'Reset de Senha', + 'mailbody' => 'Oi {USERNAME},\\n\\nsua senha do Froxlor foi resetada!\\nA nova senha é: {LINK}\\n\\nObrigado,\\nequipe Froxlor', + ], + ], + 'menu' => [ + 'message' => 'Mensagens', + ], + 'menue' => [ + 'main' => [ + 'main' => 'Principal', + 'changepassword' => 'Trocar senha', + 'changelanguage' => 'Trocar idioma', + 'username' => 'Logado como', + ], + 'email' => [ + 'email' => 'E-mail', + 'emails' => 'Endereços', + 'webmail' => 'WebMail', + ], + 'mysql' => [ + 'mysql' => 'MySQL', + 'databases' => 'Banco de dados', + 'phpmyadmin' => 'phpMyAdmin', + ], + 'domains' => [ + 'domains' => 'Domínios', + 'settings' => 'Configurações', + ], + 'ftp' => [ + 'ftp' => 'FTP', + 'accounts' => 'Contas', + 'webftp' => 'WebFTP', + ], + 'extras' => [ + 'extras' => 'Extras', + 'directoryprotection' => 'Diretório protegido', + 'pathoptions' => 'Opções de caminhos', + ], + 'traffic' => [ + 'traffic' => 'Tráfego', + 'current' => 'Mês corrente', + ], + 'phpsettings' => [ + 'maintitle' => 'Configurações do PHP', + ], + ], + 'message' => [ + 'norecipients' => 'Email não enviado porque não tem destinatário no banco de dados', + ], + 'mysql' => [ + 'description' => 'Aqui você pode criar e alterar seus bancos de dados MySQL.
As alterações são instantâneas e podem ser utilizadas imediatamente depois de salvas.
No menu do lado esquerdo você pode encontrar a ferramenta phpMyAdmin e com ela facilmente administrar seus bancos de dados.

Para usar seu banco de dados com scripts em PHP use as seguintes configurações: (Os dados em italico devem ser substituidos pelo equivalente do banco de dados que você criou!)
Hostname:
Usuario: Nome do banco de dadose
Senha: a senha que você escolheu
Banco de dados: Nome do banco de dados', + 'databasename' => 'Usuario / Nome do banco de dados', + 'databasedescription' => 'Descrição do banco de dados', + 'database_create' => 'Criar banco de dados', + ], + 'panel' => [ + 'edit' => 'Editar', + 'delete' => 'Deletar', + 'create' => 'Criar', + 'save' => 'Salvar', + 'yes' => 'Sim', + 'no' => 'Não', + 'emptyfornochanges' => 'Sair sem salvar', + 'emptyfordefault' => 'Restaurar padrão', + 'path' => 'Caminho', + 'toggle' => 'Toggle', + 'next' => 'Próximo', + 'dirsmissing' => 'Directório não disponível ou ilegível', + 'urloverridespath' => 'URL (Caminho Completo)', + 'pathorurl' => 'Caminho ou URL', + 'ascending' => 'Crescente', + 'descending' => 'Decrescente', + 'search' => 'Procurar', + 'used' => 'Usado', + 'translator' => 'Tradutor', + 'reset' => 'Descartar Mudanças', + 'pathDescription' => 'Se o diretório não existir, será criado automaticamente', + 'back' => 'Volta', + 'reseller' => 'Revenda', + 'admin' => 'Administrador', + 'customer' => 'Cliente(s)', + 'send' => 'Enviar', + 'nosslipsavailable' => 'Não existem atualmente IP SSL / Porta para este servidor.', + 'backtooverview' => 'Voltar para Visão Geral', + 'dateformat' => 'AAAA-MM-DD', + 'dateformat_function' => 'A-m-d', + 'timeformat_function' => 'H:i:S', + 'default' => 'Padrão', + 'never' => 'Nunca', + 'active' => 'Ativo', + 'please_choose' => 'Por favor escolha', + 'allow_modifications' => 'Aceita alteraçoes', + 'not_supported' => 'Não suportado em:', + 'view' => 'Visualizar', + ], + 'pwdreminder' => [ + 'success' => 'Redefinição de senha com sucesso.
Você agora deve receber um e-mail com sua nova senha.', + 'notallowed' => 'Reset de senhas está desativado', + ], + 'question' => [ + 'question' => 'Pergunta de segurança', + 'admin_customer_reallydelete' => 'Você realmente deseja deletar o cliente %s? Este comando não poderá ser cancelado!', + 'admin_domain_reallydelete' => 'Você realmente deseja deletar o domínio %s?', + 'admin_domain_reallydisablesecuritysetting' => 'Você realmente deseja desativar estas configurações de segurança (OpenBasedir)?', + 'admin_admin_reallydelete' => 'Você realmente deseja deletar o administrador %s? Todos clientes e domínios serão realocados para o administrador principal.', + 'admin_template_reallydelete' => 'Você realmente deseja deletar o template \'%s\'?', + 'domains_reallydelete' => 'Você realmente deseja deletar o domínio %s?', + 'email_reallydelete' => 'Você realmente deseja deletar o e-mail %s?', + 'email_reallydelete_account' => 'Você realmente deseja deletar a conta de e-mail %s?', + 'email_reallydelete_forwarder' => 'Você realmente deseja deletar o redirecionamento %s?', + 'extras_reallydelete' => 'Você realmente deseja deletar a proteção do diretório %s?', + 'extras_reallydelete_pathoptions' => 'Você realmente deseja deletar o caminho %s?', + 'ftp_reallydelete' => 'Você realmente deseja deletar a conta de FTP %s?', + 'mysql_reallydelete' => 'Você realmente deseja deletar o banco de dados %s? Este comando não poderá ser cancelado!', + 'admin_configs_reallyrebuild' => 'Está certo que quer deixar reconfigurar os ficheiros de configuração de Apache e Bind?', + 'admin_customer_alsoremovefiles' => 'Remover arquivos do usuário também?', + 'admin_customer_alsoremovemail' => 'Remover todos os dados de e-mail do sistema de arquivos?', + 'admin_customer_alsoremoveftphomedir' => 'Remover o diretório home do usuário FTP?', + 'admin_ip_reallydelete' => 'Você realmente deseja deletar este endereço IP?', + 'admin_domain_reallydocrootoutofcustomerroot' => 'É você certo, você quer a raiz do original para este domínio, não estando dentro do customerroot do cliente?', + 'admin_counters_reallyupdate' => 'Você deseja recalcular os recursos utilizados?', + 'logger_reallytruncate' => 'Você realmente deseja dividir a tabela "%s"?', + 'admin_quotas_reallywipe' => 'Você realmente deseja limpar todas as quotas na tabela mail_users? Isto não pode ser revertido', + 'phpsetting_reallydelete' => 'Você realmente deseja apagar esta configuração? Todos os domínios que atualmente utilizam esta configuração serão alterada para a configuração padrão.', + ], + 'serversettings' => [ + 'session_timeout' => [ + 'title' => 'Tempo esgotado', + 'description' => 'Quanto tempo o usuario deve estar inativo para ser desconectado (segundos)?', + ], + 'accountprefix' => [ + 'title' => 'Prefixo do cliente', + 'description' => 'Qual o prefixo "customeraccounts" deve ter?', + ], + 'mysqlprefix' => [ + 'title' => 'SQL Prefixo', + 'description' => 'Qual prefixo as contas mysql devem ter?', + ], + 'ftpprefix' => [ + 'title' => 'FTP Prefixo', + 'description' => 'Qual prefixo as contas de FTP devem ter?', + ], + 'documentroot_prefix' => [ + 'title' => 'Diretório de documentação', + 'description' => 'Aonde os documentos dever ser gravados?', + ], + 'logfiles_directory' => [ + 'title' => 'Diretório de LOG', + 'description' => 'Aonde os arquivos de log dever ser gravados?', + ], + 'ipaddress' => [ + 'title' => 'Endereços de IP', + 'description' => 'Quais os Endereços IP deste servidor?', + ], + 'hostname' => [ + 'title' => 'Hostname', + 'description' => 'Qual o Hostname deste servidor?', + ], + 'apachereload_command' => [ + 'title' => 'Comando de reiniciar o Apache', + 'description' => 'Qual o comando para reiniciar o apache?', + ], + 'bindenable' => [ + 'title' => 'Habilitar Servidor de Nomes', + 'description' => 'Aqui o servidor de nomes pode ser habilitado ou desabilitado globalmente.', + ], + 'bindconf_directory' => [ + 'title' => 'Diretório de configuração do Bind', + 'description' => 'Aonde estão os arquivos de configuração do bind?', + ], + 'bindreload_command' => [ + 'title' => 'Comando de reiniciar o Bind', + 'description' => 'Qual o comando para reiniciar o bind?', + ], + 'vmail_uid' => [ + 'title' => 'Mails-Uid', + 'description' => 'Qual UserID os e-mails devem ter?', + ], + 'vmail_gid' => [ + 'title' => 'Mails-Gid', + 'description' => 'Qual GroupID os e-mails devem ter?', + ], + 'vmail_homedir' => [ + 'title' => 'Mails-Homedir', + 'description' => 'Aonde os e-mails devem ser gravados?', + ], + 'adminmail' => [ + 'title' => 'Remetente', + 'description' => 'Qual o remetente dos e-mails enviados pelo painel?', + ], + 'phpmyadmin_url' => [ + 'title' => 'phpMyAdmin URL', + 'description' => 'Qual a URL do phpMyAdmin? (deve iniciar com http://)', + ], + 'webmail_url' => [ + 'title' => 'WebMail URL', + 'description' => 'Qual a URL do WebMail? (deve iniciar com http://)', + ], + 'webftp_url' => [ + 'title' => 'WebFTP URL', + 'description' => 'Qual a URL do WebFTP? (deve iniciar com http://)', + ], + 'language' => [ + 'description' => 'Qual o idioma padrão do servidor?', + ], + 'maxloginattempts' => [ + 'title' => 'Tentativas maximas de Login', + 'description' => 'Tentativas maximas de Login para a conta ser desativada.', + ], + 'deactivatetime' => [ + 'title' => 'Tempo que a conta deve permanecer desativada', + 'description' => 'Tempo (sec.) qua a conta permanece desativada depois de muitas tentativas de login.', + ], + 'pathedit' => [ + 'title' => 'File-Método de entrada', + 'description' => 'A escolha do file tem que ser feita através do Dropdown-Menu ou pode ser feita manualmente?', + ], + 'paging' => [ + 'title' => 'Entradas por pagina', + 'description' => 'Quantas entradas devem ser mostradas por pagina? (0 = desabilitar paginas)', + ], + 'nameservers' => [ + 'title' => 'Servidores DNS', + ], + 'mxservers' => [ + 'title' => 'Servidores de Email', + 'description' => 'Uma lista separada por vírgulas que contém o numero de prioridade e o hostname separados por um espaço (por exemplo: \'mx.example.com 10 \'), contendo os servidores mx.', + ], + 'defaultip' => [ + 'title' => 'IP/Porta Padrão', + 'description' => 'Qual é a IP/Porta Padrão?', + ], + 'phpappendopenbasedir' => [ + 'title' => 'Caminho para adicionar OpenBasedir', + 'description' => 'Estes caminhos (separados por dois pontos) serão acrescentados ao OpenBasedir em cada vhost.', + ], + 'natsorting' => [ + 'title' => 'Usar classificação natural na visualização', + 'description' => 'Ordenar listas como: web1 -> web2 -> web11 ao invéz de web1 -> web11 -> web2.', + ], + 'deactivateddocroot' => [ + 'title' => 'Docroots desativado para usuários', + 'description' => 'Quando um usuário estiver desativado, esse caminho é usado como seu docroot. Deixe em branco para não criar um vhost a todos.', + ], + 'mailpwcleartext' => [ + 'title' => 'Salva as senhas de usuários sempre criptografia no banco de dados', + 'description' => 'Se você selecionar sim, todas as senhas serão guardadas descriptografadas (Poderá ser lido por todos com acesso ao banco de dados ) na tabela mail_users-table. Somente ative essa opção se você realmente precise!', + 'removelink' => 'Clique aqui para limpar todas as senhas não criptografadas da tabela
Você realmente deseja limpar todas as senhas não encriptadas a partir da tabela mail_users? Isto não pode ser revertido!', + ], + 'ftpdomain' => [ + 'title' => 'Contas FTP @domínio', + 'description' => 'Clientes podem criar contas de FTP user@domíniodocliente?', + ], + 'mod_fcgid' => [ + 'title' => 'Incluir PHP via mod_fcgid/suexec', + 'description' => 'Use mod_fcgid/suexec/libnss_mysql to run PHP with the corresponding useraccount.
This needs a special Apache configuration. All following options are only valid if the module is enabled.', + 'configdir' => [ + 'title' => 'Diretório de configuração', + 'description' => 'Aonde todos os arquivos de configuração do fcgid vão ser guardados? Se você não utiliza um binário compilado, está é uma situação normal, deve estar dentro de /var/www/', + ], + 'tmpdir' => [ + 'title' => 'Diretório Temporário', + 'description' => 'Aonde os arquivos temporários devem ser guardados', + ], + 'starter' => [ + 'title' => 'Processos por domínio', + 'description' => 'Quantos processos devem ser iniciadas / permitidas por domínio? O valor 0 é recomendado. O PHP irá então gerir a quantidade de processos.', + ], + 'wrapper' => [ + 'title' => 'Wrapper in Vhosts', + 'description' => 'Como os wrapper vão ser incluídos nos vhosts', + ], + 'peardir' => [ + 'title' => 'Diretórios globais do PEAR', + 'description' => 'Diretórios globais do PEAR que deverão ser substituídos em cada configuração php.ini? Diferentes diretórios devem ser separados por dois pontos.', + ], + 'maxrequests' => [ + 'title' => 'Máximo de solicitações por Domínio', + 'description' => 'Quantas solicitações serão aceitas por domínio?', + ], + ], + 'sendalternativemail' => [ + 'title' => 'Utilize endereço de e-mail alternativo', + 'description' => 'Enviar e-mail a senha para um endereço diferente durante uma criação de conta de e-mail', + ], + 'apacheconf_vhost' => [ + 'title' => 'Arquivo/Diretório de configurações do Apache Vhost', + 'description' => 'Onde as configuração de Vhost devem ser guardadas? Você pode especificar um arquivo (todos os vhosts em um arquivo) ou diretório (cada vhost com seu próprio arquivo) aqui.', + ], + 'apacheconf_diroptions' => [ + 'title' => 'Configuração de diretório do Apache Arquivo/Nome do Diretório.', + 'description' => 'Quando as opções de configuração de diretório deve ser armazenada? Você poderia especificar um arquivo (todas as opções em um arquivo) ou diretório ( cada opção no seu próprio arquivo).', + ], + 'apacheconf_htpasswddir' => [ + 'title' => 'Apache htpasswd dirname', + 'description' => 'Onde deve ser o diretório de arquivos htpasswd?', + ], + 'mysql_access_host' => [ + 'title' => 'Hosts de Acesso MySQL', + 'description' => 'Uma lista separada por vírgulas de hosts a partir do qual os utilizadores devem ter a possibilidade de conectar-se ao MySQL-Server.', + ], + 'webalizer_quiet' => [ + 'title' => 'Saida do Webalizer', + 'description' => 'Modo verbose do webalizer', + ], + 'logger' => [ + 'enable' => 'Habilitar/Desabilitar Logs', + 'severity' => 'Nível de Logs', + 'types' => [ + 'title' => 'Tipos de Log(s)', + 'description' => 'Especificar tipos de logs separados por vírgula.
Tipos de lógs disponíveis: syslog, file, mysql', + ], + 'logfile' => 'Caminho do Arquivo de Log incluindo nome de arquivo', + 'logcron' => 'Logar tarefas do cron', + 'logcronoption' => [ + 'never' => 'Nunca', + 'once' => 'Uma vez', + 'always' => 'Sempre', + ], + ], + 'ssl' => [ + 'openssl_cnf' => 'Padrão para criar o arquivo de certificado', + ], + 'default_vhostconf' => [ + 'title' => 'Configuração de Vhost padrão', + 'description' => 'O conteúdo deste campo será incluído a cada novo vhost criado. Atenção: O código será checado para algum erro. Se contiver erros, o apache pode não iniciar mais', + ], + 'mail_quota' => [ + 'title' => 'Quota de Email', + 'description' => 'Quota default para novas caixas criadas', + ], + 'mail_quota_enabled' => [ + 'title' => 'Usar quota para clientes', + 'description' => 'Ative para usar cotas em caixas de email. Padrão é Não visto que requer uma configuração especial.', + 'removelink' => 'Clique aqui para limpar todas as quotas para as contas de email.', + ], + 'decimal_places' => 'Número de casas decimais no tráfego / espaço de paginas web', + 'webalizer_enabled' => 'Ativar estatísticas webalizer', + 'awstats_enabled' => 'Ativar estatísticas awstats', + 'selfdns' => [ + 'title' => 'Configurações DNS-Domiio personalizadas', + ], + 'selfdnscustomer' => [ + 'title' => 'Aceita clientes para editar configurações de DNS', + ], + 'unix_names' => [ + 'title' => 'Usar nomes compatíveis com UNIX', + 'description' => 'Aceita você usar - and _ em nomes de usuários se Noestiver marcado', + ], + 'allow_password_reset' => [ + 'title' => 'Aceita reset de senha por clientes', + 'description' => 'Os clientes podem redefinir sua senha e serão enviadas para seu endereço de e-mail', + ], + 'allow_password_reset_admin' => [ + 'title' => 'Ativa reset de senhas pelos administradores', + 'description' => 'Admins / Revendedor pode redefinir sua senha e a nova senha será enviada para seu endereço de e-mail', + ], + 'index_file_extension' => [ + 'description' => 'Qual extensão deve ser utilizada para o índice no arquivo recém-criado no diretório do cliente? Esta extensão será utilizado, se você ou um de seus administradores criou o seu próprio índice no arquivo modelo.', + 'title' => 'Extensão do arquivo recém-criado no Ãndice do diretório do cliente.', + ], + 'session_allow_multiple_login' => [ + 'title' => 'Ativa login múltiplo', + 'description' => 'Se ativado um usuário pode ter múltiplos logins', + ], + 'panel_allow_domain_change_admin' => [ + 'title' => 'Ativa mover domínios entre admins', + 'description' => 'If activated you can change the admin of a domain at domainsettings.
Attention: If a customer isn\'t assigned to the same admin as the domain, the admin can see every other domain of that customer!', + ], + 'panel_allow_domain_change_customer' => [ + 'title' => 'Ativa mover domínios entre clientes', + 'description' => 'Se ativado você pode trocar o cliente de um domínio para administração de outro.
Attention: Froxlor não troca nenhum caminho. Isto pode fazer com que domínios parem de funcionar', + ], + ], + 'success' => [ + 'messages_success' => 'Mensagens enviadas para %s destinatários com sucesso', + ], + 'traffic' => [ + 'month' => 'Mês', + 'day' => 'Diariamente', + 'months' => [ + 1 => 'Janeiro', + 2 => 'Fevereiro', + 3 => 'Março', + 4 => 'Abril', + 5 => 'Maio', + 6 => 'Junho', + 7 => 'Julho', + 8 => 'Agosto', + 9 => 'Setembro', + 10 => 'Outubro', + 11 => 'Novembro', + 12 => 'Dezembro', + ], + 'mb' => 'Tráfego (MB)', + 'distribution' => 'FTP | HTTP | E-Mail', + 'sumhttp' => 'Resumo Tráfego de HTTP em', + 'sumftp' => 'Resumo Tráfego de FTP em', + 'summail' => 'Resumo Tráfego de HTTP em', + ], + 'translator' => 'Ricardo Luiz Costa, Rafael Andrade, Thiago Goncalves de Castro', +]; diff --git a/lng/se.lng.php b/lng/se.lng.php new file mode 100644 index 00000000..079564e9 --- /dev/null +++ b/lng/se.lng.php @@ -0,0 +1,577 @@ + + * @author Staffan Starberg + * @license http://files.froxlor.org/misc/COPYING.txt GPLv2 + */ + +return [ + 'admin' => [ + 'overview' => 'Översikt', + 'ressourcedetails' => 'Använda resurser', + 'systemdetails' => 'System Detaljer', + 'froxlordetails' => 'Froxlor Detaljer', + 'installedversion' => 'Installerad version av Froxlor', + 'latestversion' => 'Senaste version av Froxlor', + 'lookfornewversion' => [ + 'clickhere' => '[Sök senaste verison av Froxlor via Internet]', + 'error' => 'Fel vid läsning, kontrollera uppkopplingen mot Froxlor', + ], + 'resources' => 'Resurser', + 'customer' => 'Kunder', + 'customers' => 'Kunder', + 'customer_add' => '[Skapa en ny kund]', + 'customer_edit' => 'Ändra ny kund', + 'domains' => 'Domäner', + 'domain_add' => '[Skapa en ny domän]', + 'domain_edit' => 'Tillåt ändring av domänen', + 'subdomainforemail' => 'Sub-domän som E-postdomän (Subdomains as emaildomains)', + 'admin' => 'Admin', + 'admins' => 'Admins', + 'admin_add' => '[Skapa en ny admin]', + 'admin_edit' => 'Ändra admin', + 'customers_see_all' => 'Kan se alla kunder?', + 'domains_see_all' => 'Kan se alla domäner?', + 'change_serversettings' => 'Kan ändra serverinställningar?', + 'server' => 'Systemet', + 'serversettings' => 'Inställningar', + 'rebuildconf' => 'Uppdatera konfig filer', + 'stdsubdomain' => 'Standard subdomän', + 'stdsubdomain_add' => '[Skapa en ny standard subdomän]', + 'phpenabled' => 'PHP påslagen', + 'deactivated' => 'Inaktiv', + 'deactivated_user' => 'Avaktivera användare', + 'sendpassword' => 'Skicka lösenord', + 'ownvhostsettings' => 'Egna vHost-Inställningar', + 'configfiles' => [ + 'serverconfiguration' => 'Konfiguration', + 'overview' => 'Översikt', + 'wizard' => 'Guide', + 'mail' => 'E-postserver (POP3/IMAP)', + 'smtp' => 'E-postserver (SMTP)', + ], + 'templates' => [ + 'templates' => 'Mallar', + 'template_add' => '[Lägg till en ny mall]', + 'template_edit' => 'Ändra en befintlig mall', + 'action' => 'Action', + 'email' => 'E-Post', + 'subject' => 'Rubrik (subjekt)', + 'mailbody' => 'E-Postinnehåll (Mail body)', + 'createcustomer' => 'E-Post till nya kunder (Välkommen)', + 'pop_success' => 'E-Post för nya konton (Välkommen)', + 'template_replace_vars' => 'Variabler som kan ändras i mallen:', + 'FIRSTNAME' => 'Ändra till kundens förnamn.', + 'NAME' => 'Ändra till kundens efternamn.', + 'USERNAME' => 'Ändra till kundens kontonamns användarnamn.', + 'PASSWORD' => 'Ändra till kundens kontonamns lösenord.', + 'EMAIL' => 'Ändra till adressen för POP3/IMAP kontot.', + 'TRAFFIC' => 'Ersatt med trafikbegrnsningen som var tilldelad till kunden.', + 'TRAFFICUSED' => 'Ersatt med trafikbegrnsningen som var överskriden av kunden.', + 'pop_success_alternative' => 'Välkommstmeddelande för nya E-post konton som skickas till den alternativa adressen', + 'EMAIL_PASSWORD' => 'Ersatt med POP3/IMAP kontots lösenord.', + ], + 'ipsandports' => [ + 'ipsandports' => 'IPs and Ports', + 'add' => '[Lägg till IP/Port]', + 'edit' => 'Ändra IP/Port', + 'create_listen_statement' => 'Skapa "Listen statement"', + 'create_namevirtualhost_statement' => 'Skapa NameVirtualHost statement', + 'create_vhostcontainer' => 'Skapa vHost-Container', + 'create_vhostcontainer_servername_statement' => 'Skapa ServerName statement i vHost-Container', + ], + 'memorylimitdisabled' => 'Avstängd', + 'valuemandatory' => 'Denna ruta måste fyllas i', + 'valuemandatorycompany' => 'Fyll i "förnamn" och "efternamn" eller "företagsnamn"', + 'serversoftware' => 'Webserver version', + 'phpversion' => 'PHP-Version', + 'phpmemorylimit' => 'PHP-Minnesgräns', + 'mysqlserverversion' => 'MySQL Server Version', + 'mysqlclientversion' => 'MySQL Klient Version', + 'webserverinterface' => 'Webserver Interface', + 'accountsettings' => 'Kontoinställningar', + 'panelsettings' => 'Panelinställningar', + 'systemsettings' => 'Systeminställningar', + 'webserversettings' => 'Webserverinställningar', + 'mailserversettings' => 'E-postserverinställningar', + 'nameserversettings' => 'Namnserverinställningar', + 'updatecounters' => 'Uppdatera status', + 'subcanemaildomain' => [ + 'never' => 'Aldrig', + 'choosableno' => 'Valbar, standardvärdet är Nej', + 'choosableyes' => 'Valbar, standardvärdet är Ja', + 'always' => 'Alltid', + ], + 'webalizersettings' => 'Webalizer inställningar', + 'webalizer' => [ + 'normal' => 'Normal', + 'quiet' => 'Tyst', + 'veryquiet' => 'Väldigt tyst', + ], + 'domain_nocustomeraddingavailable' => 'Det går inte att skapa en ny domän innan det finns mins en upplagd kund.', + ], + 'changepassword' => [ + 'old_password' => 'Gammalt lösenord', + 'new_password' => 'Nytt lösenord', + 'new_password_confirm' => 'Nytt lösenord (verifiera)', + 'new_password_ifnotempty' => 'Nytt lösenord (Tomt fältet = inga ändringar)', + 'also_change_ftp' => ' Ändra även lösenord för huvud FTP kontot', + 'also_change_stats' => ' Ändra även lösenord för statistik', + ], + 'customer' => [ + 'documentroot' => 'Hemkatalog', + 'name' => 'Efternamn', + 'firstname' => 'Förnamn', + 'company' => 'Företag', + 'street' => 'Postadress', + 'zipcode' => 'Postnummer', + 'city' => 'Postort', + 'phone' => 'Telefon', + 'fax' => 'Fax', + 'email' => 'E-post', + 'customernumber' => 'Kundnummer', + 'diskspace' => 'Webb (MB)', + 'traffic' => 'Trafik (GB)', + 'mysqls' => 'SQL_DBas', + 'emails' => 'E-post_adresser', + 'accounts' => 'E-post_konton', + 'forwarders' => 'E-post_skicka_vidare', + 'ftps' => 'FTP_Kto', + 'subdomains' => 'Sub-Domäner', + 'domains' => 'Domäner', + ], + 'domain' => [ + 'openbasedirpath' => 'OpenBasedir-path', + 'docroot' => 'Sökvägen från ovanstående fält', + 'homedir' => 'Hemkatalog', + ], + 'domains' => [ + 'description' => 'Här kan du skapa (sub-)domäner och ändra i dem.
Systemet behöver dock lite tid på sig att genomföra ändringarna.', + 'domainsettings' => 'Domäninställningar', + 'domainname' => 'Domännamn', + 'subdomain_add' => '[Skapa en ny subdomän]', + 'subdomain_edit' => 'Ändra (sub)domän', + 'wildcarddomain' => 'Skapa som ospecificerad domän (Create as wildcarddomain?)', + 'aliasdomain' => 'Alias for domän', + 'noaliasdomain' => '(inget alias)', + 'hasaliasdomains' => 'Domänen har redan alias', + 'statstics' => 'Användarstatistik', + 'isassigneddomain' => 'Tilldelad domän ', + ], + 'emails' => [ + 'description' => 'Här kan du skapa eller ändra dina E-postadresser.
Ett konto är som en brevlåda utanför huset. Om någon skickar dig E-post kommer det att hamna i din brevlåda (ditt konto).

För att hämta din E-post så skall du använda följande inställningar i ditt E-postprogram: (Text i kursiv stil italics måste ändras till det som motsvaras av det du knappade in tidigare!)
Servernamn (Hostname): Domännamn (Domainname)
Användarnamn (Username): Konto namn (Account name) / E-postadress
Lösenord (Password): lösenordet som du valde', + 'emailaddress' => 'E-postadress', + 'emails_add' => '[Skapa en E-postadress]', + 'emails_edit' => 'Ändra E-postadressen', + 'catchall' => 'Maildump', + 'iscatchall' => 'Skapa en maildump?', + 'account' => 'Konto', + 'account_add' => 'Skapa konto', + 'account_delete' => 'Radera konto', + 'from' => 'Från', + 'to' => 'Till', + 'forwarders' => 'Skicka vidare:', + 'forwarder_add' => '[Skapa ny "skicka vidare"]', + 'alternative_emailaddress' => 'Alternative e-mail-address', + ], + 'error' => [ + 'error' => 'Följande fel har uppstått', + 'directorymustexist' => 'Katalogen %s måste finnas. Skapa den med ditt FTP program.', + 'filemustexist' => 'Filen %s måste existera.', + 'allresourcesused' => 'Du har redan skapt så många konton som du har tillstånd till.', + 'domains_cantdeletemaindomain' => 'Du kan inte radera en domän som användes för E-post.', + 'domains_canteditdomain' => 'Endast administratörer kan ändra denna domän.', + 'domains_cantdeletedomainwithemail' => 'Du kan inte radera en domän som användes för E-post. Radera alla E-postadresser först', + 'firstdeleteallsubdomains' => 'Du måste radera alla sub-domäner innan du kan skapa en maildump (wildcard domain).', + 'youhavealreadyacatchallforthisdomain' => 'Du har redan skapat en maildump för denna domän.', + 'ftp_cantdeletemainaccount' => 'Det går inte att radera huvud FTP kontot för domänen', + 'login' => 'Användarnamnet eller lösenordet var felaktigt, försök igen!', + 'login_blocked' => 'Kontot har blivit avstängt på grund av för många felaktiga inloggningsförsök.
Försök igen om %s sekunder.', + 'notallreqfieldsorerrors' => 'Du har inte fyllt i alla fält eller så har du skrivit in något som inte accepteras.', + 'oldpasswordnotcorrect' => 'Det gamla lösenordet är fel.', + 'youcantallocatemorethanyouhave' => 'Du kan inte skapa fler resurser än du äger själv (You cannot allocate more resources than you own for yourself).', + 'mustbeurl' => 'Du har inte skrivit in en korrekt url (e.g. http://somedomain.com/error404.htm)', + 'invalidpath' => 'Du har inte valt en korrekt url (Kanske har du lagt till en katalogsäkerhet så att katalogerna inte kan visas?)', + 'stringisempty' => 'Du måste skriva in något i fältet', + 'stringiswrong' => 'Fel inatningsfält', + 'newpasswordconfirmerror' => 'New password and confirmation does not match', + 'mydomain' => '\'Domain\'', + 'mydocumentroot' => '\'Documentroot\'', + 'loginnameexists' => 'Login-Name %s är upptaget', + 'emailiswrong' => 'E-post-Adressen "%s" innehåller ogiltiga tecken eller så är den inte komplett', + 'loginnameiswrong' => 'Login-Namnet %s innehåller ogiltiga tecken', + 'userpathcombinationdupe' => 'Användarnamnet och sökvägen tillsammans finns redan', + 'patherror' => 'Generellt Fel! sökvägen till katalogen kan inte vara tom', + 'errordocpathdupe' => 'Option för sökvägen %s finns redan', + 'adduserfirst' => 'Skapa användaren först', + 'domainalreadyexists' => 'Domänen %s ägs redan av en kund', + 'nolanguageselect' => 'Inget språk är valt.', + 'nosubjectcreate' => 'Du måste ha ett rubrik för denna E-postmall.', + 'nomailbodycreate' => 'Du måste ha skrivit in en E-post text för denna mall.', + 'templatenotfound' => 'E-postmallen hittades inte.', + 'alltemplatesdefined' => 'Du kan inte skapa flera mallar, alla språk finns redan.', + 'wwwnotallowed' => 'www är inte tillåtet att använda för subdomäner.', + 'subdomainiswrong' => 'Subdomänen %s innehåller ogiltiga tecken.', + 'domaincantbeempty' => 'Fältet för domännamn får inte vara tommt.', + 'domainexistalready' => 'Domänen %s finns redan.', + 'domainisaliasorothercustomer' => 'Den valda domänen är antingen en aliasdomän eller så ägs den redan av en annan kund.', + 'emailexistalready' => 'E-postadressen %s finns redan.', + 'maindomainnonexist' => 'Huvuddomänen %s finns inte.', + 'destinationnonexist' => 'Skapa en forwarder i fältet \'Destination\'.', + 'destinationalreadyexistasmail' => 'Denna forwarder %s, finns redan som aktiv E-postadress.', + 'destinationalreadyexist' => 'Du har redan skapat en forwarder till %s .', + 'destinationiswrong' => 'Denna forwarder: %s innehåller ogiltiga tecken eller så är den inte komplett adress.', + 'ipstillhasdomains' => 'IP/Port kombinationen som du vill radera har fortfarande domäner anslutna till sig, Flytta dessa till någon annan IP/Port kombination innan du raderar denna IP/Port kombination.', + 'cantdeletedefaultip' => 'Det går inte att ta bort den förvalda återförsäljarens IP/Port kombination, Välj en annan IP/Port kombination som förval för återförsäljare innan du raderar denna IP/Port kombination.', + 'cantdeletesystemip' => 'Det går inte att radera den sista system IP:n, Antingen skapar man en ny IP/Port kombination för system IP eller så ändrar man system IP:n.', + 'myipaddress' => '\'IP\'', + 'myport' => '\'Port\'', + 'myipdefault' => 'Man måste välja en IP/Port kombination som skall bli standardvärdet.', + 'myipnotdouble' => 'Denna IP/Port kombination finns redan.', + 'cantchangesystemip' => 'Man kan inte ändra den senaste system IP-adressen. Skapa en helt ny IP/Port kombination för system IP:n eller ändra system IP-adressen.', + 'sessiontimeoutiswrong' => 'Bara siffror "Session Timeout" är tillåtna.', + 'maxloginattemptsiswrong' => 'Bara siffror "Max Login Attempts" är tillåtna.', + 'deactivatetimiswrong' => 'Bara siffror "Deactivate Time" är tillåtna.', + 'accountprefixiswrong' => 'Det här "Customerprefix" är fel.', + 'mysqlprefixiswrong' => 'Det här "SQL Prefix" är fel.', + 'ftpprefixiswrong' => 'Det här "FTP Prefix" är fel.', + 'ipiswrong' => 'Den här "IP-Address" är fel. Endast en giltig IP-adress är tillåten.', + 'vmailuidiswrong' => 'Den här "Mails-uid" är fel. Endast numerisk UID är tillåtenis allowed.', + 'vmailgidiswrong' => 'Den här "Mails-gid" är fel. Endast numerisk GID är tillåtenis allowed.', + 'adminmailiswrong' => 'Den här "Sender-address" är fel. Endast en giltig E-postadress är tillåten.', + 'pagingiswrong' => 'Den här "Entries per Page"-värdet är fel. Endast siffror är tillåtna.', + 'phpmyadminiswrong' => 'Den här phpMyAdmin-link är inte en giltig länk.', + 'webmailiswrong' => 'Den här WebMail-link är inte en giltig länk.', + 'webftpiswrong' => 'Den här WebFTP-link är inte en giltig länk.', + 'stringformaterror' => 'Värdet för fältet "%s" har inte rätt format.', + 'loginnameissystemaccount' => 'Det går inte att skapa ett konto som liknar ett systemkonto (Om det till exempel börjar med "%s"). Vlj ett annat kontonamn.', + 'youcantdeleteyourself' => 'Av säkerhetsskäl går inte att redera ditt eget konto.', + 'youcanteditallfieldsofyourself' => 'Notera: Av säkerhetsskäl går det inte att ändra ditt eget konto.', + 'documentrootexists' => 'Katalogen "%s" finns redan hos den här kunden. Radera detta först innan kunden skapas igen.', + 'formtokencompromised' => 'Den säkra anslutningen till Froxlor har avslutats och du har av säkerhetsskäl automatiskt loggats ur.', + ], + 'extras' => [ + 'description' => 'Här kan du ändra övriga saker såsom katalogskydd mm.
Systemet behöver dock lite tid på sig att genomföra ändringarna.', + 'directoryprotection_add' => '[Skapa ett nytt katalogskydd]', + 'view_directory' => 'Visa kataloginnehåll', + 'pathoptions_add' => '[Skapa ny regel för sökvägar]', + 'directory_browsing' => 'Visning av katalogstruktur', + 'pathoptions_edit' => 'Ändra sökvägsinställningar', + ], + 'ftp' => [ + 'description' => 'Här kan du skapa eller änra i dina FTP konton.
Ändringen genomförs omedelbart så man kan använda det nya/ändrade kontot direkt.', + 'account_add' => '[Skapa ett nytt FTP konto]', + ], + 'index' => [ + 'customerdetails' => 'Kunddetaljer', + 'accountdetails' => 'Kontodetaljer', + ], + 'login' => [ + 'username' => 'Användarnamn', + 'password' => 'Lösenord', + 'language' => 'Språk', + 'login' => 'Logga in', + 'logout' => 'Logga ut', + 'profile_lng' => 'Profilspråk', + ], + 'mails' => [ + 'pop_success' => [ + 'mailbody' => 'Hej,\\n\\nDitt E-postkonto {EMAIL}\\nhar nu skapats.\\n\\nDetta är ett automatgenererat E-post meddelande\\n, Det går därför inte att svara på detta meddelande!\\n', + 'subject' => 'E-postkontot är nu skapat', + ], + 'createcustomer' => [ + 'mailbody' => 'Hej {FIRSTNAME} {NAME},\\n\\nHär kommer kontoinformationen för ditt konto:\\n\\nAnvändarnamn (Username): {USERNAME}\\nLösenord (Password): {PASSWORD}\\n\\n', + 'subject' => 'Kontoinformation', + ], + 'pop_success_alternative' => [ + 'mailbody' => 'Hej,\\n\\nditt E-postkonto {EMAIL}\\nhar ny skapats.\\nDitt lösenord är {PASSWORD}.\\n\\nDetta är ett automatgenererat E-postmeddelande som det INTE går att svara på!\\n\\nLycka till önskar, Froxlor', + 'subject' => 'E-postkontot är nu skapat', + ], + ], + 'menue' => [ + 'main' => [ + 'main' => 'Huvudsidan', + 'changepassword' => 'Ändra lösenord', + 'changelanguage' => 'Ändra språk', + 'username' => 'Inloggad som: ', + ], + 'email' => [ + 'email' => 'E-post', + 'emails' => 'E-post', + 'webmail' => 'WebMail', + ], + 'mysql' => [ + 'mysql' => 'MySQL', + 'databases' => 'Databaser', + 'phpmyadmin' => 'phpMyAdmin', + ], + 'domains' => [ + 'domains' => 'Domäner', + 'settings' => 'Inställningar', + ], + 'ftp' => [ + 'ftp' => 'FTP', + 'accounts' => 'Konton', + 'webftp' => 'WebFTP', + ], + 'extras' => [ + 'extras' => 'Extras', + 'directoryprotection' => 'Katalog säkerhet', + 'pathoptions' => 'Inställningar sökväg', + ], + 'traffic' => [ + 'traffic' => 'Trafik', + 'current' => 'Nuvarande månad', + ], + ], + 'mysql' => [ + 'databasename' => 'Användare/databasnamn', + 'databasedescription' => 'Beskrivning av databasen', + 'database_create' => '[Skapa en ny databas]', + 'description' => 'Här ändras eller skapas MySQL-Databaser.
Ändringen sker omedelbart och databasen kan användas direkt.
I menyn på vänster sida finns verktyget phpMyAdmin med vilket man enkelt kan ändra i sin databas.

För att använda databasen i dina egna php-scripts använd följande inställningar: (Data med kursiv stil italics måste ändras till det du matat in!)
Servernamn (Hostname):
Användarnamn (Username): Databsnamn (Databasename)
Lösenord (Password): Lösenordet som du har valt
Databas (Database): Databasnamn (Databasename)', + ], + 'panel' => [ + 'edit' => 'Ändra', + 'delete' => 'Radera', + 'create' => 'Skapa', + 'save' => 'Spara', + 'yes' => 'Ja', + 'no' => 'Nej', + 'emptyfornochanges' => 'Tomt fält = ingen ändring', + 'emptyfordefault' => 'Förvalt värde används om fältet lämnas tommt', + 'path' => 'Sökväg (Path)', + 'toggle' => 'Växla (Toggle)', + 'next' => 'nästa', + 'dirsmissing' => 'Kan inte hitta eller läsa katalogen!', + 'urloverridespath' => 'URL (skriver över sökvägen)', + 'pathorurl' => 'Sökväg eller URL', + 'ascending' => 'Stigande', + 'descending' => 'Fallande', + 'search' => 'Sök', + 'used' => 'använd', + 'translator' => 'Översättare', + 'reset' => 'Avbryt ändringarna', + 'pathDescription' => 'Katalogen kommer att skapas om den inte redan finns.', + 'back' => 'Tillbaka', + ], + 'question' => [ + 'question' => 'Säkerhetsfråga', + 'admin_customer_reallydelete' => 'Är du säker på att du vill radera kunden %s? Om du väljer att radera går det inte att ångra sig efteråt!', + 'admin_domain_reallydelete' => 'Är du riktigt säker på att du vill radera domänen %s?', + 'admin_domain_reallydisablesecuritysetting' => 'Är du riktigt säker på att du vill avaktivera säkerhetsinställningarna (OpenBasedir and/or SafeMode)?', + 'admin_admin_reallydelete' => 'Är du riktigt säker på att du vill radera adminkontot %s? Alla kunder och domäner kommer att flyttas till ditt konto istället.', + 'admin_template_reallydelete' => 'Är du riktigt säker på att du vill radera mallen \'%s\'?', + 'domains_reallydelete' => 'Är du riktigt säker på att du vill radera domänen %s?', + 'email_reallydelete' => 'Är du riktigt säker på att du vill radera E-postadressen %s?', + 'email_reallydelete_account' => 'Är du riktigt säker på att du vill radera E-postkontot %s?', + 'email_reallydelete_forwarder' => 'Är du riktigt säker på att du vill radera forwardern till %s?', + 'extras_reallydelete' => 'Är du riktigt säker på att du vill radera katalogsäkerheten (directory protection) för %s?', + 'extras_reallydelete_pathoptions' => 'Är du riktigt säker på att du vill radera katalogalternativen (path options) för %s?', + 'ftp_reallydelete' => 'Är du riktigt säker på att du vill radera FTP kontot %s?', + 'mysql_reallydelete' => 'Är du riktigt säker på att du vill radera databasen %s? Om du väljer att radera går det inte att ångra sig efteråt!', + 'admin_configs_reallyrebuild' => 'Är du riktigt säker på att du vill skapa nya konfigurationsfiler för apache och bind?', + 'admin_ip_reallydelete' => 'Är du säker på att du vill radera IP addressen %s?', + 'admin_domain_reallydocrootoutofcustomerroot' => 'Dokumentkatalogen för denna domän inte kommer att ligga under kundkatalogen, är du säker på att du vill ändra detta?', + 'admin_counters_reallyupdate' => 'Vill du uppdatera alla statusberäkningar för kunder och admins?', + 'admin_cleartextmailpws_reallywipe' => 'Är du säker på att du vill radera alla okrupterade lösenord från tabellen mail_users? Du kan INTE ändra dig efteråt!', + ], + 'serversettings' => [ + 'session_timeout' => [ + 'title' => 'Sessionen har avslutats för att den tog för lång tid att utföra (session Timeout)', + 'description' => 'Tiden (i sekunder) som användaren får vara inaktiv innan han måste logga in igen är (seconds)?', + ], + 'accountprefix' => [ + 'title' => 'Kund ID (Customer prefix)', + 'description' => 'Vilket prefix skall användas till ett kundkonto?', + ], + 'mysqlprefix' => [ + 'title' => 'SQL ID (SQL Prefix)', + 'description' => 'Vilket prefix skall användas till mysql?', + ], + 'ftpprefix' => [ + 'title' => 'FTP ID (FTP Prefix)', + 'description' => 'Vilket prefix skall användas till ftp?', + ], + 'documentroot_prefix' => [ + 'title' => 'Hemkatalog', + 'description' => 'Vilken sökväg skall det vara till hemkatalogen?', + ], + 'logfiles_directory' => [ + 'title' => 'Loggfilernas hemkatalog (Logfiles directory)', + 'description' => 'Vilken sökväg skall det vara till loggfilernas hemkatalog?', + ], + 'ipaddress' => [ + 'title' => 'IP-Adress', + 'description' => 'Vilken IP-adress har denna server?', + ], + 'hostname' => [ + 'title' => 'Datornamn (Hostname)', + 'description' => 'Villket Datornamn (Hostname) har denna server?', + ], + 'apachereload_command' => [ + 'title' => 'Ladda om Apache kommandot (Apache reload)', + 'description' => 'Ange sökvägen till programmet som laddar om Apache (reload apache) konfigurationsfiler?', + ], + 'bindconf_directory' => [ + 'title' => 'Bind konfigurationskatalog (Bind config directory)', + 'description' => 'Vilken sökväg skall det vara till bind:s konfigurationsfiler?', + ], + 'bindreload_command' => [ + 'title' => 'Ange sökvägen till programmet som laddar om Bind (reload bind) konfigurationsfiler?', + 'description' => 'Ange sökvägen till programmet som laddar om Bind (reload bind) konfigurationsfiler?', + ], + 'vmail_uid' => [ + 'title' => 'Mails-UID', + 'description' => 'Vilket användarID (UserID) ska E-posten ha?', + ], + 'vmail_gid' => [ + 'title' => 'Mails-GID', + 'description' => 'Vilket gruppID (GroupID) ska E-posten ha?', + ], + 'vmail_homedir' => [ + 'title' => 'E-post hemkatalog', + 'description' => 'I vilken katalog skall E-posten sparas?', + ], + 'adminmail' => [ + 'title' => 'Avsändare', + 'description' => 'Vilken avsändaradress skall E-post från admin panelen ha?', + ], + 'phpmyadmin_url' => [ + 'title' => 'phpMyAdmin URL', + 'description' => 'Vilken URL är det till phpMyAdmin? (Måste börja med http(s)://)', + ], + 'webmail_url' => [ + 'title' => 'WebMail URL', + 'description' => 'Vilken URL är det till WebMail? (Måste börja med http(s)://)', + ], + 'webftp_url' => [ + 'title' => 'WebFTP URL', + 'description' => 'Vilken URL är det till WebFTP? (Måste börja med http(s)://)', + ], + 'language' => [ + 'description' => 'Vilket språk skall användas som standardspråk?', + ], + 'maxloginattempts' => [ + 'title' => 'Max antal Login försök', + 'description' => 'Maximalt antal inloggningsförsök innan kontot stängs av.', + ], + 'deactivatetime' => [ + 'title' => 'Avstängningstid', + 'description' => 'Tid (sec.) som kontot stängs av efter för många felaktiga försök.', + ], + 'pathedit' => [ + 'title' => 'Typ av (path input)', + 'description' => 'Skall en sökväg väljas i en rullist eller matas in för hand?', + ], + 'nameservers' => [ + 'title' => 'Nameservers', + 'description' => 'En kommaseparerad lista med namnet (hostname) på alla DNS:er. Den första blir den första som söks (primary).', + ], + 'mxservers' => [ + 'title' => 'MX servers', + 'description' => 'En kommaseparerad lista med nummer och namn separerade men mellanslag (ex. \'10 mx.example.com\') innehåller mx servrarna.', + ], + 'paging' => [ + 'title' => 'Antal rader per sida', + 'description' => 'Hur många rader skall det vara på en sida? (0 = Stäng av sidbrytning)', + ], + 'defaultip' => [ + 'title' => 'Förvald IP/Port', + 'description' => 'Vilken är den förvalda IP/Port kombinationen?', + ], + 'phpappendopenbasedir' => [ + 'title' => 'Sökväg att lägga till OpenBasedir', + 'description' => 'Dessa sökvägar (separerade med kolon) kommer att läggas till OpenBasedir-statement i alla vhost-container.', + ], + 'natsorting' => [ + 'title' => 'Använd mänsklig sortertering i listvisning', + 'description' => 'Sorterar listan så här web1 -> web2 -> web11 istället för web1 -> web11 -> web2.', + ], + 'deactivateddocroot' => [ + 'title' => 'Dokumentroot för avstängda användare', + 'description' => 'När en användare är avstängd kommer denna sökväg att användas som dokumentroot. Lämna fältet tommt om du inte vill skapa någon vhost.', + ], + 'mailpwcleartext' => [ + 'title' => 'Spara även lösenord till E-postkonton okrypterade i databassen', + 'description' => 'Om du valt Ja så kommer alla lösenord att sparas okrypterade (klartext, fullt läsbara för alla som har rättigheter till databasen) i tabellen mail_users-table. Aktivera detta endast om du är säker på vad du gör!', + 'removelink' => 'Klicka här för att radera alla okrypterade lösenord från tabellen.', + ], + 'ftpdomain' => [ + 'title' => 'FTP konton @domain', + 'description' => 'Kunder kan skapa Ftp accounts user@customerdomain?', + ], + 'mod_fcgid' => [ + 'title' => 'Inkludera PHP via mod_fcgid/suexec', + 'description' => 'Använd mod_fcgid/suexec/libnss_mysql för att köra PHP med tillhörande användarkonto.
Denna inställning behöver en speciell apache-konfiguration!', + 'configdir' => [ + 'title' => 'FCGI konfigurationskatalog', + 'description' => 'I vilken katalog skall alla fcgi-konfigurationfiler lagras?', + ], + 'tmpdir' => [ + 'title' => 'FCGI temporärkatalog', + ], + ], + 'sendalternativemail' => [ + 'title' => 'Använd en alternativ E-postadress', + 'description' => 'Skicka lösenord med E-post till adressen under email-account-creation', + ], + 'apacheconf_vhost' => [ + 'title' => 'Apache vhost konfiguration fil/katalognamn', + 'description' => 'Var skall vhost konfigurationen sparas? Det går att specificera alla vhost i en fil eller en katalog där alla filerna ligger (varje vhost i sin egen fil).', + ], + 'apacheconf_diroptions' => [ + 'title' => 'Apache diroptions konfiguration fil/katalognamn', + 'description' => 'Var skall diroptions konfigurationen sparas? Det går att specificera alla diroptions i en fil eller en katalog där alla filerna ligger (varje diroptions i sin egen fil).', + ], + 'apacheconf_htpasswddir' => [ + 'title' => 'Apache htpasswd katalognamn', + 'description' => 'Var skall htpasswd konfigurationen för katalogsäkerheten?', + ], + 'mysql_access_host' => [ + 'description' => 'En kommaseparerad lista med datornamn som tillåts att kontakta MySQL servern.', + ], + ], + 'traffic' => [ + 'month' => 'Månad', + 'day' => 'Dag', + 'months' => [ + 1 => 'Januari', + 2 => 'Februari', + 3 => 'Mars', + 4 => 'April', + 5 => 'Maj', + 6 => 'Juni', + 7 => 'Juli', + 8 => 'Augusti', + 9 => 'September', + 10 => 'Oktober', + 11 => 'November', + 12 => 'December', + ], + 'mb' => 'Trafik (MB)', + 'distribution' => 'FTP | HTTP | Mail', + 'sumhttp' => 'Summa HTTP-Trafik i', + 'sumftp' => 'Summa FTP-Trafik i', + 'summail' => 'Summa E-posttrafik i', + ], + 'translator' => 'Staffan Starberg', +]; diff --git a/lng/swedish.lng.php b/lng/swedish.lng.php deleted file mode 100644 index d3d21ef2..00000000 --- a/lng/swedish.lng.php +++ /dev/null @@ -1,572 +0,0 @@ - - * @author Froxlor Team - * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt - * @package Language - * - */ - -/** - * Global - */ -$lng['translator'] = 'Staffan Starberg'; -$lng['panel']['edit'] = 'Ändra'; -$lng['panel']['delete'] = 'Radera'; -$lng['panel']['create'] = 'Skapa'; -$lng['panel']['save'] = 'Spara'; -$lng['panel']['yes'] = 'Ja'; -$lng['panel']['no'] = 'Nej'; -$lng['panel']['emptyfornochanges'] = 'Tomt fält = ingen ändring'; -$lng['panel']['emptyfordefault'] = 'Förvalt värde används om fältet lämnas tommt'; -$lng['panel']['path'] = 'Sökväg (Path)'; -$lng['panel']['toggle'] = 'Växla (Toggle)'; -$lng['panel']['next'] = 'nästa'; -$lng['panel']['dirsmissing'] = 'Kan inte hitta eller läsa katalogen!'; - -/** - * Login - */ - -$lng['login']['username'] = 'Användarnamn'; -$lng['login']['password'] = 'Lösenord'; -$lng['login']['language'] = 'Språk'; -$lng['login']['login'] = 'Logga in'; -$lng['login']['logout'] = 'Logga ut'; -$lng['login']['profile_lng'] = 'Profilspråk'; - -/** - * Customer - */ - -$lng['customer']['documentroot'] = 'Hemkatalog'; -$lng['customer']['name'] = 'Efternamn'; -$lng['customer']['firstname'] = 'Förnamn'; -$lng['customer']['company'] = 'Företag'; -$lng['customer']['street'] = 'Postadress'; -$lng['customer']['zipcode'] = 'Postnummer'; -$lng['customer']['city'] = 'Postort'; -$lng['customer']['phone'] = 'Telefon'; -$lng['customer']['fax'] = 'Fax'; -$lng['customer']['email'] = 'E-post'; -$lng['customer']['customernumber'] = 'Kundnummer'; -$lng['customer']['diskspace'] = 'Webb (MB)'; -$lng['customer']['traffic'] = 'Trafik (GB)'; -$lng['customer']['mysqls'] = 'SQL_DBas'; -$lng['customer']['emails'] = 'E-post_adresser'; -$lng['customer']['accounts'] = 'E-post_konton'; -$lng['customer']['forwarders'] = 'E-post_skicka_vidare'; -$lng['customer']['ftps'] = 'FTP_Kto'; -$lng['customer']['subdomains'] = 'Sub-Domäner'; -$lng['customer']['domains'] = 'Domäner'; - -/** - * Customermenue - */ - -$lng['menue']['main']['main'] = 'Huvudsidan'; -$lng['menue']['main']['changepassword'] = 'Ändra lösenord'; -$lng['menue']['main']['changelanguage'] = 'Ändra språk'; -$lng['menue']['email']['email'] = 'E-post'; -$lng['menue']['email']['emails'] = 'E-post'; -$lng['menue']['email']['webmail'] = 'WebMail'; -$lng['menue']['mysql']['mysql'] = 'MySQL'; -$lng['menue']['mysql']['databases'] = 'Databaser'; -$lng['menue']['mysql']['phpmyadmin'] = 'phpMyAdmin'; -$lng['menue']['domains']['domains'] = 'Domäner'; -$lng['menue']['domains']['settings'] = 'Inställningar'; -$lng['menue']['ftp']['ftp'] = 'FTP'; -$lng['menue']['ftp']['accounts'] = 'Konton'; -$lng['menue']['ftp']['webftp'] = 'WebFTP'; -$lng['menue']['extras']['extras'] = 'Extras'; -$lng['menue']['extras']['directoryprotection'] = 'Katalog säkerhet'; -$lng['menue']['extras']['pathoptions'] = 'Inställningar sökväg'; - -/** - * Index - */ - -$lng['index']['customerdetails'] = 'Kunddetaljer'; -$lng['index']['accountdetails'] = 'Kontodetaljer'; - -/** - * Change Password - */ - -$lng['changepassword']['old_password'] = 'Gammalt lösenord'; -$lng['changepassword']['new_password'] = 'Nytt lösenord'; -$lng['changepassword']['new_password_confirm'] = 'Nytt lösenord (verifiera)'; -$lng['changepassword']['new_password_ifnotempty'] = 'Nytt lösenord (Tomt fältet = inga ändringar)'; -$lng['changepassword']['also_change_ftp'] = ' Ändra även lösenord för huvud FTP kontot'; - -/** - * Domains - */ - -$lng['domains']['description'] = 'Här kan du skapa (sub-)domäner och ändra i dem.
Systemet behöver dock lite tid på sig att genomföra ändringarna.'; -$lng['domains']['domainsettings'] = 'Domäninställningar'; -$lng['domains']['domainname'] = 'Domännamn'; -$lng['domains']['subdomain_add'] = '[Skapa en ny subdomän]'; -$lng['domains']['subdomain_edit'] = 'Ändra (sub)domän'; -$lng['domains']['wildcarddomain'] = 'Skapa som ospecificerad domän (Create as wildcarddomain?)'; -$lng['domains']['aliasdomain'] = 'Alias for domän'; -$lng['domains']['noaliasdomain'] = '(inget alias)'; - -/** - * E-mails - */ - -$lng['emails']['description'] = 'Här kan du skapa eller ändra dina E-postadresser.
Ett konto är som en brevlåda utanför huset. Om någon skickar dig E-post kommer det att hamna i din brevlåda (ditt konto).

För att hämta din E-post så skall du använda följande inställningar i ditt E-postprogram: (Text i kursiv stil italics måste ändras till det som motsvaras av det du knappade in tidigare!)
Servernamn (Hostname): Domännamn (Domainname)
Användarnamn (Username): Konto namn (Account name) / E-postadress
Lösenord (Password): lösenordet som du valde'; -$lng['emails']['emailaddress'] = 'E-postadress'; -$lng['emails']['emails_add'] = '[Skapa en E-postadress]'; -$lng['emails']['emails_edit'] = 'Ändra E-postadressen'; -$lng['emails']['catchall'] = 'Maildump'; -$lng['emails']['iscatchall'] = 'Skapa en maildump?'; -$lng['emails']['account'] = 'Konto'; -$lng['emails']['account_add'] = 'Skapa konto'; -$lng['emails']['account_delete'] = 'Radera konto'; -$lng['emails']['from'] = 'Från'; -$lng['emails']['to'] = 'Till'; -$lng['emails']['forwarders'] = 'Skicka vidare:'; -$lng['emails']['forwarder_add'] = '[Skapa ny "skicka vidare"]'; - -/** - * FTP - */ - -$lng['ftp']['description'] = 'Här kan du skapa eller änra i dina FTP konton.
Ändringen genomförs omedelbart så man kan använda det nya/ändrade kontot direkt.'; -$lng['ftp']['account_add'] = '[Skapa ett nytt FTP konto]'; - -/** - * MySQL - */ - -$lng['mysql']['databasename'] = 'Användare/databasnamn'; -$lng['mysql']['databasedescription'] = 'Beskrivning av databasen'; -$lng['mysql']['database_create'] = '[Skapa en ny databas]'; - -/** - * Extras - */ - -$lng['extras']['description'] = 'Här kan du ändra övriga saker såsom katalogskydd mm.
Systemet behöver dock lite tid på sig att genomföra ändringarna.'; -$lng['extras']['directoryprotection_add'] = '[Skapa ett nytt katalogskydd]'; -$lng['extras']['view_directory'] = 'Visa kataloginnehåll'; -$lng['extras']['pathoptions_add'] = '[Skapa ny regel för sökvägar]'; -$lng['extras']['directory_browsing'] = 'Visning av katalogstruktur'; -$lng['extras']['pathoptions_edit'] = 'Ändra sökvägsinställningar'; - -/** - * Errors - */ - -$lng['error']['error'] = 'Följande fel har uppstått'; -$lng['error']['directorymustexist'] = 'Katalogen %s måste finnas. Skapa den med ditt FTP program.'; -$lng['error']['filemustexist'] = 'Filen %s måste existera.'; -$lng['error']['allresourcesused'] = 'Du har redan skapt så många konton som du har tillstånd till.'; -$lng['error']['domains_cantdeletemaindomain'] = 'Du kan inte radera en domän som användes för E-post.'; -$lng['error']['domains_canteditdomain'] = 'Endast administratörer kan ändra denna domän.'; -$lng['error']['domains_cantdeletedomainwithemail'] = 'Du kan inte radera en domän som användes för E-post. Radera alla E-postadresser först'; -$lng['error']['firstdeleteallsubdomains'] = 'Du måste radera alla sub-domäner innan du kan skapa en maildump (wildcard domain).'; -$lng['error']['youhavealreadyacatchallforthisdomain'] = 'Du har redan skapat en maildump för denna domän.'; -$lng['error']['ftp_cantdeletemainaccount'] = 'Det går inte att radera huvud FTP kontot för domänen'; -$lng['error']['login'] = 'Användarnamnet eller lösenordet var felaktigt, försök igen!'; -$lng['error']['login_blocked'] = 'Kontot har blivit avstängt på grund av för många felaktiga inloggningsförsök.
Försök igen om %s sekunder.'; -$lng['error']['notallreqfieldsorerrors'] = 'Du har inte fyllt i alla fält eller så har du skrivit in något som inte accepteras.'; -$lng['error']['oldpasswordnotcorrect'] = 'Det gamla lösenordet är fel.'; -$lng['error']['youcantallocatemorethanyouhave'] = 'Du kan inte skapa fler resurser än du äger själv (You cannot allocate more resources than you own for yourself).'; -$lng['error']['mustbeurl'] = 'Du har inte skrivit in en korrekt url (e.g. http://somedomain.com/error404.htm)'; -$lng['error']['invalidpath'] = 'Du har inte valt en korrekt url (Kanske har du lagt till en katalogsäkerhet så att katalogerna inte kan visas?)'; -$lng['error']['stringisempty'] = 'Du måste skriva in något i fältet'; -$lng['error']['stringiswrong'] = 'Fel inatningsfält'; -$lng['error']['newpasswordconfirmerror'] = 'New password and confirmation does not match'; -$lng['error']['mydomain'] = '\'Domain\''; -$lng['error']['mydocumentroot'] = '\'Documentroot\''; -$lng['error']['loginnameexists'] = 'Login-Name %s är upptaget'; -$lng['error']['emailiswrong'] = 'E-post-Adressen "%s" innehåller ogiltiga tecken eller så är den inte komplett'; -$lng['error']['loginnameiswrong'] = 'Login-Namnet %s innehåller ogiltiga tecken'; -$lng['error']['userpathcombinationdupe'] = 'Användarnamnet och sökvägen tillsammans finns redan'; -$lng['error']['patherror'] = 'Generellt Fel! sökvägen till katalogen kan inte vara tom'; -$lng['error']['errordocpathdupe'] = 'Option för sökvägen %s finns redan'; -$lng['error']['adduserfirst'] = 'Skapa användaren först'; -$lng['error']['domainalreadyexists'] = 'Domänen %s ägs redan av en kund'; -$lng['error']['nolanguageselect'] = 'Inget språk är valt.'; -$lng['error']['nosubjectcreate'] = 'Du måste ha ett rubrik för denna E-postmall.'; -$lng['error']['nomailbodycreate'] = 'Du måste ha skrivit in en E-post text för denna mall.'; -$lng['error']['templatenotfound'] = 'E-postmallen hittades inte.'; -$lng['error']['alltemplatesdefined'] = 'Du kan inte skapa flera mallar, alla språk finns redan.'; -$lng['error']['wwwnotallowed'] = 'www är inte tillåtet att använda för subdomäner.'; -$lng['error']['subdomainiswrong'] = 'Subdomänen %s innehåller ogiltiga tecken.'; -$lng['error']['domaincantbeempty'] = 'Fältet för domännamn får inte vara tommt.'; -$lng['error']['domainexistalready'] = 'Domänen %s finns redan.'; -$lng['error']['domainisaliasorothercustomer'] = 'Den valda domänen är antingen en aliasdomän eller så ägs den redan av en annan kund.'; -$lng['error']['emailexistalready'] = 'E-postadressen %s finns redan.'; -$lng['error']['maindomainnonexist'] = 'Huvuddomänen %s finns inte.'; -$lng['error']['destinationnonexist'] = 'Skapa en forwarder i fältet \'Destination\'.'; -$lng['error']['destinationalreadyexistasmail'] = 'Denna forwarder %s, finns redan som aktiv E-postadress.'; -$lng['error']['destinationalreadyexist'] = 'Du har redan skapat en forwarder till %s .'; -$lng['error']['destinationiswrong'] = 'Denna forwarder: %s innehåller ogiltiga tecken eller så är den inte komplett adress.'; - -/** - * Questions - */ - -$lng['question']['question'] = 'Säkerhetsfråga'; -$lng['question']['admin_customer_reallydelete'] = 'Är du säker på att du vill radera kunden %s? Om du väljer att radera går det inte att ångra sig efteråt!'; -$lng['question']['admin_domain_reallydelete'] = 'Är du riktigt säker på att du vill radera domänen %s?'; -$lng['question']['admin_domain_reallydisablesecuritysetting'] = 'Är du riktigt säker på att du vill avaktivera säkerhetsinställningarna (OpenBasedir and/or SafeMode)?'; -$lng['question']['admin_admin_reallydelete'] = 'Är du riktigt säker på att du vill radera adminkontot %s? Alla kunder och domäner kommer att flyttas till ditt konto istället.'; -$lng['question']['admin_template_reallydelete'] = 'Är du riktigt säker på att du vill radera mallen \'%s\'?'; -$lng['question']['domains_reallydelete'] = 'Är du riktigt säker på att du vill radera domänen %s?'; -$lng['question']['email_reallydelete'] = 'Är du riktigt säker på att du vill radera E-postadressen %s?'; -$lng['question']['email_reallydelete_account'] = 'Är du riktigt säker på att du vill radera E-postkontot %s?'; -$lng['question']['email_reallydelete_forwarder'] = 'Är du riktigt säker på att du vill radera forwardern till %s?'; -$lng['question']['extras_reallydelete'] = 'Är du riktigt säker på att du vill radera katalogsäkerheten (directory protection) för %s?'; -$lng['question']['extras_reallydelete_pathoptions'] = 'Är du riktigt säker på att du vill radera katalogalternativen (path options) för %s?'; -$lng['question']['ftp_reallydelete'] = 'Är du riktigt säker på att du vill radera FTP kontot %s?'; -$lng['question']['mysql_reallydelete'] = 'Är du riktigt säker på att du vill radera databasen %s? Om du väljer att radera går det inte att ångra sig efteråt!'; -$lng['question']['admin_configs_reallyrebuild'] = 'Är du riktigt säker på att du vill skapa nya konfigurationsfiler för apache och bind?'; - -/** - * Mails - */ - -$lng['mails']['pop_success']['mailbody'] = 'Hej,\n\nDitt E-postkonto {EMAIL}\nhar nu skapats.\n\nDetta är ett automatgenererat E-post meddelande\n, Det går därför inte att svara på detta meddelande!\n'; -$lng['mails']['pop_success']['subject'] = 'E-postkontot är nu skapat'; -$lng['mails']['createcustomer']['mailbody'] = 'Hej {FIRSTNAME} {NAME},\n\nHär kommer kontoinformationen för ditt konto:\n\nAnvändarnamn (Username): {USERNAME}\nLösenord (Password): {PASSWORD}\n\n'; -$lng['mails']['createcustomer']['subject'] = 'Kontoinformation'; - -/** - * Admin - */ - -$lng['admin']['overview'] = 'Översikt'; -$lng['admin']['ressourcedetails'] = 'Använda resurser'; -$lng['admin']['systemdetails'] = 'System Detaljer'; -$lng['admin']['froxlordetails'] = 'Froxlor Detaljer'; -$lng['admin']['installedversion'] = 'Installerad version av Froxlor'; -$lng['admin']['latestversion'] = 'Senaste version av Froxlor'; -$lng['admin']['lookfornewversion']['clickhere'] = '[Sök senaste verison av Froxlor via Internet]'; -$lng['admin']['lookfornewversion']['error'] = 'Fel vid läsning, kontrollera uppkopplingen mot Froxlor'; -$lng['admin']['resources'] = 'Resurser'; -$lng['admin']['customer'] = 'Kunder'; -$lng['admin']['customers'] = 'Kunder'; -$lng['admin']['customer_add'] = '[Skapa en ny kund]'; -$lng['admin']['customer_edit'] = 'Ändra ny kund'; -$lng['admin']['domains'] = 'Domäner'; -$lng['admin']['domain_add'] = '[Skapa en ny domän]'; -$lng['admin']['domain_edit'] = 'Tillåt ändring av domänen'; -$lng['admin']['subdomainforemail'] = 'Sub-domän som E-postdomän (Subdomains as emaildomains)'; -$lng['admin']['admin'] = 'Admin'; -$lng['admin']['admins'] = 'Admins'; -$lng['admin']['admin_add'] = '[Skapa en ny admin]'; -$lng['admin']['admin_edit'] = 'Ändra admin'; -$lng['admin']['customers_see_all'] = 'Kan se alla kunder?'; -$lng['admin']['domains_see_all'] = 'Kan se alla domäner?'; -$lng['admin']['change_serversettings'] = 'Kan ändra serverinställningar?'; -$lng['admin']['server'] = 'Systemet'; -$lng['admin']['serversettings'] = 'Inställningar'; -$lng['admin']['rebuildconf'] = 'Uppdatera konfig filer'; -$lng['admin']['stdsubdomain'] = 'Standard subdomän'; -$lng['admin']['stdsubdomain_add'] = '[Skapa en ny standard subdomän]'; -$lng['admin']['phpenabled'] = 'PHP påslagen'; -$lng['admin']['deactivated'] = 'Inaktiv'; -$lng['admin']['deactivated_user'] = 'Avaktivera användare'; -$lng['admin']['sendpassword'] = 'Skicka lösenord'; -$lng['admin']['ownvhostsettings'] = 'Egna vHost-Inställningar'; -$lng['admin']['configfiles']['serverconfiguration'] = 'Konfiguration'; -$lng['admin']['templates']['templates'] = 'Mallar'; -$lng['admin']['templates']['template_add'] = '[Lägg till en ny mall]'; -$lng['admin']['templates']['template_edit'] = 'Ändra en befintlig mall'; -$lng['admin']['templates']['action'] = 'Action'; -$lng['admin']['templates']['email'] = 'E-Post'; -$lng['admin']['templates']['subject'] = 'Rubrik (subjekt)'; -$lng['admin']['templates']['mailbody'] = 'E-Postinnehåll (Mail body)'; -$lng['admin']['templates']['createcustomer'] = 'E-Post till nya kunder (Välkommen)'; -$lng['admin']['templates']['pop_success'] = 'E-Post för nya konton (Välkommen)'; -$lng['admin']['templates']['template_replace_vars'] = 'Variabler som kan ändras i mallen:'; -$lng['admin']['templates']['FIRSTNAME'] = 'Ändra till kundens förnamn.'; -$lng['admin']['templates']['NAME'] = 'Ändra till kundens efternamn.'; -$lng['admin']['templates']['USERNAME'] = 'Ändra till kundens kontonamns användarnamn.'; -$lng['admin']['templates']['PASSWORD'] = 'Ändra till kundens kontonamns lösenord.'; -$lng['admin']['templates']['EMAIL'] = 'Ändra till adressen för POP3/IMAP kontot.'; - -/** - * Serversettings - */ - -$lng['serversettings']['session_timeout']['title'] = 'Sessionen har avslutats för att den tog för lång tid att utföra (session Timeout)'; -$lng['serversettings']['session_timeout']['description'] = 'Tiden (i sekunder) som användaren får vara inaktiv innan han måste logga in igen är (seconds)?'; -$lng['serversettings']['accountprefix']['title'] = 'Kund ID (Customer prefix)'; -$lng['serversettings']['accountprefix']['description'] = 'Vilket prefix skall användas till ett kundkonto?'; -$lng['serversettings']['mysqlprefix']['title'] = 'SQL ID (SQL Prefix)'; -$lng['serversettings']['mysqlprefix']['description'] = 'Vilket prefix skall användas till mysql?'; -$lng['serversettings']['ftpprefix']['title'] = 'FTP ID (FTP Prefix)'; -$lng['serversettings']['ftpprefix']['description'] = 'Vilket prefix skall användas till ftp?'; -$lng['serversettings']['documentroot_prefix']['title'] = 'Hemkatalog'; -$lng['serversettings']['documentroot_prefix']['description'] = 'Vilken sökväg skall det vara till hemkatalogen?'; -$lng['serversettings']['logfiles_directory']['title'] = 'Loggfilernas hemkatalog (Logfiles directory)'; -$lng['serversettings']['logfiles_directory']['description'] = 'Vilken sökväg skall det vara till loggfilernas hemkatalog?'; -$lng['serversettings']['ipaddress']['title'] = 'IP-Adress'; -$lng['serversettings']['ipaddress']['description'] = 'Vilken IP-adress har denna server?'; -$lng['serversettings']['hostname']['title'] = 'Datornamn (Hostname)'; -$lng['serversettings']['hostname']['description'] = 'Villket Datornamn (Hostname) har denna server?'; -$lng['serversettings']['apachereload_command']['title'] = 'Ladda om Apache kommandot (Apache reload)'; -$lng['serversettings']['apachereload_command']['description'] = 'Ange sökvägen till programmet som laddar om Apache (reload apache) konfigurationsfiler?'; -$lng['serversettings']['bindconf_directory']['title'] = 'Bind konfigurationskatalog (Bind config directory)'; -$lng['serversettings']['bindconf_directory']['description'] = 'Vilken sökväg skall det vara till bind:s konfigurationsfiler?'; -$lng['serversettings']['bindreload_command']['title'] = 'Ange sökvägen till programmet som laddar om Bind (reload bind) konfigurationsfiler?'; -$lng['serversettings']['bindreload_command']['description'] = 'Ange sökvägen till programmet som laddar om Bind (reload bind) konfigurationsfiler?'; -$lng['serversettings']['vmail_uid']['title'] = 'Mails-UID'; -$lng['serversettings']['vmail_uid']['description'] = 'Vilket användarID (UserID) ska E-posten ha?'; -$lng['serversettings']['vmail_gid']['title'] = 'Mails-GID'; -$lng['serversettings']['vmail_gid']['description'] = 'Vilket gruppID (GroupID) ska E-posten ha?'; -$lng['serversettings']['vmail_homedir']['title'] = 'E-post hemkatalog'; -$lng['serversettings']['vmail_homedir']['description'] = 'I vilken katalog skall E-posten sparas?'; -$lng['serversettings']['adminmail']['title'] = 'Avsändare'; -$lng['serversettings']['adminmail']['description'] = 'Vilken avsändaradress skall E-post från admin panelen ha?'; -$lng['serversettings']['phpmyadmin_url']['title'] = 'phpMyAdmin URL'; -$lng['serversettings']['phpmyadmin_url']['description'] = 'Vilken URL är det till phpMyAdmin? (Måste börja med http(s)://)'; -$lng['serversettings']['webmail_url']['title'] = 'WebMail URL'; -$lng['serversettings']['webmail_url']['description'] = 'Vilken URL är det till WebMail? (Måste börja med http(s)://)'; -$lng['serversettings']['webftp_url']['title'] = 'WebFTP URL'; -$lng['serversettings']['webftp_url']['description'] = 'Vilken URL är det till WebFTP? (Måste börja med http(s)://)'; -$lng['serversettings']['language']['description'] = 'Vilket språk skall användas som standardspråk?'; -$lng['serversettings']['maxloginattempts']['title'] = 'Max antal Login försök'; -$lng['serversettings']['maxloginattempts']['description'] = 'Maximalt antal inloggningsförsök innan kontot stängs av.'; -$lng['serversettings']['deactivatetime']['title'] = 'Avstängningstid'; -$lng['serversettings']['deactivatetime']['description'] = 'Tid (sec.) som kontot stängs av efter för många felaktiga försök.'; -$lng['serversettings']['pathedit']['title'] = 'Typ av (path input)'; -$lng['serversettings']['pathedit']['description'] = 'Skall en sökväg väljas i en rullist eller matas in för hand?'; -$lng['serversettings']['nameservers']['title'] = 'Nameservers'; -$lng['serversettings']['nameservers']['description'] = 'En kommaseparerad lista med namnet (hostname) på alla DNS:er. Den första blir den första som söks (primary).'; -$lng['serversettings']['mxservers']['title'] = 'MX servers'; -$lng['serversettings']['mxservers']['description'] = 'En kommaseparerad lista med nummer och namn separerade men mellanslag (ex. \'10 mx.example.com\') innehåller mx servrarna.'; - -/** - * CHANGED BETWEEN 1.2.12 and 1.2.13 - */ - -$lng['mysql']['description'] = 'Här ändras eller skapas MySQL-Databaser.
Ändringen sker omedelbart och databasen kan användas direkt.
I menyn på vänster sida finns verktyget phpMyAdmin med vilket man enkelt kan ändra i sin databas.

För att använda databasen i dina egna php-scripts använd följande inställningar: (Data med kursiv stil italics måste ändras till det du matat in!)
Servernamn (Hostname):
Användarnamn (Username): Databsnamn (Databasename)
Lösenord (Password): Lösenordet som du har valt
Databas (Database): Databasnamn (Databasename)'; - -/** - * ADDED BETWEEN 1.2.12 and 1.2.13 - */ -$lng['serversettings']['paging']['title'] = 'Antal rader per sida'; -$lng['serversettings']['paging']['description'] = 'Hur många rader skall det vara på en sida? (0 = Stäng av sidbrytning)'; -$lng['error']['ipstillhasdomains'] = 'IP/Port kombinationen som du vill radera har fortfarande domäner anslutna till sig, Flytta dessa till någon annan IP/Port kombination innan du raderar denna IP/Port kombination.'; -$lng['error']['cantdeletedefaultip'] = 'Det går inte att ta bort den förvalda återförsäljarens IP/Port kombination, Välj en annan IP/Port kombination som förval för återförsäljare innan du raderar denna IP/Port kombination.'; -$lng['error']['cantdeletesystemip'] = 'Det går inte att radera den sista system IP:n, Antingen skapar man en ny IP/Port kombination för system IP eller så ändrar man system IP:n.'; -$lng['error']['myipaddress'] = '\'IP\''; -$lng['error']['myport'] = '\'Port\''; -$lng['error']['myipdefault'] = 'Man måste välja en IP/Port kombination som skall bli standardvärdet.'; -$lng['error']['myipnotdouble'] = 'Denna IP/Port kombination finns redan.'; -$lng['question']['admin_ip_reallydelete'] = 'Är du säker på att du vill radera IP addressen %s?'; -$lng['admin']['ipsandports']['ipsandports'] = 'IPs and Ports'; -$lng['admin']['ipsandports']['add'] = '[Lägg till IP/Port]'; -$lng['admin']['ipsandports']['edit'] = 'Ändra IP/Port'; - -// ADDED IN 1.2.13-rc3 - -$lng['error']['cantchangesystemip'] = 'Man kan inte ändra den senaste system IP-adressen. Skapa en helt ny IP/Port kombination för system IP:n eller ändra system IP-adressen.'; -$lng['question']['admin_domain_reallydocrootoutofcustomerroot'] = 'Dokumentkatalogen för denna domän inte kommer att ligga under kundkatalogen, är du säker på att du vill ändra detta?'; - -// ADDED IN 1.2.14-rc1 - -$lng['admin']['memorylimitdisabled'] = 'Avstängd'; -$lng['domain']['openbasedirpath'] = 'OpenBasedir-path'; -$lng['domain']['docroot'] = 'Sökvägen från ovanstående fält'; -$lng['domain']['homedir'] = 'Hemkatalog'; -$lng['admin']['valuemandatory'] = 'Denna ruta måste fyllas i'; -$lng['admin']['valuemandatorycompany'] = 'Fyll i "förnamn" och "efternamn" eller "företagsnamn"'; -$lng['menue']['main']['username'] = 'Inloggad som: '; -$lng['panel']['urloverridespath'] = 'URL (skriver över sökvägen)'; -$lng['panel']['pathorurl'] = 'Sökväg eller URL'; -$lng['error']['sessiontimeoutiswrong'] = 'Bara siffror "Session Timeout" är tillåtna.'; -$lng['error']['maxloginattemptsiswrong'] = 'Bara siffror "Max Login Attempts" är tillåtna.'; -$lng['error']['deactivatetimiswrong'] = 'Bara siffror "Deactivate Time" är tillåtna.'; -$lng['error']['accountprefixiswrong'] = 'Det här "Customerprefix" är fel.'; -$lng['error']['mysqlprefixiswrong'] = 'Det här "SQL Prefix" är fel.'; -$lng['error']['ftpprefixiswrong'] = 'Det här "FTP Prefix" är fel.'; -$lng['error']['ipiswrong'] = 'Den här "IP-Address" är fel. Endast en giltig IP-adress är tillåten.'; -$lng['error']['vmailuidiswrong'] = 'Den här "Mails-uid" är fel. Endast numerisk UID är tillåtenis allowed.'; -$lng['error']['vmailgidiswrong'] = 'Den här "Mails-gid" är fel. Endast numerisk GID är tillåtenis allowed.'; -$lng['error']['adminmailiswrong'] = 'Den här "Sender-address" är fel. Endast en giltig E-postadress är tillåten.'; -$lng['error']['pagingiswrong'] = 'Den här "Entries per Page"-värdet är fel. Endast siffror är tillåtna.'; -$lng['error']['phpmyadminiswrong'] = 'Den här phpMyAdmin-link är inte en giltig länk.'; -$lng['error']['webmailiswrong'] = 'Den här WebMail-link är inte en giltig länk.'; -$lng['error']['webftpiswrong'] = 'Den här WebFTP-link är inte en giltig länk.'; -$lng['domains']['hasaliasdomains'] = 'Domänen har redan alias'; -$lng['serversettings']['defaultip']['title'] = 'Förvald IP/Port'; -$lng['serversettings']['defaultip']['description'] = 'Vilken är den förvalda IP/Port kombinationen?'; -$lng['domains']['statstics'] = 'Användarstatistik'; -$lng['panel']['ascending'] = 'Stigande'; -$lng['panel']['descending'] = 'Fallande'; -$lng['panel']['search'] = 'Sök'; -$lng['panel']['used'] = 'använd'; - -// ADDED IN 1.2.14-rc3 - -$lng['panel']['translator'] = 'Översättare'; - -// ADDED IN 1.2.14-rc4 - -$lng['error']['stringformaterror'] = 'Värdet för fältet "%s" har inte rätt format.'; - -// ADDED IN 1.2.15-rc1 - -$lng['admin']['serversoftware'] = 'Webserver version'; -$lng['admin']['phpversion'] = 'PHP-Version'; -$lng['admin']['phpmemorylimit'] = 'PHP-Minnesgräns'; -$lng['admin']['mysqlserverversion'] = 'MySQL Server Version'; -$lng['admin']['mysqlclientversion'] = 'MySQL Klient Version'; -$lng['admin']['webserverinterface'] = 'Webserver Interface'; -$lng['domains']['isassigneddomain'] = 'Tilldelad domän '; -$lng['serversettings']['phpappendopenbasedir']['title'] = 'Sökväg att lägga till OpenBasedir'; -$lng['serversettings']['phpappendopenbasedir']['description'] = 'Dessa sökvägar (separerade med kolon) kommer att läggas till OpenBasedir-statement i alla vhost-container.'; - -// CHANGED IN 1.2.15-rc1 - -$lng['error']['loginnameissystemaccount'] = 'Det går inte att skapa ett konto som liknar ett systemkonto (Om det till exempel börjar med "%s"). Vlj ett annat kontonamn.'; -$lng['error']['youcantdeleteyourself'] = 'Av säkerhetsskäl går inte att redera ditt eget konto.'; -$lng['error']['youcanteditallfieldsofyourself'] = 'Notera: Av säkerhetsskäl går det inte att ändra ditt eget konto.'; - -// ADDED IN 1.2.16-svn1 - -$lng['serversettings']['natsorting']['title'] = 'Använd mänsklig sortertering i listvisning'; -$lng['serversettings']['natsorting']['description'] = 'Sorterar listan så här web1 -> web2 -> web11 istället för web1 -> web11 -> web2.'; - -// ADDED IN 1.2.16-svn2 - -$lng['serversettings']['deactivateddocroot']['title'] = 'Dokumentroot för avstängda användare'; -$lng['serversettings']['deactivateddocroot']['description'] = 'När en användare är avstängd kommer denna sökväg att användas som dokumentroot. Lämna fältet tommt om du inte vill skapa någon vhost.'; - -// ADDED IN 1.2.16-svn4 - -$lng['panel']['reset'] = 'Avbryt ändringarna'; -$lng['admin']['accountsettings'] = 'Kontoinställningar'; -$lng['admin']['panelsettings'] = 'Panelinställningar'; -$lng['admin']['systemsettings'] = 'Systeminställningar'; -$lng['admin']['webserversettings'] = 'Webserverinställningar'; -$lng['admin']['mailserversettings'] = 'E-postserverinställningar'; -$lng['admin']['nameserversettings'] = 'Namnserverinställningar'; -$lng['admin']['updatecounters'] = 'Uppdatera status'; -$lng['question']['admin_counters_reallyupdate'] = 'Vill du uppdatera alla statusberäkningar för kunder och admins?'; -$lng['panel']['pathDescription'] = 'Katalogen kommer att skapas om den inte redan finns.'; - -// ADDED IN 1.2.16-svn6 -$lng['admin']['templates']['TRAFFIC'] = 'Ersatt med trafikbegrnsningen som var tilldelad till kunden.'; -$lng['admin']['templates']['TRAFFICUSED'] = 'Ersatt med trafikbegrnsningen som var överskriden av kunden.'; - -// ADDED IN 1.2.16-svn7 - -$lng['admin']['subcanemaildomain']['never'] = 'Aldrig'; -$lng['admin']['subcanemaildomain']['choosableno'] = 'Valbar, standardvärdet är Nej'; -$lng['admin']['subcanemaildomain']['choosableyes'] = 'Valbar, standardvärdet är Ja'; -$lng['admin']['subcanemaildomain']['always'] = 'Alltid'; -$lng['changepassword']['also_change_stats'] = ' Ändra även lösenord för statistik'; - -// ADDED IN 1.2.16-svn8 - -$lng['serversettings']['mailpwcleartext']['title'] = 'Spara även lösenord till E-postkonton okrypterade i databassen'; -$lng['serversettings']['mailpwcleartext']['description'] = 'Om du valt Ja så kommer alla lösenord att sparas okrypterade (klartext, fullt läsbara för alla som har rättigheter till databasen) i tabellen mail_users-table. Aktivera detta endast om du är säker på vad du gör!'; -$lng['serversettings']['mailpwcleartext']['removelink'] = 'Klicka här för att radera alla okrypterade lösenord från tabellen.'; -$lng['question']['admin_cleartextmailpws_reallywipe'] = 'Är du säker på att du vill radera alla okrupterade lösenord från tabellen mail_users? Du kan INTE ändra dig efteråt!'; -$lng['admin']['configfiles']['overview'] = 'Översikt'; -$lng['admin']['configfiles']['wizard'] = 'Guide'; -$lng['admin']['configfiles']['mail'] = 'E-postserver (POP3/IMAP)'; -$lng['admin']['configfiles']['smtp'] = 'E-postserver (SMTP)'; - -// ADDED IN 1.2.16-svn10 - -$lng['serversettings']['ftpdomain']['title'] = 'FTP konton @domain'; -$lng['serversettings']['ftpdomain']['description'] = 'Kunder kan skapa Ftp accounts user@customerdomain?'; -$lng['panel']['back'] = 'Tillbaka'; - -// ADDED IN 1.2.16-svn12 - -$lng['serversettings']['mod_fcgid']['title'] = 'Inkludera PHP via mod_fcgid/suexec'; -$lng['serversettings']['mod_fcgid']['description'] = 'Använd mod_fcgid/suexec/libnss_mysql för att köra PHP med tillhörande användarkonto.
Denna inställning behöver en speciell apache-konfiguration!'; -$lng['serversettings']['sendalternativemail']['title'] = 'Använd en alternativ E-postadress'; -$lng['serversettings']['sendalternativemail']['description'] = 'Skicka lösenord med E-post till adressen under email-account-creation'; -$lng['emails']['alternative_emailaddress'] = 'Alternative e-mail-address'; -$lng['mails']['pop_success_alternative']['mailbody'] = 'Hej,\n\nditt E-postkonto {EMAIL}\nhar ny skapats.\nDitt lösenord är {PASSWORD}.\n\nDetta är ett automatgenererat E-postmeddelande som det INTE går att svara på!\n\nLycka till önskar, Froxlor'; -$lng['mails']['pop_success_alternative']['subject'] = 'E-postkontot är nu skapat'; -$lng['admin']['templates']['pop_success_alternative'] = 'Välkommstmeddelande för nya E-post konton som skickas till den alternativa adressen'; -$lng['admin']['templates']['EMAIL_PASSWORD'] = 'Ersatt med POP3/IMAP kontots lösenord.'; - -// ADDED IN 1.2.16-svn13 - -$lng['error']['documentrootexists'] = 'Katalogen "%s" finns redan hos den här kunden. Radera detta först innan kunden skapas igen.'; - -// ADDED IN 1.2.16-svn14 - -$lng['serversettings']['apacheconf_vhost']['title'] = 'Apache vhost konfiguration fil/katalognamn'; -$lng['serversettings']['apacheconf_vhost']['description'] = 'Var skall vhost konfigurationen sparas? Det går att specificera alla vhost i en fil eller en katalog där alla filerna ligger (varje vhost i sin egen fil).'; -$lng['serversettings']['apacheconf_diroptions']['title'] = 'Apache diroptions konfiguration fil/katalognamn'; -$lng['serversettings']['apacheconf_diroptions']['description'] = 'Var skall diroptions konfigurationen sparas? Det går att specificera alla diroptions i en fil eller en katalog där alla filerna ligger (varje diroptions i sin egen fil).'; -$lng['serversettings']['apacheconf_htpasswddir']['title'] = 'Apache htpasswd katalognamn'; -$lng['serversettings']['apacheconf_htpasswddir']['description'] = 'Var skall htpasswd konfigurationen för katalogsäkerheten?'; - -// ADDED IN 1.2.16-svn15 - -$lng['error']['formtokencompromised'] = 'Den säkra anslutningen till Froxlor har avslutats och du har av säkerhetsskäl automatiskt loggats ur.'; -$lng['serversettings']['mysql_access_host']['description'] = 'En kommaseparerad lista med datornamn som tillåts att kontakta MySQL servern.'; - -// ADDED IN 1.2.18-svn1 - -$lng['admin']['ipsandports']['create_listen_statement'] = 'Skapa "Listen statement"'; -$lng['admin']['ipsandports']['create_namevirtualhost_statement'] = 'Skapa NameVirtualHost statement'; -$lng['admin']['ipsandports']['create_vhostcontainer'] = 'Skapa vHost-Container'; -$lng['admin']['ipsandports']['create_vhostcontainer_servername_statement'] = 'Skapa ServerName statement i vHost-Container'; - -// ADDED IN 1.2.18-svn2 - -$lng['admin']['webalizersettings'] = 'Webalizer inställningar'; -$lng['admin']['webalizer']['normal'] = 'Normal'; -$lng['admin']['webalizer']['quiet'] = 'Tyst'; -$lng['admin']['webalizer']['veryquiet'] = 'Väldigt tyst'; - -// ADDED IN 1.2.18-svn4 - -$lng['admin']['domain_nocustomeraddingavailable'] = 'Det går inte att skapa en ny domän innan det finns mins en upplagd kund.'; - -// ADDED IN 1.2.19-svn1 - -$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'FCGI konfigurationskatalog'; -$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'I vilken katalog skall alla fcgi-konfigurationfiler lagras?'; -$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'FCGI temporärkatalog'; - -// ADDED IN 1.2.19-svn4 - -$lng['menue']['traffic']['traffic'] = 'Trafik'; -$lng['menue']['traffic']['current'] = 'Nuvarande månad'; -$lng['traffic']['month'] = "Månad"; -$lng['traffic']['day'] = "Dag"; -$lng['traffic']['months'][1] = "Januari"; -$lng['traffic']['months'][2] = "Februari"; -$lng['traffic']['months'][3] = "Mars"; -$lng['traffic']['months'][4] = "April"; -$lng['traffic']['months'][5] = "Maj"; -$lng['traffic']['months'][6] = "Juni"; -$lng['traffic']['months'][7] = "Juli"; -$lng['traffic']['months'][8] = "Augusti"; -$lng['traffic']['months'][9] = "September"; -$lng['traffic']['months'][10] = "Oktober"; -$lng['traffic']['months'][11] = "November"; -$lng['traffic']['months'][12] = "December"; -$lng['traffic']['mb'] = "Trafik (MB)"; -$lng['traffic']['distribution'] = 'FTP | HTTP | Mail'; -$lng['traffic']['sumhttp'] = 'Summa HTTP-Trafik i'; -$lng['traffic']['sumftp'] = 'Summa FTP-Trafik i'; -$lng['traffic']['summail'] = 'Summa E-posttrafik i'; diff --git a/templates/Froxlor/form/formfields.html.twig b/templates/Froxlor/form/formfields.html.twig index 02ec6471..c77d24ed 100644 --- a/templates/Froxlor/form/formfields.html.twig +++ b/templates/Froxlor/form/formfields.html.twig @@ -61,6 +61,13 @@ {% endif %} {% endmacro %} +{% macro field(id, field, norow = true, nohide = false, em = false) %} +
+ + {{ _self.fieldrow(id, field, norow, nohide, em) }} +
+{% endmacro %} + {% macro bool(id, field) %} {% if field.is_array is defined and field.is_array == 1 and field.values is not empty %} {% for subfield in field.values %} diff --git a/templates/Froxlor/install/index.html.twig b/templates/Froxlor/install/index.html.twig index 896fa00d..d4827d68 100644 --- a/templates/Froxlor/install/index.html.twig +++ b/templates/Froxlor/install/index.html.twig @@ -2,58 +2,69 @@ {% block content %}
- Froxlor Server Management Panel + Froxlor Server Management Panel -
-
-

{{ pagetitle }}

- {% if pagecontent.checks is defined or pagecontent.installprocess is defined %} - - {% if pagecontent.checks is defined %} - {% set checks = pagecontent.checks %} - {% else %} - {% set checks = pagecontent.installprocess %} +
+
Preflight
+
Database
+
Admin
+
System
+
+ +
+
+
+ {% if setup.step > 0 %} +

{{ section.title }}

+

{{ section.description }}

+ + {% import "Froxlor/form/formfields.html.twig" as formfields %} + + {% for id, field in section.fields %} + {{ formfields.field(id, field) }} + {% endfor %} + +
+ « + +
+ {% else %} +

Welcome to froxlor

+

We check the system for dependencies to ensure that all required php extensions and modules are enabled so that froxlor runs properly.

+ +

+ + {{ preflight.text }} +

+ + {% if preflight.criticals %} +

Critical Error

+
    + {% for critical in preflight.criticals %} +
  • {{ critical|json_encode }}
    • + {% endfor %} +
{% endif %} - {% for check in checks %} -
- - - - {% if check.result_desc is not empty %} - - - - {% endif %} - {% endfor %} -
{{ check.title }} - {{ check.result_txt }} - {% if check.result == 0 %}  ???{% elseif check.result == 1 %} !!! - {% endif %} -
- {{ check.result_desc|raw }} -
- {% elseif pagecontent.form is defined %} - {% include "Froxlor/install/form.html.twig" %} - {% else %} - - {% endif %} + {% if preflight.suggestions %} +

Suggestions

+
    + {% for suggestion in preflight.suggestions %} +
  • {{ suggestion|json_encode }}
    • + {% endfor %} +
+ {% endif %} - {% if pagenavigation is not empty %} -
-
-

{{ pagenavigation.message }}

+
+ {% if preflight.criticals or preflight.suggestions %} + Check again + {% else %} + Start installation + {% endif %}
-
- - {{ pagenavigation.linktext }} » - -
-
- {% endif %} + {% endif %} +
-
+
{% endblock %} diff --git a/templates/index.html b/templates/index.html new file mode 100644 index 00000000..e69de29b