maketank/Froxlor
2
0
Fork 0
Code Pull Requests Releases Activity

beginning of rework/redesign of settings

Browse Source 
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
This commit is contained in:
Michael Kaufmann
2022-02-27 14:34:05 +01:00
parent c48a22a58e
commit ab5ffc7545
33 changed files with 655 additions and 670 deletions
Download Patch File Download Diff File Expand all files Collapse all files

108
lng/czech.lng.php
View File

@@ -318,7 +318,7 @@ $lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account
$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.';
$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number';
$lng['admin']['webserver'] = 'Webový server';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="text-danger">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
/**
* Serversettings
@@ -408,7 +408,7 @@ $lng['admin']['ipsandports']['add'] = 'Přidat IP/Port';
$lng['admin']['ipsandports']['edit'] = 'Upravit IP/Port';
$lng['admin']['ipsandports']['ipandport'] = 'IP/Port';
$lng['admin']['ipsandports']['ip'] = 'IP';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="text-danger">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
$lng['admin']['ipsandports']['port'] = 'Port';
// ADDED IN 1.2.13-rc3
@@ -596,7 +596,7 @@ $lng['error']['norepymailiswrong'] = 'The "Noreply-address" is wrong. Only a val
// ADDED IN 1.2.19-svn1
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Konfigurace adresářů';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/<br /><br /><div class="red">POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.</div>';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/<br /><br /><div class="text-danger">POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.</div>';
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Dočasný adresář';
// ADDED IN 1.2.19-svn4
@@ -705,7 +705,7 @@ $lng['admin']['caneditphpsettings'] = 'Může změnit doménové nastavení spoj
$lng['admin']['allips'] = 'Všechny IP';
$lng['panel']['nosslipsavailable'] = 'Momentálně zde nejsou žádné ssl ip/port kombinace pro tento server';
$lng['dkim']['use_dkim']['title'] = 'Aktivovat DKIM podporu?';
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="red">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="text-danger">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
$lng['error']['invalidmysqlhost'] = 'Invalid MySQL host address: %s';
$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'You cannot enable Webalizer and AWstats at the same time, please chose one of them';
$lng['serversettings']['webalizer_enabled'] = 'Povolit webalizer statistiky';
@@ -1043,12 +1043,12 @@ $lng['serversettings']['defaultttl'] = 'Domain TTL for bind in seconds (default
// ADDED IN FROXLOR 0.9.6-svn3
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Enable default errordocuments for all customers';
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL for error 401';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL for error 403';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL for error 404';
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL for error 500';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
// ADDED IN FROXLOR 0.9.6-svn5
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Default PHP configuration for new domains';
@@ -1062,7 +1062,7 @@ $lng['serversettings']['ftpserver']['desc'] = 'If pureftpd is selected the .ftpq
$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'New ftp-user created';
$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nyou have just added a new ftp-user. Here is the entered information:\n\nUsername: {USR_NAME}\nPassword: {USR_PASS}\nPath: {USR_PATH}\n\nYours sincerely, your administrator";
$lng['domains']['redirectifpathisurl'] = 'Redirect code (default: empty)';
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="red">NOTE:</strong>Changes are only applied if the given path is an URL.';
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="text-danger">NOTE:</strong>Changes are only applied if the given path is an URL.';
$lng['serversettings']['customredirect_enabled']['title'] = 'Allow customer redirects';
$lng['serversettings']['customredirect_enabled']['description'] = 'Allow customers to choose the http-status code for redirects which will be used';
$lng['serversettings']['customredirect_default']['title'] = 'Default redirect';
@@ -1142,64 +1142,14 @@ $lng['admin']['templates']['PMA_URI'] = 'Odkaz k phpMyAdmin (pokud je postytnut)
$lng['admin']['notgiven'] = '[not given]';
$lng['admin']['templates']['USR_NAME'] = 'FTP uživatelské jméno';
$lng['admin']['templates']['USR_PASS'] = 'FTP heslo';
$lng['admin']['templates']['USR_PATH'] = 'FTP homedir (relative to customer-docroot)';
// ADDED IN FROXLOR 0.9.12-svn4
$lng['serversettings']['awstats_awstatspath'] = 'Path to AWStats \'awstats.pl\'';
// ADDED IN FROXLOR 0.9.12-svn6
$lng['extras']['htpasswdauthname'] = 'Authentication reason (AuthName)';
$lng['extras']['directoryprotection_edit'] = 'edit directory protection';
$lng['admin']['templates']['forgotpwd'] = 'Notification-mails for password-reset';
$lng['admin']['templates']['password_reset'] = 'Customer-notification for passwort-reset';
$lng['admin']['store_defaultindex'] = 'Store default index-file to customers docroot';
// ADDED IN FROXLOR 0.9.14
$lng['serversettings']['mod_fcgid']['defaultini_ownvhost'] = 'Default PHP configuration for Froxlor-vHost';
$lng['serversettings']['awstats_icons']['title'] = 'Path to AWstats icons folder';
$lng['serversettings']['awstats_icons']['description'] = 'e.g. /usr/share/awstats/htdocs/icon/';
$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Path to the SSL CertificateChainFile';
$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
$lng['admin']['ipsandports']['docroot']['title'] = 'Custom docroot (empty = point to Froxlor)';
$lng['admin']['ipsandports']['docroot']['description'] = 'You can define a custom document-root (the destination for a request) for this ip/port combination here.<br /><strong>ATTENTION:</strong> Please be careful with what you enter here!';
$lng['serversettings']['login_domain_login'] = 'Allow login with domains';
$lng['panel']['unlock'] = 'Unlock';
$lng['question']['customer_reallyunlock'] = 'Do you really want to unlock customer %s?';
// ADDED IN FROXLOR 0.9.15
$lng['serversettings']['perl_server']['title'] = 'Perl umístění na serveru';
$lng['serversettings']['perl_server']['description'] = 'Default is set for using the guide found at: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
$lng['serversettings']['nginx_php_backend']['description'] = 'this is where the PHP process is listening for requests from nginx, can be a unix socket of ip:port combination<br />*NOT used with php-fpm';
$lng['serversettings']['phpreload_command']['title'] = 'PHP reload command';
$lng['serversettings']['phpreload_command']['description'] = 'this is used to reload the PHP backend if any is used<br />Default: blank<br />*NOT used with php-fpm';
// ADDED IN FROXLOR 0.9.16
$lng['error']['intvaluetoolow'] = 'Zadané číslo je přiliš malé (pole %s)';
$lng['error']['intvaluetoohigh'] = 'Zadané číslo je příliš vysoké (pole %s)';
$lng['admin']['phpfpm_settings'] = 'PHP-FPM';
$lng['serversettings']['phpfpm']['title'] = 'Zapnout php-fpm';
$lng['serversettings']['phpfpm']['description'] = '<b>This needs a special webserver configuration see FPM-handbook for <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> or <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
$lng['serversettings']['phpfpm_settings']['configdir'] = 'Configuration directory of php-fpm';
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configuration Alias-directory of php-fpm';
$lng['serversettings']['phpfpm_settings']['reload'] = 'php-fpm restart command';
$lng['serversettings']['phpfpm_settings']['pm'] = 'Process manager control (pm)';
$lng['serversettings']['phpfpm_settings']['max_children']['title'] = 'The number of child processes';
$lng['serversettings']['phpfpm_settings']['max_children']['description'] = 'The number of child processes to be created when pm is set to \'static\' and the maximum number of child processes to be created when pm is set to \'dynamic/ondemand\'<br />Equivalent to the PHP_FCGI_CHILDREN';
$lng['serversettings']['phpfpm_settings']['start_servers']['title'] = 'The number of child processes created on startup';
$lng['serversettings']['phpfpm_settings']['start_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'';
$lng['serversettings']['phpfpm_settings']['min_spare_servers']['title'] = 'The desired minimum number of idle server processes';
$lng['serversettings']['phpfpm_settings']['min_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'<br />Note: Mandatory when pm is set to \'dynamic\'';
$lng['serversettings']['phpfpm_settings']['max_spare_servers']['title'] = 'The desired maximum number of idle server processes';
$lng['serversettings']['phpfpm_settings']['max_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'<br />Note: Mandatory when pm is set to \'dynamic\'';
$lng['serversettings']['phpfpm_settings']['max_requests']['title'] = 'Requests per child before respawning';
$lng['serversettings']['phpfpm_settings']['max_requests']['description'] = 'For endless request processing specify \'0\'. Equivalent to PHP_FCGI_MAX_REQUESTS.';
$lng['error']['phpfpmstillenabled'] = 'PHP-FPM is currently active. Please deactivate it before activating FCGID';
$lng['error']['fcgidstillenabled'] = 'FCGID is currently active. Please deactivate it before activating PHP-FPM';
$lng['phpfpm']['vhost_httpuser'] = 'Local user to use for PHP-FPM (Froxlor vHost)';
$lng['phpfpm']['vhost_httpgroup'] = 'Local group to use for PHP-FPM (Froxlor vHost)';
$lng['phpfpm']['ownvhost']['title'] = 'Enable PHP-FPM for the Froxlor vHost';
$lng['phpfpm']['ownvhost']['description'] = 'If enabled, Froxlor will also be running under a local user';
// ADDED IN FROXLOR 0.9.17
$lng['crondesc']['cron_usage_report'] = 'Web- and traffic-reports';
@@ -1562,7 +1512,7 @@ $lng['serversettings']['catchall_enabled']['description'] = 'Do you want to prov
// ADDED IN 0.9.28.svn6
$lng['serversettings']['apache_24']['title'] = 'Použít modifikace pro Apache 2.4';
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
$lng['serversettings']['apache_24']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Path to fastcgi_params file';
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specify the path to nginx\'s fastcgi_params file including filename';
@@ -1606,13 +1556,13 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="text-danger">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
// Added in Froxlor 0.9.30
$lng['crondesc']['cron_mailboxsize'] = 'Calculating of mailbox-sizes';
$lng['domains']['ipandport_multi']['title'] = 'IP adresa(y)';
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="red">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="text-danger">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL IP adresa(y)';
$lng['domains']['ssl_redirect']['title'] = 'SSL přesměrování';
$lng['domains']['ssl_redirect']['description'] = 'This option creates redirects for non-ssl vhosts so that all requests are redirected to the SSL-vhost.<br /><br />e.g. a request to <strong>http</strong>://domain.tld/ will redirect you to <strong>https</strong>://domain.tld/';
@@ -1696,7 +1646,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Command to execut
$lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.';
$lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.';
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="red">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="text-danger"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="text-danger">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
$lng['error']['passwordshouldnotbeusername'] = 'The password should not be the same as the username.';
// Added in Froxlor 0.9.33
@@ -1715,7 +1665,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
$lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list';
$lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.';
$lng['phpfpm']['use_mod_proxy']['title'] = 'Použít mod_proxy / mod_proxy_fcgi';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="text-danger">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['error']['no_phpinfo'] = 'Omlouváme se, ale phpinfo() nelze načíst';
$lng['admin']['movetoadmin'] = 'Přesunout zákazníka';
@@ -1737,10 +1687,10 @@ $lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID and PHP-FPM cannot be act
// Added in Froxlor 0.9.34
$lng['admin']['configfiles']['legend'] = '<h3>You are about to configure a service/daemon</h3>';
$lng['admin']['configfiles']['commands'] = '<span class="red">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
$lng['admin']['configfiles']['files'] = '<span class="red">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="red">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
$lng['admin']['configfiles']['commands'] = '<span class="text-danger">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
$lng['admin']['configfiles']['files'] = '<span class="text-danger">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="text-danger">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
$lng['serversettings']['apache_itksupport']['title'] = 'Use modifications for Apache ITK-MPM';
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
$lng['integrity_check']['databaseCharset'] = 'Character set of database (should be UTF-8)';
$lng['integrity_check']['domainIpTable'] = 'IP &lt;&dash;&gt; domain references';
$lng['integrity_check']['subdomainSslRedirect'] = 'False SSL-redirect flag for non-ssl domains';
@@ -1823,9 +1773,9 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
// Added for let's encrypt
$lng['admin']['letsencrypt']['title'] = 'Používat Let\'s Encrypt';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> This feature is still in beta.';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> This feature is still in beta.';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely';
$lng['panel']['letsencrypt'] = 'Používá Let\'s encrypt';
@@ -1885,8 +1835,8 @@ $lng['crondesc']['cron_backup'] = 'Process backup jobs';
$lng['error']['backupfunctionnotenabled'] = 'The backup function is not enabled';
$lng['serversettings']['backupenabled']['title'] = "Povolit zálohy pro zákazníky";
$lng['serversettings']['backupenabled']['description'] = "If activated, the customer will be able to schedule backup jobs (cron-backup) which generates an archive within his docroot (subdirectory chosable by customer)";
$lng['extras']['path_protection_label'] = '<strong class="red">Important</strong>';
$lng['extras']['path_protection_info'] = '<strong class="red">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
$lng['extras']['path_protection_label'] = '<strong class="text-danger">Important</strong>';
$lng['extras']['path_protection_info'] = '<strong class="text-danger">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Backup job for customer %loginname%';
$lng['error']['dns_domain_nodns'] = 'DNS pro tuto doménu je vypnuto';
@@ -1926,7 +1876,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Select i
// Added in froxlor 0.9.38-rc1
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Please note: Shell access allows the user to execute various binaries on your system. Use with extreme caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="text-danger">Please note: Shell access allows the user to execute various binaries on your system. Use with extreme caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
$lng['serversettings']['available_shells']['title'] = 'List of available shells';
$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.<br><br>Note that the default shell <strong>/bin/false</strong> will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case';
$lng['panel']['shell'] = 'Shell';
@@ -1935,8 +1885,8 @@ $lng['serversettings']['le_froxlor_enabled']['description'] = "If activated, the
$lng['serversettings']['le_froxlor_redirect']['title'] = "Enable SSL-redirect for the froxlor vhost";
$lng['serversettings']['le_froxlor_redirect']['description'] = "If activated, all http requests to your froxlor will be redirected to the corresponding SSL site.";
$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost settings';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="red">Available only for: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="red">Option not available due to other settings.</em>';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="text-danger">Available only for: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="text-danger">Option not available due to other settings.</em>';
$lng['serversettings']['letsencryptacmeconf']['title'] = "Path to the acme.conf snippet";
$lng['serversettings']['letsencryptacmeconf']['description'] = "File name of the config snippet which allows the web server to serve the acme challenge.";
$lng['admin']['hostname'] = 'Hostname';
@@ -1961,18 +1911,18 @@ $lng['admin']['domain_hsts_preload']['title'] = 'Include domain in <a href="http
$lng['admin']['domain_hsts_preload']['description'] = 'If you would like this domain to be included in the HSTS preload list maintained by Chrome (and used by Firefox and Safari), then use activate this.<br>Sending the preload directive from your site can have PERMANENT CONSEQUENCES and prevent users from accessing your site and any of its subdomains.<br>Please read the details at <a href="https://hstspreload.appspot.com/#removal" target="_blank">hstspreload.appspot.com/#removal</a> before sending the header with "preload".';
$lng['serversettings']['http2_support']['title'] = 'HTTP2 Support';
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="red">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="text-danger">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['error']['noipportgiven'] = 'No IP/port given';
// Added in froxlor 0.9.38.8
$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling';
$lng['admin']['domain_ocsp_stapling']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/OCSP_stapling">Wikipedia</a> for a detailed explanation of OCSP stapling';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="red">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="text-danger">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: path to the OCSP stapling cache';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Configures the cache used to store OCSP responses which get included in TLS handshakes.';
$lng['serversettings']['nssextrausers']['title'] = 'Use libnss-extrausers instead of libnss-mysql';
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="red">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="text-danger">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
$lng['admin']['domain_http2']['title'] = 'HTTP2 support';
$lng['admin']['domain_http2']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/HTTP/2">Wikipedia</a> for a detailed explanation of HTTP2';
$lng['admin']['testmail'] = 'SMTP test';
@@ -2012,7 +1962,7 @@ $lng['question']['plan_reallydelete'] = 'Do you really want to delete the hostin
$lng['admin']['notryfiles']['title'] = 'No autogenerated try_files';
$lng['admin']['notryfiles']['description'] = 'Say yes here if you want to specify a custom try_files directive in specialsettings (needed for some wordpress plugins for example).';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Override FPM-daemon settings (pm, max_children, etc.)';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="red">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="text-danger">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
$lng['panel']['backuppath']['title'] = 'Destination path for the backup';
$lng['panel']['backuppath']['description'] = 'This is the path where the backups will be stored. If backup of web-data is selected, all files from the homedir are stored excluding the backup-folder specified here.';
@@ -2032,7 +1982,7 @@ $lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD';
$lng['serversettings']['enable_api']['title'] = 'Enable external API usage';
$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
$lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <code>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096</code>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['2fa']['2fa'] = '2FA možnosti';
$lng['2fa']['2fa_enabled'] = 'Aktivovat dvoufázové ověření (2FA)';
$lng['login']['2fa'] = 'Dvoufázové ověření (2FA)';
@@ -2057,7 +2007,7 @@ $lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted th
$lng['panel']['alternative_cmdline_config'] = 'Alternatively, just run the following command as root-user in your shell to configure the services automatically';
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database';
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%';
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
$lng['admin']['novhostcontainer'] = '<br><br><small class="text-danger">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
$lng['serversettings']['errorlog_level']['title'] = 'Error log-level';
$lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.';
$lng['serversettings']['letsencryptecc']['title'] = "Issue ECC / ECDSA certificate";