beginning of rework/redesign of settings
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
This commit is contained in:
Michael Kaufmann
@@ -318,7 +318,7 @@ $lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account
|
||||
$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.';
|
||||
$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number';
|
||||
$lng['admin']['webserver'] = 'Webový server';
|
||||
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
|
||||
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="text-danger">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
|
||||
|
||||
/**
|
||||
* Serversettings
|
||||
@@ -408,7 +408,7 @@ $lng['admin']['ipsandports']['add'] = 'Přidat IP/Port';
|
||||
$lng['admin']['ipsandports']['edit'] = 'Upravit IP/Port';
|
||||
$lng['admin']['ipsandports']['ipandport'] = 'IP/Port';
|
||||
$lng['admin']['ipsandports']['ip'] = 'IP';
|
||||
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
|
||||
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="text-danger">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
|
||||
$lng['admin']['ipsandports']['port'] = 'Port';
|
||||
|
||||
// ADDED IN 1.2.13-rc3
|
||||
@@ -596,7 +596,7 @@ $lng['error']['norepymailiswrong'] = 'The "Noreply-address" is wrong. Only a val
|
||||
// ADDED IN 1.2.19-svn1
|
||||
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Konfigurace adresářů';
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/<br /><br /><div class="red">POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.</div>';
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/<br /><br /><div class="text-danger">POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.</div>';
|
||||
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Dočasný adresář';
|
||||
|
||||
// ADDED IN 1.2.19-svn4
|
||||
@@ -705,7 +705,7 @@ $lng['admin']['caneditphpsettings'] = 'Může změnit doménové nastavení spoj
|
||||
$lng['admin']['allips'] = 'Všechny IP';
|
||||
$lng['panel']['nosslipsavailable'] = 'Momentálně zde nejsou žádné ssl ip/port kombinace pro tento server';
|
||||
$lng['dkim']['use_dkim']['title'] = 'Aktivovat DKIM podporu?';
|
||||
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="red">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
|
||||
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="text-danger">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
|
||||
$lng['error']['invalidmysqlhost'] = 'Invalid MySQL host address: %s';
|
||||
$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'You cannot enable Webalizer and AWstats at the same time, please chose one of them';
|
||||
$lng['serversettings']['webalizer_enabled'] = 'Povolit webalizer statistiky';
|
||||
@@ -1043,12 +1043,12 @@ $lng['serversettings']['defaultttl'] = 'Domain TTL for bind in seconds (default
|
||||
// ADDED IN FROXLOR 0.9.6-svn3
|
||||
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Enable default errordocuments for all customers';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL for error 401';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL for error 403';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL for error 404';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL for error 500';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.6-svn5
|
||||
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Default PHP configuration for new domains';
|
||||
@@ -1062,7 +1062,7 @@ $lng['serversettings']['ftpserver']['desc'] = 'If pureftpd is selected the .ftpq
|
||||
$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'New ftp-user created';
|
||||
$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nyou have just added a new ftp-user. Here is the entered information:\n\nUsername: {USR_NAME}\nPassword: {USR_PASS}\nPath: {USR_PATH}\n\nYours sincerely, your administrator";
|
||||
$lng['domains']['redirectifpathisurl'] = 'Redirect code (default: empty)';
|
||||
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="red">NOTE:</strong>Changes are only applied if the given path is an URL.';
|
||||
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="text-danger">NOTE:</strong>Changes are only applied if the given path is an URL.';
|
||||
$lng['serversettings']['customredirect_enabled']['title'] = 'Allow customer redirects';
|
||||
$lng['serversettings']['customredirect_enabled']['description'] = 'Allow customers to choose the http-status code for redirects which will be used';
|
||||
$lng['serversettings']['customredirect_default']['title'] = 'Default redirect';
|
||||
@@ -1142,64 +1142,14 @@ $lng['admin']['templates']['PMA_URI'] = 'Odkaz k phpMyAdmin (pokud je postytnut)
|
||||
$lng['admin']['notgiven'] = '[not given]';
|
||||
$lng['admin']['templates']['USR_NAME'] = 'FTP uživatelské jméno';
|
||||
$lng['admin']['templates']['USR_PASS'] = 'FTP heslo';
|
||||
$lng['admin']['templates']['USR_PATH'] = 'FTP homedir (relative to customer-docroot)';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.12-svn4
|
||||
$lng['serversettings']['awstats_awstatspath'] = 'Path to AWStats \'awstats.pl\'';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.12-svn6
|
||||
$lng['extras']['htpasswdauthname'] = 'Authentication reason (AuthName)';
|
||||
$lng['extras']['directoryprotection_edit'] = 'edit directory protection';
|
||||
$lng['admin']['templates']['forgotpwd'] = 'Notification-mails for password-reset';
|
||||
$lng['admin']['templates']['password_reset'] = 'Customer-notification for passwort-reset';
|
||||
$lng['admin']['store_defaultindex'] = 'Store default index-file to customers docroot';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.14
|
||||
$lng['serversettings']['mod_fcgid']['defaultini_ownvhost'] = 'Default PHP configuration for Froxlor-vHost';
|
||||
$lng['serversettings']['awstats_icons']['title'] = 'Path to AWstats icons folder';
|
||||
$lng['serversettings']['awstats_icons']['description'] = 'e.g. /usr/share/awstats/htdocs/icon/';
|
||||
$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Path to the SSL CertificateChainFile';
|
||||
$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
|
||||
$lng['admin']['ipsandports']['docroot']['title'] = 'Custom docroot (empty = point to Froxlor)';
|
||||
$lng['admin']['ipsandports']['docroot']['description'] = 'You can define a custom document-root (the destination for a request) for this ip/port combination here.<br /><strong>ATTENTION:</strong> Please be careful with what you enter here!';
|
||||
$lng['serversettings']['login_domain_login'] = 'Allow login with domains';
|
||||
$lng['panel']['unlock'] = 'Unlock';
|
||||
$lng['question']['customer_reallyunlock'] = 'Do you really want to unlock customer %s?';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.15
|
||||
$lng['serversettings']['perl_server']['title'] = 'Perl umístění na serveru';
|
||||
$lng['serversettings']['perl_server']['description'] = 'Default is set for using the guide found at: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
|
||||
$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
|
||||
$lng['serversettings']['nginx_php_backend']['description'] = 'this is where the PHP process is listening for requests from nginx, can be a unix socket of ip:port combination<br />*NOT used with php-fpm';
|
||||
$lng['serversettings']['phpreload_command']['title'] = 'PHP reload command';
|
||||
$lng['serversettings']['phpreload_command']['description'] = 'this is used to reload the PHP backend if any is used<br />Default: blank<br />*NOT used with php-fpm';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.16
|
||||
$lng['error']['intvaluetoolow'] = 'Zadané číslo je přiliš malé (pole %s)';
|
||||
$lng['error']['intvaluetoohigh'] = 'Zadané číslo je příliš vysoké (pole %s)';
|
||||
$lng['admin']['phpfpm_settings'] = 'PHP-FPM';
|
||||
$lng['serversettings']['phpfpm']['title'] = 'Zapnout php-fpm';
|
||||
$lng['serversettings']['phpfpm']['description'] = '<b>This needs a special webserver configuration see FPM-handbook for <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> or <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
|
||||
$lng['serversettings']['phpfpm_settings']['configdir'] = 'Configuration directory of php-fpm';
|
||||
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configuration Alias-directory of php-fpm';
|
||||
$lng['serversettings']['phpfpm_settings']['reload'] = 'php-fpm restart command';
|
||||
$lng['serversettings']['phpfpm_settings']['pm'] = 'Process manager control (pm)';
|
||||
$lng['serversettings']['phpfpm_settings']['max_children']['title'] = 'The number of child processes';
|
||||
$lng['serversettings']['phpfpm_settings']['max_children']['description'] = 'The number of child processes to be created when pm is set to \'static\' and the maximum number of child processes to be created when pm is set to \'dynamic/ondemand\'<br />Equivalent to the PHP_FCGI_CHILDREN';
|
||||
$lng['serversettings']['phpfpm_settings']['start_servers']['title'] = 'The number of child processes created on startup';
|
||||
$lng['serversettings']['phpfpm_settings']['start_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'';
|
||||
$lng['serversettings']['phpfpm_settings']['min_spare_servers']['title'] = 'The desired minimum number of idle server processes';
|
||||
$lng['serversettings']['phpfpm_settings']['min_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'<br />Note: Mandatory when pm is set to \'dynamic\'';
|
||||
$lng['serversettings']['phpfpm_settings']['max_spare_servers']['title'] = 'The desired maximum number of idle server processes';
|
||||
$lng['serversettings']['phpfpm_settings']['max_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'<br />Note: Mandatory when pm is set to \'dynamic\'';
|
||||
$lng['serversettings']['phpfpm_settings']['max_requests']['title'] = 'Requests per child before respawning';
|
||||
$lng['serversettings']['phpfpm_settings']['max_requests']['description'] = 'For endless request processing specify \'0\'. Equivalent to PHP_FCGI_MAX_REQUESTS.';
|
||||
$lng['error']['phpfpmstillenabled'] = 'PHP-FPM is currently active. Please deactivate it before activating FCGID';
|
||||
$lng['error']['fcgidstillenabled'] = 'FCGID is currently active. Please deactivate it before activating PHP-FPM';
|
||||
$lng['phpfpm']['vhost_httpuser'] = 'Local user to use for PHP-FPM (Froxlor vHost)';
|
||||
$lng['phpfpm']['vhost_httpgroup'] = 'Local group to use for PHP-FPM (Froxlor vHost)';
|
||||
$lng['phpfpm']['ownvhost']['title'] = 'Enable PHP-FPM for the Froxlor vHost';
|
||||
$lng['phpfpm']['ownvhost']['description'] = 'If enabled, Froxlor will also be running under a local user';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.17
|
||||
$lng['crondesc']['cron_usage_report'] = 'Web- and traffic-reports';
|
||||
@@ -1562,7 +1512,7 @@ $lng['serversettings']['catchall_enabled']['description'] = 'Do you want to prov
|
||||
|
||||
// ADDED IN 0.9.28.svn6
|
||||
$lng['serversettings']['apache_24']['title'] = 'Použít modifikace pro Apache 2.4';
|
||||
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
|
||||
$lng['serversettings']['apache_24']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Path to fastcgi_params file';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specify the path to nginx\'s fastcgi_params file including filename';
|
||||
|
||||
@@ -1606,13 +1556,13 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
|
||||
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
|
||||
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
|
||||
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="text-danger">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
|
||||
|
||||
// Added in Froxlor 0.9.30
|
||||
$lng['crondesc']['cron_mailboxsize'] = 'Calculating of mailbox-sizes';
|
||||
$lng['domains']['ipandport_multi']['title'] = 'IP adresa(y)';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="red">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="text-danger">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
|
||||
$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL IP adresa(y)';
|
||||
$lng['domains']['ssl_redirect']['title'] = 'SSL přesměrování';
|
||||
$lng['domains']['ssl_redirect']['description'] = 'This option creates redirects for non-ssl vhosts so that all requests are redirected to the SSL-vhost.<br /><br />e.g. a request to <strong>http</strong>://domain.tld/ will redirect you to <strong>https</strong>://domain.tld/';
|
||||
@@ -1696,7 +1646,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Command to execut
|
||||
$lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.';
|
||||
$lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="red">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="text-danger"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="text-danger">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
|
||||
$lng['error']['passwordshouldnotbeusername'] = 'The password should not be the same as the username.';
|
||||
|
||||
// Added in Froxlor 0.9.33
|
||||
@@ -1715,7 +1665,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
|
||||
$lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list';
|
||||
$lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.';
|
||||
$lng['phpfpm']['use_mod_proxy']['title'] = 'Použít mod_proxy / mod_proxy_fcgi';
|
||||
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
|
||||
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="text-danger">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
|
||||
$lng['error']['no_phpinfo'] = 'Omlouváme se, ale phpinfo() nelze načíst';
|
||||
|
||||
$lng['admin']['movetoadmin'] = 'Přesunout zákazníka';
|
||||
@@ -1737,10 +1687,10 @@ $lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID and PHP-FPM cannot be act
|
||||
|
||||
// Added in Froxlor 0.9.34
|
||||
$lng['admin']['configfiles']['legend'] = '<h3>You are about to configure a service/daemon</h3>';
|
||||
$lng['admin']['configfiles']['commands'] = '<span class="red">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
|
||||
$lng['admin']['configfiles']['files'] = '<span class="red">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="red">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
|
||||
$lng['admin']['configfiles']['commands'] = '<span class="text-danger">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
|
||||
$lng['admin']['configfiles']['files'] = '<span class="text-danger">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="text-danger">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
|
||||
$lng['serversettings']['apache_itksupport']['title'] = 'Use modifications for Apache ITK-MPM';
|
||||
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
|
||||
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
|
||||
$lng['integrity_check']['databaseCharset'] = 'Character set of database (should be UTF-8)';
|
||||
$lng['integrity_check']['domainIpTable'] = 'IP <‐> domain references';
|
||||
$lng['integrity_check']['subdomainSslRedirect'] = 'False SSL-redirect flag for non-ssl domains';
|
||||
@@ -1823,9 +1773,9 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
|
||||
|
||||
// Added for let's encrypt
|
||||
$lng['admin']['letsencrypt']['title'] = 'Používat Let\'s Encrypt';
|
||||
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
|
||||
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
|
||||
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
|
||||
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> This feature is still in beta.';
|
||||
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> This feature is still in beta.';
|
||||
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
|
||||
$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely';
|
||||
$lng['panel']['letsencrypt'] = 'Používá Let\'s encrypt';
|
||||
@@ -1885,8 +1835,8 @@ $lng['crondesc']['cron_backup'] = 'Process backup jobs';
|
||||
$lng['error']['backupfunctionnotenabled'] = 'The backup function is not enabled';
|
||||
$lng['serversettings']['backupenabled']['title'] = "Povolit zálohy pro zákazníky";
|
||||
$lng['serversettings']['backupenabled']['description'] = "If activated, the customer will be able to schedule backup jobs (cron-backup) which generates an archive within his docroot (subdirectory chosable by customer)";
|
||||
$lng['extras']['path_protection_label'] = '<strong class="red">Important</strong>';
|
||||
$lng['extras']['path_protection_info'] = '<strong class="red">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
|
||||
$lng['extras']['path_protection_label'] = '<strong class="text-danger">Important</strong>';
|
||||
$lng['extras']['path_protection_info'] = '<strong class="text-danger">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
|
||||
$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Backup job for customer %loginname%';
|
||||
|
||||
$lng['error']['dns_domain_nodns'] = 'DNS pro tuto doménu je vypnuto';
|
||||
@@ -1926,7 +1876,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Select i
|
||||
|
||||
// Added in froxlor 0.9.38-rc1
|
||||
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users';
|
||||
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Please note: Shell access allows the user to execute various binaries on your system. Use with extreme caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
|
||||
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="text-danger">Please note: Shell access allows the user to execute various binaries on your system. Use with extreme caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
|
||||
$lng['serversettings']['available_shells']['title'] = 'List of available shells';
|
||||
$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.<br><br>Note that the default shell <strong>/bin/false</strong> will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case';
|
||||
$lng['panel']['shell'] = 'Shell';
|
||||
@@ -1935,8 +1885,8 @@ $lng['serversettings']['le_froxlor_enabled']['description'] = "If activated, the
|
||||
$lng['serversettings']['le_froxlor_redirect']['title'] = "Enable SSL-redirect for the froxlor vhost";
|
||||
$lng['serversettings']['le_froxlor_redirect']['description'] = "If activated, all http requests to your froxlor will be redirected to the corresponding SSL site.";
|
||||
$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost settings';
|
||||
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="red">Available only for: %s</em>';
|
||||
$lng['serversettings']['option_unavailable'] = '<br><em class="red">Option not available due to other settings.</em>';
|
||||
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="text-danger">Available only for: %s</em>';
|
||||
$lng['serversettings']['option_unavailable'] = '<br><em class="text-danger">Option not available due to other settings.</em>';
|
||||
$lng['serversettings']['letsencryptacmeconf']['title'] = "Path to the acme.conf snippet";
|
||||
$lng['serversettings']['letsencryptacmeconf']['description'] = "File name of the config snippet which allows the web server to serve the acme challenge.";
|
||||
$lng['admin']['hostname'] = 'Hostname';
|
||||
@@ -1961,18 +1911,18 @@ $lng['admin']['domain_hsts_preload']['title'] = 'Include domain in <a href="http
|
||||
$lng['admin']['domain_hsts_preload']['description'] = 'If you would like this domain to be included in the HSTS preload list maintained by Chrome (and used by Firefox and Safari), then use activate this.<br>Sending the preload directive from your site can have PERMANENT CONSEQUENCES and prevent users from accessing your site and any of its subdomains.<br>Please read the details at <a href="https://hstspreload.appspot.com/#removal" target="_blank">hstspreload.appspot.com/#removal</a> before sending the header with "preload".';
|
||||
|
||||
$lng['serversettings']['http2_support']['title'] = 'HTTP2 Support';
|
||||
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="red">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
|
||||
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="text-danger">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
|
||||
|
||||
$lng['error']['noipportgiven'] = 'No IP/port given';
|
||||
|
||||
// Added in froxlor 0.9.38.8
|
||||
$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling';
|
||||
$lng['admin']['domain_ocsp_stapling']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/OCSP_stapling">Wikipedia</a> for a detailed explanation of OCSP stapling';
|
||||
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="red">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
|
||||
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="text-danger">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
|
||||
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: path to the OCSP stapling cache';
|
||||
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Configures the cache used to store OCSP responses which get included in TLS handshakes.';
|
||||
$lng['serversettings']['nssextrausers']['title'] = 'Use libnss-extrausers instead of libnss-mysql';
|
||||
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="red">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
|
||||
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="text-danger">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
|
||||
$lng['admin']['domain_http2']['title'] = 'HTTP2 support';
|
||||
$lng['admin']['domain_http2']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/HTTP/2">Wikipedia</a> for a detailed explanation of HTTP2';
|
||||
$lng['admin']['testmail'] = 'SMTP test';
|
||||
@@ -2012,7 +1962,7 @@ $lng['question']['plan_reallydelete'] = 'Do you really want to delete the hostin
|
||||
$lng['admin']['notryfiles']['title'] = 'No autogenerated try_files';
|
||||
$lng['admin']['notryfiles']['description'] = 'Say yes here if you want to specify a custom try_files directive in specialsettings (needed for some wordpress plugins for example).';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Override FPM-daemon settings (pm, max_children, etc.)';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="red">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="text-danger">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
|
||||
$lng['panel']['backuppath']['title'] = 'Destination path for the backup';
|
||||
$lng['panel']['backuppath']['description'] = 'This is the path where the backups will be stored. If backup of web-data is selected, all files from the homedir are stored excluding the backup-folder specified here.';
|
||||
|
||||
@@ -2032,7 +1982,7 @@ $lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD';
|
||||
$lng['serversettings']['enable_api']['title'] = 'Enable external API usage';
|
||||
$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
|
||||
$lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)';
|
||||
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
|
||||
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <code>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096</code>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
|
||||
$lng['2fa']['2fa'] = '2FA možnosti';
|
||||
$lng['2fa']['2fa_enabled'] = 'Aktivovat dvoufázové ověření (2FA)';
|
||||
$lng['login']['2fa'] = 'Dvoufázové ověření (2FA)';
|
||||
@@ -2057,7 +2007,7 @@ $lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted th
|
||||
$lng['panel']['alternative_cmdline_config'] = 'Alternatively, just run the following command as root-user in your shell to configure the services automatically';
|
||||
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database';
|
||||
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%';
|
||||
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
|
||||
$lng['admin']['novhostcontainer'] = '<br><br><small class="text-danger">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
|
||||
$lng['serversettings']['errorlog_level']['title'] = 'Error log-level';
|
||||
$lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.';
|
||||
$lng['serversettings']['letsencryptecc']['title'] = "Issue ECC / ECDSA certificate";
|
||||
|
||||
@@ -953,12 +953,12 @@ $lng['serversettings']['defaultttl'] = 'Standaard TTL voor domeinen in seconden
|
||||
// ADDED IN FROXLOR 0.9.6-svn3
|
||||
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Standaard foutdocumenten voor alle klanten activeren';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'Bestand/URL voor foutcode 401';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Wordt niet ondersteund in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Wordt niet ondersteund in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'Bestand/URL voor foutcode 403';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Wordt niet ondersteund in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Wordt niet ondersteund in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'Bestand/URL voor foutcode 404';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'Bestand/URL voor foutcode 500';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Wordt niet ondersteund in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Wordt niet ondersteund in: lighttpd</div>';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.6-svn5
|
||||
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Standaard PHP-configuratie voor nieuwe domeinen';
|
||||
|
||||
@@ -322,7 +322,7 @@ $lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account
|
||||
$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.';
|
||||
$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number';
|
||||
$lng['admin']['webserver'] = 'Webserver';
|
||||
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
|
||||
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="text-danger">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
|
||||
|
||||
/**
|
||||
* Serversettings
|
||||
@@ -412,7 +412,7 @@ $lng['admin']['ipsandports']['add'] = 'Add IP/Port';
|
||||
$lng['admin']['ipsandports']['edit'] = 'Edit IP/Port';
|
||||
$lng['admin']['ipsandports']['ipandport'] = 'IP/Port';
|
||||
$lng['admin']['ipsandports']['ip'] = 'IP';
|
||||
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
|
||||
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="text-danger">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
|
||||
$lng['admin']['ipsandports']['port'] = 'Port';
|
||||
|
||||
// ADDED IN 1.2.13-rc3
|
||||
@@ -600,7 +600,7 @@ $lng['error']['norepymailiswrong'] = 'The "Noreply-address" is wrong. Only a val
|
||||
// ADDED IN 1.2.19-svn1
|
||||
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Configuration directory';
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Where should all fcgid-configuration files be stored? If you don\'t use a self compiled suexec binary, which is the normal situation, this path must be under /var/www/<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Where should all fcgid-configuration files be stored? If you don\'t use a self compiled suexec binary, which is the normal situation, this path must be under /var/www/<br /><br /><div class="text-danger">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Temp directory';
|
||||
|
||||
// ADDED IN 1.2.19-svn4
|
||||
@@ -711,7 +711,7 @@ $lng['admin']['caneditphpsettings'] = 'Can change php-related domain settings?';
|
||||
$lng['admin']['allips'] = 'All IP\'s';
|
||||
$lng['panel']['nosslipsavailable'] = 'There are currently no ssl ip/port combinations for this server';
|
||||
$lng['dkim']['use_dkim']['title'] = 'Activate DKIM support?';
|
||||
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="red">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
|
||||
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="text-danger">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
|
||||
$lng['error']['invalidmysqlhost'] = 'Invalid MySQL host address: %s';
|
||||
$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'You cannot enable Webalizer and AWstats at the same time, please chose one of them';
|
||||
$lng['serversettings']['webalizer_enabled'] = 'Enable webalizer statistics';
|
||||
@@ -1049,12 +1049,12 @@ $lng['serversettings']['defaultttl'] = 'Domain TTL for bind in seconds (default
|
||||
// ADDED IN FROXLOR 0.9.6-svn3
|
||||
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Enable default errordocuments for all customers';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL for error 401';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL for error 403';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL for error 404';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL for error 500';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Not supported in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.6-svn5
|
||||
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Default PHP configuration for new domains';
|
||||
@@ -1068,7 +1068,7 @@ $lng['serversettings']['ftpserver']['desc'] = 'If pureftpd is selected the .ftpq
|
||||
$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'New ftp-user created';
|
||||
$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nyou have just added a new ftp-user. Here is the entered information:\n\nUsername: {USR_NAME}\nPassword: {USR_PASS}\nPath: {USR_PATH}\n\nYours sincerely, your administrator";
|
||||
$lng['domains']['redirectifpathisurl'] = 'Redirect code (default: empty)';
|
||||
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="red">NOTE:</strong>Changes are only applied if the given path is an URL.';
|
||||
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="text-danger">NOTE:</strong>Changes are only applied if the given path is an URL.';
|
||||
$lng['serversettings']['customredirect_enabled']['title'] = 'Allow customer redirects';
|
||||
$lng['serversettings']['customredirect_enabled']['description'] = 'Allow customers to choose the http-status code for redirects which will be used';
|
||||
$lng['serversettings']['customredirect_default']['title'] = 'Default redirect';
|
||||
@@ -1185,7 +1185,7 @@ $lng['error']['intvaluetoolow'] = 'The given number is too low (field %s)';
|
||||
$lng['error']['intvaluetoohigh'] = 'The given number is too high (field %s)';
|
||||
$lng['admin']['phpfpm_settings'] = 'PHP-FPM';
|
||||
$lng['serversettings']['phpfpm']['title'] = 'Enable php-fpm';
|
||||
$lng['serversettings']['phpfpm']['description'] = '<b>This needs a special webserver configuration see FPM-handbook for <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> or <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
|
||||
$lng['serversettings']['phpfpm']['description'] = '<b>This needs a special webserver configuration see <a target="_blank" href="https://docs.froxlor.org/general/configuration/php-fpm.html">PHP-FPM handbook</a></b>';
|
||||
$lng['serversettings']['phpfpm_settings']['configdir'] = 'Configuration directory of php-fpm';
|
||||
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configuration Alias-directory of php-fpm';
|
||||
$lng['serversettings']['phpfpm_settings']['reload'] = 'php-fpm restart command';
|
||||
@@ -1568,7 +1568,7 @@ $lng['serversettings']['catchall_enabled']['description'] = 'Do you want to prov
|
||||
|
||||
// ADDED IN 0.9.28.svn6
|
||||
$lng['serversettings']['apache_24']['title'] = 'Use modifications for Apache 2.4';
|
||||
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
|
||||
$lng['serversettings']['apache_24']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Path to fastcgi_params file';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specify the path to nginx\'s fastcgi_params file including filename';
|
||||
|
||||
@@ -1614,13 +1614,13 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
|
||||
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
|
||||
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
|
||||
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="text-danger">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
|
||||
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
|
||||
|
||||
// Added in Froxlor 0.9.30
|
||||
$lng['crondesc']['cron_mailboxsize'] = 'Calculating of mailbox-sizes';
|
||||
$lng['domains']['ipandport_multi']['title'] = 'IP address(es)';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="red">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="text-danger">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
|
||||
$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL IP address(es)';
|
||||
$lng['domains']['ssl_redirect']['title'] = 'SSL redirect';
|
||||
$lng['domains']['ssl_redirect']['description'] = 'This option creates redirects for non-ssl vhosts so that all requests are redirected to the SSL-vhost.<br /><br />e.g. a request to <strong>http</strong>://domain.tld/ will redirect you to <strong>https</strong>://domain.tld/';
|
||||
@@ -1704,7 +1704,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Command to execut
|
||||
$lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.';
|
||||
$lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="red">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="text-danger"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="text-danger">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
|
||||
$lng['error']['passwordshouldnotbeusername'] = 'The password should not be the same as the username.';
|
||||
|
||||
// Added in Froxlor 0.9.33
|
||||
@@ -1723,7 +1723,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
|
||||
$lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list';
|
||||
$lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.';
|
||||
$lng['phpfpm']['use_mod_proxy']['title'] = 'Use mod_proxy / mod_proxy_fcgi';
|
||||
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch) or newer</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
|
||||
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="text-danger">Must be enabled when using Debian 9.x (Stretch) or newer</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
|
||||
$lng['error']['no_phpinfo'] = 'Sorry, unable to read phpinfo()';
|
||||
|
||||
$lng['admin']['movetoadmin'] = 'Move customer';
|
||||
@@ -1745,10 +1745,10 @@ $lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID and PHP-FPM cannot be act
|
||||
|
||||
// Added in Froxlor 0.9.34
|
||||
$lng['admin']['configfiles']['legend'] = '<h3>You are about to configure a service/daemon</h3>';
|
||||
$lng['admin']['configfiles']['commands'] = '<span class="red">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
|
||||
$lng['admin']['configfiles']['files'] = '<span class="red">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="red">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
|
||||
$lng['admin']['configfiles']['commands'] = '<span class="text-danger">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
|
||||
$lng['admin']['configfiles']['files'] = '<span class="text-danger">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="text-danger">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
|
||||
$lng['serversettings']['apache_itksupport']['title'] = 'Use modifications for Apache ITK-MPM';
|
||||
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
|
||||
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
|
||||
$lng['integrity_check']['databaseCharset'] = 'Character set of database (should be UTF-8)';
|
||||
$lng['integrity_check']['domainIpTable'] = 'IP <‐> domain references';
|
||||
$lng['integrity_check']['subdomainSslRedirect'] = 'False SSL-redirect flag for non-ssl domains';
|
||||
@@ -1831,7 +1831,7 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
|
||||
|
||||
// Added for let's encrypt
|
||||
$lng['admin']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
|
||||
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
|
||||
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
|
||||
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
|
||||
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.';
|
||||
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
|
||||
@@ -1935,7 +1935,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Select i
|
||||
|
||||
// Added in froxlor 0.9.38-rc1
|
||||
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users';
|
||||
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Please note: Shell access allows the user to execute various binaries on your system. Use with extrem caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
|
||||
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="text-danger">Please note: Shell access allows the user to execute various binaries on your system. Use with extrem caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
|
||||
$lng['serversettings']['available_shells']['title'] = 'List of available shells';
|
||||
$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.<br><br>Note that the default shell <strong>/bin/false</strong> will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case';
|
||||
$lng['panel']['shell'] = 'Shell';
|
||||
@@ -1944,8 +1944,8 @@ $lng['serversettings']['le_froxlor_enabled']['description'] = "If activated, the
|
||||
$lng['serversettings']['le_froxlor_redirect']['title'] = "Enable SSL-redirect for the froxlor vhost";
|
||||
$lng['serversettings']['le_froxlor_redirect']['description'] = "If activated, all http requests to your froxlor will be redirected to the corresponding SSL site.";
|
||||
$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost settings';
|
||||
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="red">Available only for: %s</em>';
|
||||
$lng['serversettings']['option_unavailable'] = '<br><em class="red">Option not available due to other settings.</em>';
|
||||
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="text-danger">Available only for: %s</em>';
|
||||
$lng['serversettings']['option_unavailable'] = '<br><em class="text-danger">Option not available due to other settings.</em>';
|
||||
$lng['serversettings']['letsencryptacmeconf']['title'] = "Path to the acme.conf snippet";
|
||||
$lng['serversettings']['letsencryptacmeconf']['description'] = "File name of the config snippet which allows the web server to serve the acme challenge.";
|
||||
$lng['admin']['hostname'] = 'Hostname';
|
||||
@@ -1970,18 +1970,18 @@ $lng['admin']['domain_hsts_preload']['title'] = 'Include domain in <a href="http
|
||||
$lng['admin']['domain_hsts_preload']['description'] = 'If you would like this domain to be included in the HSTS preload list maintained by Chrome (and used by Firefox and Safari), then use activate this.<br>Sending the preload directive from your site can have PERMANENT CONSEQUENCES and prevent users from accessing your site and any of its subdomains.<br>Please read the details at <a href="https://hstspreload.appspot.com/#removal" target="_blank">hstspreload.appspot.com/#removal</a> before sending the header with "preload".';
|
||||
|
||||
$lng['serversettings']['http2_support']['title'] = 'HTTP2 Support';
|
||||
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="red">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
|
||||
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="text-danger">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
|
||||
|
||||
$lng['error']['noipportgiven'] = 'No IP/port given';
|
||||
|
||||
// Added in froxlor 0.9.38.8
|
||||
$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling';
|
||||
$lng['admin']['domain_ocsp_stapling']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/OCSP_stapling">Wikipedia</a> for a detailed explanation of OCSP stapling';
|
||||
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="red">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
|
||||
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="text-danger">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
|
||||
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: path to the OCSP stapling cache';
|
||||
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Configures the cache used to store OCSP responses which get included in TLS handshakes.';
|
||||
$lng['serversettings']['nssextrausers']['title'] = 'Use libnss-extrausers instead of libnss-mysql';
|
||||
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="red">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
|
||||
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="text-danger">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
|
||||
$lng['admin']['domain_http2']['title'] = 'HTTP2 support';
|
||||
$lng['admin']['domain_http2']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/HTTP/2">Wikipedia</a> for a detailed explanation of HTTP2';
|
||||
$lng['admin']['testmail'] = 'SMTP test';
|
||||
@@ -2021,7 +2021,7 @@ $lng['question']['plan_reallydelete'] = 'Do you really want to delete the hostin
|
||||
$lng['admin']['notryfiles']['title'] = 'No autogenerated try_files';
|
||||
$lng['admin']['notryfiles']['description'] = 'Say yes here if you want to specify a custom try_files directive in specialsettings (needed for some wordpress plugins for example).';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Override FPM-daemon settings (pm, max_children, etc.)';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="red">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="text-danger">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
|
||||
$lng['panel']['backuppath']['title'] = 'Destination path for the backup';
|
||||
$lng['panel']['backuppath']['description'] = 'This is the path where the backups will be stored. If backup of web-data is selected, all files from the homedir are stored excluding the backup-folder specified here.';
|
||||
|
||||
@@ -2041,7 +2041,7 @@ $lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD';
|
||||
$lng['serversettings']['enable_api']['title'] = 'Enable external API usage';
|
||||
$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
|
||||
$lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)';
|
||||
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/ssl/webserver/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
|
||||
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/ssl/webserver/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <code>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096</code>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
|
||||
$lng['2fa']['2fa'] = '2FA options';
|
||||
$lng['2fa']['2fa_enabled'] = 'Activate Two-factor authentication (2FA)';
|
||||
$lng['login']['2fa'] = 'Two-factor authentication (2FA)';
|
||||
@@ -2066,7 +2066,7 @@ $lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted th
|
||||
$lng['panel']['alternative_cmdline_config'] = 'Alternatively, just run the following command as root-user in your shell to configure the services automatically';
|
||||
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database';
|
||||
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%';
|
||||
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
|
||||
$lng['admin']['novhostcontainer'] = '<br><br><small class="text-danger">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
|
||||
$lng['serversettings']['errorlog_level']['title'] = 'Error log-level';
|
||||
$lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.';
|
||||
$lng['serversettings']['letsencryptecc']['title'] = "Issue ECC / ECDSA certificate";
|
||||
|
||||
@@ -317,7 +317,7 @@ $lng['admin']['templates']['USERNAME'] = 'Wird mit dem Benutzernamen des neuen K
|
||||
$lng['admin']['templates']['PASSWORD'] = 'Wird mit dem Passwort des neuen Kundenkontos ersetzt.';
|
||||
$lng['admin']['templates']['EMAIL'] = 'Wird mit der Adresse des neuen E-Mail-Kontos ersetzt.';
|
||||
$lng['admin']['templates']['CUSTOMER_NO'] = 'Wir mit der Kunden-Nummer ersetzt';
|
||||
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">WARNUNG:</strong> Bei der Verwendung einer Zonendatei müssen alle benötigten Records aller Subdomains ebenfalls manuell verwaltet werden.';
|
||||
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="text-danger">WARNUNG:</strong> Bei der Verwendung einer Zonendatei müssen alle benötigten Records aller Subdomains ebenfalls manuell verwaltet werden.';
|
||||
|
||||
/**
|
||||
* Serversettings
|
||||
@@ -406,7 +406,7 @@ $lng['admin']['ipsandports']['add'] = 'IP-Adresse/Port hinzufügen';
|
||||
$lng['admin']['ipsandports']['edit'] = 'IP-Adresse/Port bearbeiten';
|
||||
$lng['admin']['ipsandports']['ipandport'] = 'IP-Adresse/Port';
|
||||
$lng['admin']['ipsandports']['ip'] = 'IP-Adresse';
|
||||
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Hinweis: Obwohl private IP Adressen erlaubt sind, kann es bei manchen Features wie DNS zu ungewolltem Verhalten kommen.<br>Verwende private Adressen nur wenn du sicher bist.</div>';
|
||||
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="text-danger">Hinweis: Obwohl private IP Adressen erlaubt sind, kann es bei manchen Features wie DNS zu ungewolltem Verhalten kommen.<br>Verwende private Adressen nur wenn du sicher bist.</div>';
|
||||
$lng['admin']['ipsandports']['port'] = 'Port';
|
||||
|
||||
// ADDED IN 1.2.13-rc3
|
||||
@@ -593,7 +593,7 @@ $lng['admin']['domain_nocustomeraddingavailable'] = 'Es können derzeit keine Do
|
||||
// ADDED IN 1.2.19-svn
|
||||
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Konfigurations-Verzeichnis';
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Wo sollen alle Konfigurationsdateien von fcgid liegen? Wenn Sie keine selbst kompilierte suexec Binary benutzen, was in der Regel der Fall ist, muss dieser Pfad unter /var/www/ liegen.<br /><br /><div class="red">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
|
||||
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Wo sollen alle Konfigurationsdateien von fcgid liegen? Wenn Sie keine selbst kompilierte suexec Binary benutzen, was in der Regel der Fall ist, muss dieser Pfad unter /var/www/ liegen.<br /><br /><div class="text-danger">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
|
||||
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Temporäres Verzeichnis';
|
||||
|
||||
// ADDED IN 1.2.19-svn4
|
||||
@@ -704,7 +704,7 @@ $lng['admin']['caneditphpsettings'] = 'Kann PHP-bezogene Domaineinstellungen vor
|
||||
$lng['admin']['allips'] = 'Alle IP-Adressen';
|
||||
$lng['panel']['nosslipsavailable'] = 'Für diesen Server wurden noch keine SSL IP/Port Kombinationen eingetragen';
|
||||
$lng['dkim']['use_dkim']['title'] = 'DKIM-Support aktivieren?';
|
||||
$lng['dkim']['use_dkim']['description'] = 'Wollen Sie das Domain-Keys-System (DKIM) benutzen?<br/><em class="red">Hinweis: Derzeit wird DKIM nur via dkim-filter unterstützt, nicht opendkim.</em>';
|
||||
$lng['dkim']['use_dkim']['description'] = 'Wollen Sie das Domain-Keys-System (DKIM) benutzen?<br/><em class="text-danger">Hinweis: Derzeit wird DKIM nur via dkim-filter unterstützt, nicht opendkim.</em>';
|
||||
$lng['error']['invalidmysqlhost'] = 'Ungültige MySQL-Host-Adresse: "%s"';
|
||||
$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'Webalizer und AWstats können nicht zur gleichen Zeit aktiviert werden, bitte wählen Sie eines aus.';
|
||||
$lng['serversettings']['webalizer_enabled'] = 'Nutze Webalizer-Statistiken';
|
||||
@@ -1038,12 +1038,12 @@ $lng['serversettings']['defaultttl'] = 'Domain TTL für Bind in Sekunden (defaul
|
||||
// ADDED IN FROXLOR 0.9.6-svn3
|
||||
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Verwende Standard-Fehlerdokumente für alle Kunden';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'Datei/URL für Fehler 401';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Nicht unterstützt in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Nicht unterstützt in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'Datei/URL für Fehler 403';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Nicht unterstützt in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Nicht unterstützt in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'Datei/URL für Fehler 404';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'Datei/URL für Fehler 500';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Nicht unterstützt in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Nicht unterstützt in: lighttpd</div>';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.6-svn5
|
||||
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Voreingestellte PHP-Konfiguration für neue Domains';
|
||||
@@ -1057,7 +1057,7 @@ $lng['serversettings']['ftpserver']['desc'] = 'Wenn pureftpd ausgewählt ist, we
|
||||
$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'Neuer FTP-Benutzer erstellt';
|
||||
$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hallo {CUST_NAME},\n\ndu hast gerade einen neuen FTP-Benutzer angelegt. Hier die angegebenen Informationen:\n\nBenutzername: {USR_NAME}\nPasswort: {USR_PASS}\nPfad: {USR_PATH}\n\nVielen Dank, Ihr Administrator";
|
||||
$lng['domains']['redirectifpathisurl'] = 'Redirect-Code (Standard: leer)';
|
||||
$lng['domains']['redirectifpathisurlinfo'] = 'Der Redirect-Code kann gewählt werden, wenn der eingegebene Pfad eine URL ist.<br/><strong class="red">HINWEIS:</strong>Änderungen werden nur wirksam wenn der Pfad eine URL ist.';
|
||||
$lng['domains']['redirectifpathisurlinfo'] = 'Der Redirect-Code kann gewählt werden, wenn der eingegebene Pfad eine URL ist.<br/><strong class="text-danger">HINWEIS:</strong>Änderungen werden nur wirksam wenn der Pfad eine URL ist.';
|
||||
$lng['serversettings']['customredirect_enabled']['title'] = 'Erlaube Kunden-Redirect';
|
||||
$lng['serversettings']['customredirect_enabled']['description'] = 'Erlaubt es Kunden den HTTP-Status Code für einen Redirect zu wählen';
|
||||
$lng['serversettings']['customredirect_default']['title'] = 'Standard-Redirect';
|
||||
@@ -1161,7 +1161,7 @@ $lng['error']['intvaluetoolow'] = 'Die angegebene Zahl ist zu klein (Feld "%s")'
|
||||
$lng['error']['intvaluetoohigh'] = 'Die angegebene Zahl ist zu groß (Feld "%s")';
|
||||
$lng['admin']['phpfpm_settings'] = 'PHP-FPM';
|
||||
$lng['serversettings']['phpfpm']['title'] = 'Aktiviere PHP-FPM';
|
||||
$lng['serversettings']['phpfpm']['description'] = '<b>Dies benötigt eine spezielle Webserver-Konfiguration, siehe FPM-Handbuch für <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> oder <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
|
||||
$lng['serversettings']['phpfpm']['description'] = '<b>Dies benötigt eine spezielle Webserver-Konfiguration, siehe <a target="_blank" href="https://docs.froxlor.org/general/configuration/php-fpm.html">PHP-FPM Handbuch</a></b>';
|
||||
$lng['serversettings']['phpfpm_settings']['configdir'] = 'Pfad zu php-fpm-Konfigurationen';
|
||||
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Alias-Ordner der php-fpm Konfiguration';
|
||||
$lng['serversettings']['phpfpm_settings']['reload'] = 'Kommando zum Neustarten von php-fpm';
|
||||
@@ -1292,7 +1292,7 @@ $lng['serversettings']['catchall_enabled']['description'] = 'Möchten Sie Ihren
|
||||
|
||||
// ADDED IN 0.9.28.svn6
|
||||
$lng['serversettings']['apache_24']['title'] = 'Anpassungen für Apache 2.4 verwenden';
|
||||
$lng['serversettings']['apache_24']['description'] = '<div class="red">Achtung: Bitte nur verwenden, wenn wirklich Apache mit Version 2.4 oder höher installiert ist, ansonsten wird der Webserver nicht starten.</div>';
|
||||
$lng['serversettings']['apache_24']['description'] = '<div class="text-danger">Achtung: Bitte nur verwenden, wenn wirklich Apache mit Version 2.4 oder höher installiert ist, ansonsten wird der Webserver nicht starten.</div>';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Pfad zur fastcgi_params Datei';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Geben Sie den Pfad zu nginx\'s fastcgi_params Datei an. Inklusive Dateiname!';
|
||||
|
||||
@@ -1338,13 +1338,13 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'Der angegebene Key (Private
|
||||
$lng['error']['sslcertificateinvalidca'] = 'Das angegebene CA-Zertifikat scheint nicht gültig zu sein.';
|
||||
$lng['error']['sslcertificateinvalidchain'] = 'Das angegebene CertificateChainFile scheint nicht gültig zu sein.';
|
||||
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver-Kunden-SSL-Zertifikatsverzeichnis';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Wo sollen kundenspezifizierte SSL-Zertifikate erstellt werden?<br /><br /><div class="red">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Wo sollen kundenspezifizierte SSL-Zertifikate erstellt werden?<br /><br /><div class="text-danger">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
|
||||
$lng['admin']['phpfpm.ininote'] = 'Nicht alle gewünschten Werte können in der php-fpm-pool-Konfiguration verwendet werden.';
|
||||
|
||||
// Added in Froxlor 0.9.30
|
||||
$lng['crondesc']['cron_mailboxsize'] = 'Berechnung der Mailbox-Größen';
|
||||
$lng['domains']['ipandport_multi']['title'] = 'IP-Adresse(n)';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Definieren Sie eine oder mehrere IP-Adresse(n) für diese Domain.<br /><br /><div class="red">Hinweis: Die IP-Adressen können nicht geändert werden, sollte die Domain als <strong>Alias-Domain</strong> für eine andere Domain konfiguriert worden sein.</div>';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Definieren Sie eine oder mehrere IP-Adresse(n) für diese Domain.<br /><br /><div class="text-danger">Hinweis: Die IP-Adressen können nicht geändert werden, sollte die Domain als <strong>Alias-Domain</strong> für eine andere Domain konfiguriert worden sein.</div>';
|
||||
$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL-IP-Adresse(n)';
|
||||
$lng['domains']['ssl_redirect']['title'] = 'SSL-Weiterleitung';
|
||||
$lng['domains']['ssl_redirect']['description'] = 'Diese Option erstellt für alle Nicht-SSL-vHosts eine Weiterleitung (Redirect), so dass alle Anfragen an den SSL-vHost übermittelt werden (z. B. würde eine Anfrage an <strong>http</strong>://domain.tld/ weitergeleitet werden zu <strong>https</strong>://domain.tld/).';
|
||||
@@ -1427,7 +1427,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Befehl zum Ausfü
|
||||
$lng['error']['cannotdeletehostnamephpconfig'] = 'Diese PHP-Konfiguration ist dem Froxlor-Vhost zugewiesen und kann daher nicht gelöscht werden.';
|
||||
$lng['error']['cannotdeletedefaultphpconfig'] = 'Diese PHP-Konfiguration ist als Standard hinterlegt und kann daher nicht gelöscht werden.';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Erlaube automatische Datenbank-Aktualisierungen';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<strong class="red">WARNUNG:</strong> Diese Einstellung erlaubt es dem Cronjob die Prüfung der Dateien- und Datenbank-Version zu umgehen und bei einem Versions-Unterschied die Datenbank-Aktualisierungen automatisiert auszuführen.<br /><br/><div class="red">Das automatische Update setzt für neue Einstellungen und Änderungen immer die default-Werte. Diese müssen nicht zwingend zu dem genutzten System passen. Bitte zwei mal nachdenken, bevor diese Option aktiviert wird.</div>';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<strong class="text-danger">WARNUNG:</strong> Diese Einstellung erlaubt es dem Cronjob die Prüfung der Dateien- und Datenbank-Version zu umgehen und bei einem Versions-Unterschied die Datenbank-Aktualisierungen automatisiert auszuführen.<br /><br/><div class="text-danger">Das automatische Update setzt für neue Einstellungen und Änderungen immer die default-Werte. Diese müssen nicht zwingend zu dem genutzten System passen. Bitte zwei mal nachdenken, bevor diese Option aktiviert wird.</div>';
|
||||
$lng['error']['passwordshouldnotbeusername'] = 'Das Passwort sollte nicht mit dem Benutzernamen übereinstimmen.';
|
||||
|
||||
// Added in Froxlor 0.9.33
|
||||
@@ -1446,7 +1446,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
|
||||
$lng['serversettings']['panel_password_special_char']['title'] = 'Sonderzeichen-Liste';
|
||||
$lng['serversettings']['panel_password_special_char']['description'] = 'Mindestens eines dieser Sonderzeichen muss in dem Passwort vorkommen, sofern die Sonderzeichen-Option aktiviert ist.';
|
||||
$lng['phpfpm']['use_mod_proxy']['title'] = 'Verwende mod_proxy / mod_proxy_fcgi';
|
||||
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Muss gesetzt sein bei Debian 9.x (Stretch) oder neuer</strong>. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus';
|
||||
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="text-danger">Muss gesetzt sein bei Debian 9.x (Stretch) oder neuer</strong>. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus';
|
||||
$lng['error']['no_phpinfo'] = 'Entschuldigung, es ist nicht möglich die phpinfo() auszulesen.';
|
||||
|
||||
$lng['admin']['movetoadmin'] = 'Kunde verschieben';
|
||||
@@ -1468,10 +1468,10 @@ $lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID und PHP-FPM können nicht
|
||||
|
||||
// Added in Froxlor 0.9.34
|
||||
$lng['admin']['configfiles']['legend'] = '<h3>Sie konfigurieren nun einen Service/Daemon.</h3>';
|
||||
$lng['admin']['configfiles']['commands'] = '<span class="red">Kommandos:</span> Die angezeigten Befehle müssen als Benutzer root in einer Shell ausgeführt werden. Es kann auch problemlos der ganze Block kopiert und in die Shell eingefügt werden.';
|
||||
$lng['admin']['configfiles']['files'] = '<span class="red">Konfigurationsdateien:</span> Der Befehl direkt vor dem Textfeld sollte einen Editor mit der Zieldatei öffnen. Der Inhalt kann nun einfach kopiert und in den Editor eingefügt und die Datei gespeichert werden.<br><span class="red">Bitte beachten:</span> Das MySQL-Passwort wurde aus Sicherheitsgründen nicht ersetzt. Bitte ersetzen Sie "FROXLOR_MYSQL_PASSWORD" manuell oder nutzen Sie das folgende Formular, um es temporär auf dieser Seite zu setzen. Falls das Passwort vergessen wurde, findet es sich in der Datei "lib/userdata.inc.php".';
|
||||
$lng['admin']['configfiles']['commands'] = '<span class="text-danger">Kommandos:</span> Die angezeigten Befehle müssen als Benutzer root in einer Shell ausgeführt werden. Es kann auch problemlos der ganze Block kopiert und in die Shell eingefügt werden.';
|
||||
$lng['admin']['configfiles']['files'] = '<span class="text-danger">Konfigurationsdateien:</span> Der Befehl direkt vor dem Textfeld sollte einen Editor mit der Zieldatei öffnen. Der Inhalt kann nun einfach kopiert und in den Editor eingefügt und die Datei gespeichert werden.<br><span class="text-danger">Bitte beachten:</span> Das MySQL-Passwort wurde aus Sicherheitsgründen nicht ersetzt. Bitte ersetzen Sie "FROXLOR_MYSQL_PASSWORD" manuell oder nutzen Sie das folgende Formular, um es temporär auf dieser Seite zu setzen. Falls das Passwort vergessen wurde, findet es sich in der Datei "lib/userdata.inc.php".';
|
||||
$lng['serversettings']['apache_itksupport']['title'] = 'Anpassungen für Apache ITK-MPM verwenden';
|
||||
$lng['serversettings']['apache_itksupport']['description'] = '<div class="red">Achtung: Bitte nur verwenden, wenn wirklich Apache itk-mpm verwendet wird, ansonsten wird der Webserver nicht starten.</div>';
|
||||
$lng['serversettings']['apache_itksupport']['description'] = '<div class="text-danger">Achtung: Bitte nur verwenden, wenn wirklich Apache itk-mpm verwendet wird, ansonsten wird der Webserver nicht starten.</div>';
|
||||
$lng['integrity_check']['databaseCharset'] = 'Characterset der Datenbank (sollte UTF-8 sein)';
|
||||
$lng['integrity_check']['domainIpTable'] = 'IP <‐> Domain Verknüpfung';
|
||||
$lng['integrity_check']['subdomainSslRedirect'] = 'Falsches SSL-redirect Flag bei nicht-SSL Domains';
|
||||
@@ -1482,7 +1482,7 @@ $lng['admin']['mod_fcgid_umask']['title'] = 'Umask (Standard: 022)';
|
||||
|
||||
// Added for let's encrypt
|
||||
$lng['admin']['letsencrypt']['title'] = 'SSL Zertifikat erstellen (Let\'s Encrypt)';
|
||||
$lng['admin']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von <a href="https://letsencrypt.org">Let\'s Encrypt</a>. Das Zertifikat wird automatisch erstellt und verlängert.<br><strong class="red">ACHTUNG:</strong> Wenn Wildcards aktiviert sind, wird diese Option automatisch deaktiviert.';
|
||||
$lng['admin']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von <a href="https://letsencrypt.org">Let\'s Encrypt</a>. Das Zertifikat wird automatisch erstellt und verlängert.<br><strong class="text-danger">ACHTUNG:</strong> Wenn Wildcards aktiviert sind, wird diese Option automatisch deaktiviert.';
|
||||
$lng['customer']['letsencrypt']['title'] = 'SSL Zertifikat erstellen (Let\'s Encrypt)';
|
||||
$lng['customer']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von <a href="https://letsencrypt.org">Let\'s Encrypt</a>. Das Zertifikat wird automatisch erstellt und verlängert.';
|
||||
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Die Nutzung von Let\'s Encrypt ist nur möglich, wenn die Domain mindestens eine IP/Port - Kombination mit aktiviertem SSL zugewiesen hat.';
|
||||
@@ -1585,7 +1585,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Wählen
|
||||
|
||||
// Added in froxlor 0.9.38-rc1
|
||||
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Erlaube Kunden für FTP Benutzer eine Shell auszuwählen';
|
||||
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Bitte beachten: Shell Zugriff gestattet dem Benutzer verschiedene Programme auf Ihrem System auszuführen. Mit großer Vorsicht verwenden. Bitte aktiviere dies nur wenn WIRKLICH bekannt ist, was das bedeutet!!!</strong>';
|
||||
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="text-danger">Bitte beachten: Shell Zugriff gestattet dem Benutzer verschiedene Programme auf Ihrem System auszuführen. Mit großer Vorsicht verwenden. Bitte aktiviere dies nur wenn WIRKLICH bekannt ist, was das bedeutet!!!</strong>';
|
||||
$lng['serversettings']['available_shells']['title'] = 'Liste der verfügbaren Shells';
|
||||
$lng['serversettings']['available_shells']['description'] = 'Komma-getrennte Liste von Shells, die der Kunde für seine FTP-Konten wählen kann.<br><br>Hinweis: Die Standard-Shell <strong>/bin/false</strong> wird immer eine Auswahlmöglichkeit sein (wenn aktiviert), auch wenn diese Einstellung leer ist. Sie ist in jedem Fall der Standardwert für alle FTP-Konten';
|
||||
$lng['serversettings']['le_froxlor_enabled']['title'] = "Let's Encrypt für den froxlor Vhost verwenden";
|
||||
@@ -1593,8 +1593,8 @@ $lng['serversettings']['le_froxlor_enabled']['description'] = "Wenn dies aktivie
|
||||
$lng['serversettings']['le_froxlor_redirect']['title'] = "SSL-Weiterleitung für den froxlor Vhost aktivieren";
|
||||
$lng['serversettings']['le_froxlor_redirect']['description'] = "Wenn dies aktiviert ist, werden alle HTTP Anfragen an die entsprechende SSL Seite weitergeleitet.";
|
||||
$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost Einstellungen';
|
||||
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="red">Nur verfügbar für: %s</em>';
|
||||
$lng['serversettings']['option_unavailable'] = '<br><em class="red">Option aufgrund anderer Einstellungen nicht verfügbar.</em>';
|
||||
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="text-danger">Nur verfügbar für: %s</em>';
|
||||
$lng['serversettings']['option_unavailable'] = '<br><em class="text-danger">Option aufgrund anderer Einstellungen nicht verfügbar.</em>';
|
||||
$lng['serversettings']['letsencryptacmeconf']['title'] = "Pfad zu acme.conf";
|
||||
$lng['serversettings']['letsencryptacmeconf']['description'] = "Dateiname der Konfiguration, die dem Webserver erlaubt, die ACME-Challenges zu bedienen.";
|
||||
$lng['admin']['hostname'] = 'Hostname';
|
||||
@@ -1619,18 +1619,18 @@ $lng['admin']['domain_hsts_preload']['title'] = 'Füge Domain in die <a href="ht
|
||||
$lng['admin']['domain_hsts_preload']['description'] = 'Wenn die Domain in die HSTS preload Liste, verwaltet von Chrome (und genutzt von Firefox und Safari), hinzugefügt werden soll, dann aktivieren Sie diese Einstellung.<br>Die preload-Direktive zu senden kann PERMANTENTE KONSEQUENZEN haben und dazu führen, dass Benutzer auf diese Domain und auch Subdomains nicht zugreifen können.<br>Beachten Sie die Details unter <a href="https://hstspreload.appspot.com/#removal" target="_blank">hstspreload.appspot.com/#removal</a> bevor ein Header mit "preload" gesendet wird.';
|
||||
|
||||
$lng['serversettings']['http2_support']['title'] = 'HTTP2 Unterstützung';
|
||||
$lng['serversettings']['http2_support']['description'] = 'Aktiviere HTTP2 Unterstützung für SSL.<br><em class="red">NUR AKTIVIEREN, WENN DER WEBSERVER DIESE FUNKTION UNTERSTÜTZT (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
|
||||
$lng['serversettings']['http2_support']['description'] = 'Aktiviere HTTP2 Unterstützung für SSL.<br><em class="text-danger">NUR AKTIVIEREN, WENN DER WEBSERVER DIESE FUNKTION UNTERSTÜTZT (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
|
||||
|
||||
$lng['error']['noipportgiven'] = 'Keine IP/Port angegeben';
|
||||
|
||||
// Added in froxlor 0.9.38.8
|
||||
$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling';
|
||||
$lng['admin']['domain_ocsp_stapling']['description'] = 'Siehe <a target="_blank" href="https://de.wikipedia.org/wiki/Online_Certificate_Status_Protocol_stapling">Wikipedia</a> für eine ausführliche Beschreibung von OCSP-Stapling';
|
||||
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="red">WARNUNG:</strong> Nginx unterstützt OCSP-Stapling erst ab Version 1.3.7. Wenn Ihre Version älter ist, wird der Webserver bei aktiviertem OCSP-Stapling NICHT korrekt starten.';
|
||||
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="text-danger">WARNUNG:</strong> Nginx unterstützt OCSP-Stapling erst ab Version 1.3.7. Wenn Ihre Version älter ist, wird der Webserver bei aktiviertem OCSP-Stapling NICHT korrekt starten.';
|
||||
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: Pfad zum OCSP-Stapling-Cache';
|
||||
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Konfiguriert den Cache-Pfad zum Zwischenspeichern der OCSP-Antworten,<br />die an TLS-Handshakes angehängt werden.';
|
||||
$lng['serversettings']['nssextrausers']['title'] = 'Verwende libnss-extrausers anstatt libnss-mysql';
|
||||
$lng['serversettings']['nssextrausers']['description'] = 'Lese Benutzer nicht direkt aus der Datenbank sondern über Dateien. Bitte nur aktivieren, wenn die entsprechende Konfiguration vorgenommen wurde (System -> libnss-extrausers).<br><strong class="red">Nur für Debian/Ubuntu (oder wenn libnss-extrausers manuell kompiliert wurde!)</strong>';
|
||||
$lng['serversettings']['nssextrausers']['description'] = 'Lese Benutzer nicht direkt aus der Datenbank sondern über Dateien. Bitte nur aktivieren, wenn die entsprechende Konfiguration vorgenommen wurde (System -> libnss-extrausers).<br><strong class="text-danger">Nur für Debian/Ubuntu (oder wenn libnss-extrausers manuell kompiliert wurde!)</strong>';
|
||||
$lng['admin']['domain_http2']['title'] = 'HTTP2 Unterstützung';
|
||||
$lng['admin']['domain_http2']['description'] = 'Siehe <a target="_blank" href="https://de.wikipedia.org/wiki/Hypertext_Transfer_Protocol#HTTP.2F2">Wikipedia</a> für eine ausführliche Beschreibung von HTTP2';
|
||||
$lng['admin']['testmail'] = 'SMTP Test';
|
||||
@@ -1669,7 +1669,7 @@ $lng['question']['plan_reallydelete'] = 'Wollen Sie den Hosting-Plan "%s" wirkli
|
||||
$lng['admin']['notryfiles']['title'] = 'Keine generierte try_files Anweisung';
|
||||
$lng['admin']['notryfiles']['description'] = 'Wählen Sie "Ja", wenn eine eigene try_files Direktive in den "eigenen Vhost Einstellungen" angegeben werden soll (z.B. nötig für manche Wordpress Plugins).';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Überschreibe FPM-Daemon Einstellungen (pm, max_children, etc.)';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="red">Nur verwendet wenn "Überschreibe FPM-Daemon Einstellungen" auf "Ja" gestellt ist</span>';
|
||||
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="text-danger">Nur verwendet wenn "Überschreibe FPM-Daemon Einstellungen" auf "Ja" gestellt ist</span>';
|
||||
$lng['panel']['backuppath']['title'] = 'Pfad zur Ablage der Backups';
|
||||
$lng['panel']['backuppath']['description'] = 'In diesem Ordner werden die Backups abgelegt. Wenn das Sichern von Web-Daten aktiviert ist, werden alle Dateien aus dem Heimatverzeichnis gesichert, exklusive des hier angegebenen Backup-Ordners.';
|
||||
|
||||
@@ -1687,7 +1687,7 @@ $lng['apikeys']['valid_until_help'] = 'Datum Gültigkeitsende, Format JJJJ-MM-TT
|
||||
$lng['serversettings']['enable_api']['title'] = 'Aktiviere externe API Nutzung';
|
||||
$lng['serversettings']['enable_api']['description'] = 'Um die froxlor API nutzen zu können, muss diese Option aktiviert sein. Für detaillierte Informationen siehe <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
|
||||
$lng['serversettings']['dhparams_file']['title'] = 'DHParams Datei (Diffie–Hellman key exchange)';
|
||||
$lng['serversettings']['dhparams_file']['description'] = 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.<br>Beispiel: /etc/ssl/webserver/dhparams.pem<br><br>Existiert die Datei nicht, wird sie wie folgt erstellt: <em>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096<em>. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.';
|
||||
$lng['serversettings']['dhparams_file']['description'] = 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.<br>Beispiel: /etc/ssl/webserver/dhparams.pem<br><br>Existiert die Datei nicht, wird sie wie folgt erstellt: <code>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096</code>. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.';
|
||||
$lng['2fa']['2fa'] = '2FA Optionen';
|
||||
$lng['2fa']['2fa_enabled'] = 'Aktiviere Zwei-Faktor Authentifizierung (2FA)';
|
||||
$lng['login']['2fa'] = 'Zwei-Faktor Authentifizierung (2FA)';
|
||||
@@ -1712,7 +1712,7 @@ $lng['panel']['settings_before_configuration'] = 'Stelle sicher, dass die Einste
|
||||
$lng['panel']['alternative_cmdline_config'] = 'Alternativ, führe den folgenden Befehl als root-Benutzer auf der Shell aus, um die Dienste automatisch zu konfigurieren.';
|
||||
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Lösche Domain %domain% von PowerDNS Datenbank';
|
||||
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Lösche SSL Dateien von Domain %domain%';
|
||||
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">Keine der IPs und Ports hat die Option "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" aktiviert, einige Einstellungen sind daher nicht verfügbar.</small>';
|
||||
$lng['admin']['novhostcontainer'] = '<br><br><small class="text-danger">Keine der IPs und Ports hat die Option "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" aktiviert, einige Einstellungen sind daher nicht verfügbar.</small>';
|
||||
$lng['serversettings']['errorlog_level']['title'] = 'Ausführlichkeit des Fehlerprotokolls';
|
||||
$lng['serversettings']['errorlog_level']['description'] = 'Steuert die Ausführlichkeit des Fehlerprotokolls. Voreinstellung ist "warn" bei Apache und "error" bei Nginx.';
|
||||
$lng['serversettings']['letsencryptecc']['title'] = "ECC / ECDSA Zertifikate ausstellen";
|
||||
|
||||
@@ -974,12 +974,12 @@ $lng['serversettings']['defaultttl'] = 'Dominio TTL per impegnare in secondi (pr
|
||||
// ADDED IN FROXLOR 0.9.6-svn3
|
||||
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Abilita errordocuments in automatico per tutti i clienti';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL per l\'errore 401';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Non supportato in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Non supportato in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL per l\'errore 403';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Non supportato in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Non supportato in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL per l\'errore 404';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL per l\'errore 500';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Non supportato in: lighttpd</div>';
|
||||
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Non supportato in: lighttpd</div>';
|
||||
|
||||
// ADDED IN FROXLOR 0.9.6-svn5
|
||||
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Configurazione di default di PHP per i nuovi domini';
|
||||
@@ -1227,7 +1227,7 @@ $lng['admin']['store_defaultindex'] = 'Archivio del file indice predefinito al p
|
||||
$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Percorso al file catena dei certificati SSL';
|
||||
$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Principalmente Bundle CA, o similare, presubilmente vuoi impostare questo se hai acquistato un certificato SSL.';
|
||||
$lng['serversettings']['phpfpm']['title'] = 'Abilita php-fpm';
|
||||
$lng['serversettings']['phpfpm']['description'] = '<b>Questa impostazione richiede una configurazione speciale del server web. Vedi il manuale FPM per <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> o <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
|
||||
$lng['serversettings']['phpfpm']['description'] = '<b>Questa impostazione richiede una configurazione speciale del server web. Vedi il <a target="_blank" href="https://docs.froxlor.org/general/configuration/php-fpm.html">manuale PHP-FPM</a></b>';
|
||||
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configurazione cartella Alias per php-fpm';
|
||||
$lng['gender']['title'] = 'Titolo';
|
||||
$lng['gender']['male'] = 'Sig.';
|
||||
@@ -1512,7 +1512,7 @@ $lng['error']['featureisdisabled'] = 'Funzionalità %s è disabilitata. Perfavor
|
||||
$lng['serversettings']['catchall_enabled']['title'] = 'Usa Catchall';
|
||||
$lng['serversettings']['catchall_enabled']['description'] = 'Vuoi offrire ai tuoi clienti la funzionalità di catchall?';
|
||||
$lng['serversettings']['apache_24']['title'] = 'Usa impostazioni per Apache 2.4';
|
||||
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENZIONE:</strong> spunta soltanto se hai installato la versione 2.4 o superiore di Apache<br />altrimenti il tuo server Web non si avvierà';
|
||||
$lng['serversettings']['apache_24']['description'] = '<strong class="text-danger">ATTENZIONE:</strong> spunta soltanto se hai installato la versione 2.4 o superiore di Apache<br />altrimenti il tuo server Web non si avvierà';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Percorso al file fastcgi_params';
|
||||
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specifica il percorso al file fastcgi_params di nginx includendo il nome del file';
|
||||
$lng['serversettings']['documentroot_use_default_value']['title'] = 'Usa il nome del dominio come valore predefinito per il percorso DocumentRoot (radice dei documenti)';
|
||||
@@ -1547,11 +1547,11 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'La chiave privata fornita n
|
||||
$lng['error']['sslcertificateinvalidca'] = 'Il certificato CA fornito non sembra essere un certificato valido';
|
||||
$lng['error']['sslcertificateinvalidchain'] = 'I dati della catena di certificato non sembrano essere un certificato valido';
|
||||
$lng['serversettings']['customerssl_directory']['title'] = 'Cartella dei certificati ssl clienti del Webserver';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Dove devono esssere creati i certificati ssl cliente?<br /><br /><div class="red">NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.</div>';
|
||||
$lng['serversettings']['customerssl_directory']['description'] = 'Dove devono esssere creati i certificati ssl cliente?<br /><br /><div class="text-danger">NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.</div>';
|
||||
$lng['admin']['phpfpm.ininote'] = 'Non tutti i valori che potresti volere settare possono essere usati nella configurazione del pool php-fpm.';
|
||||
$lng['crondesc']['cron_mailboxsize'] = 'Calcolo dimensioni caselle di posta';
|
||||
$lng['domains']['ipandport_multi']['title'] = 'Indirizzi IP';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Specifica uno o più indirizzi IP per il dominio.<br /><br /><div class="red">NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come <strong>alias-domain</strong> di un altro dominio.</div>';
|
||||
$lng['domains']['ipandport_multi']['description'] = 'Specifica uno o più indirizzi IP per il dominio.<br /><br /><div class="text-danger">NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come <strong>alias-domain</strong> di un altro dominio.</div>';
|
||||
$lng['domains']['ipandport_ssl_multi']['title'] = 'Indirizzi IP SSL';
|
||||
$lng['domains']['ssl_redirect']['title'] = 'Reindirizzamento SSL';
|
||||
$lng['domains']['ssl_redirect']['description'] = 'Questa opzione crea un reindirizzamento per vhosts non-sll in modo che tutte le richieste vengono reindirizzate ai SSL-vhost.<br /><br />praticamente una richiesta a <strong>http</strong>://dominio.tld/ ti reindirizzera a <strong>https</strong>://dominio.tld/';
|
||||
@@ -1632,7 +1632,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Commando per eseg
|
||||
$lng['error']['cannotdeletehostnamephpconfig'] = 'Questa configurazione PHP è utilizzata dal vhost Froxlor e non può essere eliminata.';
|
||||
$lng['error']['cannotdeletedefaultphpconfig'] = 'Questa configurazione PHP è impostata come predefinita e non può essere eliminata.';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Permetti aggiornamenti automatici del database';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENZIONE:</b></div> Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.<br><br><div class="red">l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione</div>';
|
||||
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="text-danger"><b>ATTENZIONE:</b></div> Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.<br><br><div class="text-danger">l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione</div>';
|
||||
$lng['error']['passwordshouldnotbeusername'] = 'La password deve essere diversa dal nome utente.';
|
||||
$lng['admin']['customer_show_news_feed'] = "Mostra feed di notizie personalizzati sul cruscotto dei clienti";
|
||||
$lng['admin']['customer_news_feed_url'] = "Feed RSS- per il feed di notizie personalizzato";
|
||||
|
||||
Reference in New Issue
Block a user