maketank/Froxlor
2
0
Fork 0
Code Pull Requests Releases Activity

beginning of rework/redesign of settings

Browse Source 
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
This commit is contained in:
Michael Kaufmann
2022-02-27 14:34:05 +01:00
parent c48a22a58e
commit ab5ffc7545
33 changed files with 655 additions and 670 deletions
Download Patch File Download Diff File Expand all files Collapse all files

93
actions/admin/settings/100.panel.php
View File

@@ -20,6 +20,7 @@ return array(
'groups' => array(
'panel' => array(
'title' => $lng['admin']['panelsettings'],
'icon' => 'fa-solid fa-chalkboard-user',
'fields' => array(
'panel_standardlanguage' => array(
'label' => array(
@@ -28,9 +29,8 @@ return array(
),
'settinggroup' => 'panel',
'varname' => 'standardlanguage',
'type' => 'option',
'type' => 'select',
'default' => 'English',
'option_mode' => 'one',
'option_options_method' => array(
'\\Froxlor\\User',
'getLanguages'
@@ -44,9 +44,8 @@ return array(
),
'settinggroup' => 'panel',
'varname' => 'default_theme',
'type' => 'option',
'default' => 'Sparkle',
'option_mode' => 'one',
'type' => 'select',
'default' => 'Froxlor',
'option_options_method' => array(
'\\Froxlor\\UI\\Template',
'getThemes'
@@ -57,7 +56,7 @@ return array(
'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_customer',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -65,7 +64,7 @@ return array(
'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_admin',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -73,7 +72,7 @@ return array(
'label' => $lng['serversettings']['natsorting'],
'settinggroup' => 'panel',
'varname' => 'natsorting',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -81,8 +80,8 @@ return array(
'label' => $lng['serversettings']['paging'],
'settinggroup' => 'panel',
'varname' => 'paging',
'type' => 'int',
'int_min' => 0,
'type' => 'number',
'min' => 0,
'default' => 0,
'save_method' => 'storeSettingField'
),
@@ -90,22 +89,20 @@ return array(
'label' => $lng['serversettings']['pathedit'],
'settinggroup' => 'panel',
'varname' => 'pathedit',
'type' => 'option',
'type' => 'select',
'default' => 'Manual',
'option_mode' => 'one',
'option_options' => array(
'select_var' => [
'Manual' => $lng['serversettings']['manual'],
'Dropdown' => $lng['serversettings']['dropdown']
),
],
'save_method' => 'storeSettingField'
),
'panel_adminmail' => array(
'label' => $lng['serversettings']['adminmail'],
'settinggroup' => 'panel',
'varname' => 'adminmail',
'type' => 'string',
'string_type' => 'mail',
'string_emptyallowed' => false,
'type' => 'email',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -113,7 +110,7 @@ return array(
'label' => $lng['serversettings']['adminmail_defname'],
'settinggroup' => 'panel',
'varname' => 'adminmail_defname',
'type' => 'string',
'type' => 'text',
'default' => 'Froxlor Administrator',
'save_method' => 'storeSettingField'
),
@@ -121,8 +118,7 @@ return array(
'label' => $lng['serversettings']['adminmail_return'],
'settinggroup' => 'panel',
'varname' => 'adminmail_return',
'type' => 'string',
'string_type' => 'mail',
'type' => 'email',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -131,9 +127,9 @@ return array(
'label' => $lng['serversettings']['decimal_places'],
'settinggroup' => 'panel',
'varname' => 'decimal_places',
'type' => 'int',
'int_min' => 0,
'int_max' => 15,
'type' => 'number',
'min' => 0,
'max' => 15,
'default' => 4,
'save_method' => 'storeSettingField'
),
@@ -141,8 +137,7 @@ return array(
'label' => $lng['serversettings']['phpmyadmin_url'],
'settinggroup' => 'panel',
'varname' => 'phpmyadmin_url',
'type' => 'string',
'string_type' => 'url',
'type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -151,8 +146,7 @@ return array(
'label' => $lng['serversettings']['webmail_url'],
'settinggroup' => 'panel',
'varname' => 'webmail_url',
'type' => 'string',
'string_type' => 'url',
'type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -161,8 +155,7 @@ return array(
'label' => $lng['serversettings']['webftp_url'],
'settinggroup' => 'panel',
'varname' => 'webftp_url',
'type' => 'string',
'string_type' => 'url',
'type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -171,7 +164,7 @@ return array(
'label' => $lng['admin']['show_version_login'],
'settinggroup' => 'admin',
'varname' => 'show_version_login',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -179,7 +172,7 @@ return array(
'label' => $lng['admin']['show_version_footer'],
'settinggroup' => 'admin',
'varname' => 'show_version_footer',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -187,7 +180,7 @@ return array(
'label' => $lng['admin']['show_news_feed'],
'settinggroup' => 'admin',
'varname' => 'show_news_feed',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -195,7 +188,7 @@ return array(
'label' => $lng['admin']['customer_show_news_feed'],
'settinggroup' => 'customer',
'varname' => 'show_news_feed',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -203,8 +196,7 @@ return array(
'label' => $lng['admin']['customer_news_feed_url'],
'settinggroup' => 'customer',
'varname' => 'news_feed_url',
'type' => 'string',
'string_type' => 'url',
'type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -213,7 +205,7 @@ return array(
'label' => $lng['serversettings']['panel_allow_domain_change_admin'],
'settinggroup' => 'panel',
'varname' => 'allow_domain_change_admin',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -221,7 +213,7 @@ return array(
'label' => $lng['serversettings']['panel_allow_domain_change_customer'],
'settinggroup' => 'panel',
'varname' => 'allow_domain_change_customer',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -229,7 +221,7 @@ return array(
'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
'settinggroup' => 'panel',
'varname' => 'phpconfigs_hidestdsubdomain',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -237,11 +229,11 @@ return array(
'label' => $lng['serversettings']['panel_customer_hide_options'],
'settinggroup' => 'panel',
'varname' => 'customer_hide_options',
'type' => 'option',
'type' => 'select',
'default' => '',
'option_mode' => 'multiple',
'select_mode' => 'multiple',
'option_emptyallowed' => true,
'option_options' => array(
'select_var' => [
'email' => $lng['menue']['email']['email'],
'mysql' => $lng['menue']['mysql']['mysql'],
'domains' => $lng['menue']['domains']['domains'],
@@ -255,15 +247,14 @@ return array(
'traffic.http' => $lng['menue']['traffic']['traffic'] . " / HTTP",
'traffic.ftp' => $lng['menue']['traffic']['traffic'] . " / FTP",
'traffic.mail' => $lng['menue']['traffic']['traffic'] . " / Mail"
),
],
'save_method' => 'storeSettingField'
),
'panel_imprint_url' => array(
'label' => $lng['serversettings']['imprint_url'],
'settinggroup' => 'panel',
'varname' => 'imprint_url',
'type' => 'string',
'string_type' => 'url',
'type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -272,8 +263,7 @@ return array(
'label' => $lng['serversettings']['terms_url'],
'settinggroup' => 'panel',
'varname' => 'terms_url',
'type' => 'string',
'string_type' => 'url',
'type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -282,8 +272,7 @@ return array(
'label' => $lng['serversettings']['privacy_url'],
'settinggroup' => 'panel',
'varname' => 'privacy_url',
'type' => 'string',
'string_type' => 'url',
'type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -292,7 +281,7 @@ return array(
'label' => $lng['serversettings']['logo_overridetheme'],
'settinggroup' => 'panel',
'varname' => 'logo_overridetheme',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -300,7 +289,7 @@ return array(
'label' => $lng['serversettings']['logo_overridecustom'],
'settinggroup' => 'panel',
'varname' => 'logo_overridecustom',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -321,10 +310,8 @@ return array(
'image_name' => 'logo_login',
'default' => '',
'save_method' => 'storeSettingImage'
),
)
)
)
)
);
?>

50
actions/admin/settings/110.accounts.php
View File

@@ -20,12 +20,14 @@ return array(
'groups' => array(
'accounts' => array(
'title' => $lng['admin']['accountsettings'],
'icon' => 'fa-solid fa-users-gear',
'fields' => array(
'session_sessiontimeout' => array(
'label' => $lng['serversettings']['session_timeout'],
'settinggroup' => 'session',
'varname' => 'sessiontimeout',
'type' => 'int',
'type' => 'number',
'min' => 60,
'default' => 600,
'save_method' => 'storeSettingField'
),
@@ -33,7 +35,7 @@ return array(
'label' => $lng['serversettings']['session_allow_multiple_login'],
'settinggroup' => 'session',
'varname' => 'allow_multiple_login',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -41,7 +43,7 @@ return array(
'label' => $lng['serversettings']['login_domain_login'],
'settinggroup' => 'login',
'varname' => 'domain_login',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -49,7 +51,8 @@ return array(
'label' => $lng['serversettings']['maxloginattempts'],
'settinggroup' => 'login',
'varname' => 'maxloginattempts',
'type' => 'int',
'type' => 'number',
'min' => 1,
'default' => 3,
'save_method' => 'storeSettingField'
),
@@ -57,7 +60,8 @@ return array(
'label' => $lng['serversettings']['deactivatetime'],
'settinggroup' => 'login',
'varname' => 'deactivatetime',
'type' => 'int',
'type' => 'number',
'min' => 0,
'default' => 900,
'save_method' => 'storeSettingField'
),
@@ -65,7 +69,7 @@ return array(
'label' => $lng['2fa']['2fa_enabled'],
'settinggroup' => '2fa',
'varname' => 'enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -73,7 +77,8 @@ return array(
'label' => $lng['serversettings']['panel_password_min_length'],
'settinggroup' => 'panel',
'varname' => 'password_min_length',
'type' => 'int',
'type' => 'number',
'min' => 0,
'default' => 0,
'save_method' => 'storeSettingField'
),
@@ -81,7 +86,7 @@ return array(
'label' => $lng['serversettings']['panel_password_alpha_lower'],
'settinggroup' => 'panel',
'varname' => 'password_alpha_lower',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -89,7 +94,7 @@ return array(
'label' => $lng['serversettings']['panel_password_alpha_upper'],
'settinggroup' => 'panel',
'varname' => 'password_alpha_upper',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -97,7 +102,7 @@ return array(
'label' => $lng['serversettings']['panel_password_numeric'],
'settinggroup' => 'panel',
'varname' => 'password_numeric',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -105,7 +110,7 @@ return array(
'label' => $lng['serversettings']['panel_password_special_char_required'],
'settinggroup' => 'panel',
'varname' => 'password_special_char_required',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -113,7 +118,7 @@ return array(
'label' => $lng['serversettings']['panel_password_special_char'],
'settinggroup' => 'panel',
'varname' => 'password_special_char',
'type' => 'string',
'type' => 'text',
'default' => '!?<>§$%+#=@',
'save_method' => 'storeSettingField'
),
@@ -121,7 +126,7 @@ return array(
'label' => $lng['serversettings']['panel_password_regex'],
'settinggroup' => 'panel',
'varname' => 'password_regex',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -129,7 +134,7 @@ return array(
'label' => $lng['serversettings']['accountprefix'],
'settinggroup' => 'customer',
'varname' => 'accountprefix',
'type' => 'string',
'type' => 'text',
'default' => '',
'plausibility_check_method' => array(
'\\Froxlor\\Validate\\Check',
@@ -141,7 +146,7 @@ return array(
'label' => $lng['serversettings']['mysqlprefix'],
'settinggroup' => 'customer',
'varname' => 'mysqlprefix',
'type' => 'string',
'type' => 'text',
'default' => '',
'plausibility_check_method' => array(
'\\Froxlor\\Validate\\Check',
@@ -153,7 +158,7 @@ return array(
'label' => $lng['serversettings']['ftpprefix'],
'settinggroup' => 'customer',
'varname' => 'ftpprefix',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -161,7 +166,7 @@ return array(
'label' => $lng['serversettings']['ftpdomain'],
'settinggroup' => 'customer',
'varname' => 'ftpatdomain',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -169,7 +174,7 @@ return array(
'label' => $lng['serversettings']['allow_password_reset'],
'settinggroup' => 'panel',
'varname' => 'allow_preset',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'dependency' => array(
@@ -185,7 +190,7 @@ return array(
'label' => $lng['serversettings']['allow_password_reset_admin'],
'settinggroup' => 'panel',
'varname' => 'allow_preset_admin',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'dependency' => array(
@@ -201,7 +206,7 @@ return array(
'label' => $lng['serversettings']['backupenabled'],
'settinggroup' => 'system',
'varname' => 'backupenabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'cronmodule' => 'froxlor/backup',
'save_method' => 'storeSettingField'
@@ -210,10 +215,9 @@ return array(
'label' => $lng['serversettings']['createstdsubdom_default'],
'settinggroup' => 'system',
'varname' => 'createstdsubdom_default',
'type' => 'option',
'type' => 'select',
'default' => '1',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'0' => $lng['panel']['no'],
'1' => $lng['panel']['yes']
),

75
actions/admin/settings/120.system.php
View File

@@ -20,12 +20,13 @@ return array(
'groups' => array(
'system' => array(
'title' => $lng['admin']['systemsettings'],
'icon' => 'fa-solid fa-gears',
'fields' => array(
'system_documentroot_prefix' => array(
'label' => $lng['serversettings']['documentroot_prefix'],
'settinggroup' => 'system',
'varname' => 'documentroot_prefix',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/var/customers/webs/',
'save_method' => 'storeSettingField',
@@ -38,7 +39,7 @@ return array(
'label' => $lng['serversettings']['documentroot_use_default_value'],
'settinggroup' => 'system',
'varname' => 'documentroot_use_default_value',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -46,8 +47,7 @@ return array(
'label' => $lng['serversettings']['ipaddress'],
'settinggroup' => 'system',
'varname' => 'ipaddress',
'type' => 'option',
'option_mode' => 'one',
'type' => 'select',
'option_options_method' => array(
'\\Froxlor\\Domain\\IpAddr',
'getIpAddresses'
@@ -59,8 +59,8 @@ return array(
'label' => $lng['serversettings']['defaultip'],
'settinggroup' => 'system',
'varname' => 'defaultip',
'type' => 'option',
'option_mode' => 'multiple',
'type' => 'select',
'select_mode' => 'multiple',
'option_options_method' => array(
'\\Froxlor\\Domain\\IpAddr',
'getIpPortCombinations'
@@ -72,8 +72,8 @@ return array(
'label' => $lng['serversettings']['defaultsslip'],
'settinggroup' => 'system',
'varname' => 'defaultsslip',
'type' => 'option',
'option_mode' => 'multiple',
'type' => 'select',
'select_mode' => 'multiple',
'option_options_method' => array(
'\\Froxlor\\Domain\\IpAddr',
'getSslIpPortCombinations'
@@ -85,7 +85,7 @@ return array(
'label' => $lng['serversettings']['hostname'],
'settinggroup' => 'system',
'varname' => 'hostname',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingHostname',
'plausibility_check_method' => array(
@@ -97,7 +97,7 @@ return array(
'label' => $lng['serversettings']['enable_api'],
'settinggroup' => 'api',
'varname' => 'enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -105,7 +105,7 @@ return array(
'label' => $lng['serversettings']['validate_domain'],
'settinggroup' => 'system',
'varname' => 'validate_domain',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -113,7 +113,7 @@ return array(
'label' => $lng['serversettings']['stdsubdomainhost'],
'settinggroup' => 'system',
'varname' => 'stdsubdomain',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingHostname'
),
@@ -121,7 +121,7 @@ return array(
'label' => $lng['serversettings']['mysql_access_host'],
'settinggroup' => 'system',
'varname' => 'mysql_access_host',
'type' => 'string',
'type' => 'text',
'default' => '127.0.0.1,localhost',
'plausibility_check_method' => array(
'\\Froxlor\\Validate\\Check',
@@ -133,7 +133,7 @@ return array(
'label' => $lng['serversettings']['nssextrausers'],
'settinggroup' => 'system',
'varname' => 'nssextrausers',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -141,7 +141,7 @@ return array(
'label' => $lng['serversettings']['index_file_extension'],
'settinggroup' => 'system',
'varname' => 'index_file_extension',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^[a-zA-Z0-9]{1,6}$/',
'default' => 'html',
'save_method' => 'storeSettingField'
@@ -150,7 +150,7 @@ return array(
'label' => $lng['serversettings']['system_store_index_file_subs'],
'settinggroup' => 'system',
'varname' => 'store_index_file_subs',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -170,7 +170,7 @@ return array(
'label' => $lng['serversettings']['report']['report'],
'settinggroup' => 'system',
'varname' => 'report_enable',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'cronmodule' => 'froxlor/reports',
'save_method' => 'storeSettingField'
@@ -179,9 +179,9 @@ return array(
'label' => $lng['serversettings']['report']['webmax'],
'settinggroup' => 'system',
'varname' => 'report_webmax',
'type' => 'int',
'int_min' => 0,
'int_max' => 150,
'type' => 'number',
'min' => 0,
'max' => 150,
'default' => 90,
'save_method' => 'storeSettingField'
),
@@ -189,9 +189,9 @@ return array(
'label' => $lng['serversettings']['report']['trafficmax'],
'settinggroup' => 'system',
'varname' => 'report_trafficmax',
'type' => 'int',
'int_min' => 0,
'int_max' => 150,
'type' => 'number',
'min' => 0,
'max' => 150,
'default' => 90,
'save_method' => 'storeSettingField'
),
@@ -200,7 +200,7 @@ return array(
'label' => $lng['serversettings']['mail_use_smtp'],
'settinggroup' => 'system',
'varname' => 'mail_use_smtp',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -208,7 +208,7 @@ return array(
'label' => $lng['serversettings']['mail_smtp_host'],
'settinggroup' => 'system',
'varname' => 'mail_smtp_host',
'type' => 'string',
'type' => 'text',
'default' => 'localhost',
'save_method' => 'storeSettingField'
),
@@ -216,9 +216,9 @@ return array(
'label' => $lng['serversettings']['mail_smtp_port'],
'settinggroup' => 'system',
'varname' => 'mail_smtp_port',
'type' => 'int',
'int_min' => 1,
'int_max' => 65535,
'type' => 'number',
'min' => 1,
'max' => 65535,
'default' => 25,
'save_method' => 'storeSettingField'
),
@@ -226,7 +226,7 @@ return array(
'label' => $lng['serversettings']['mail_smtp_usetls'],
'settinggroup' => 'system',
'varname' => 'mail_smtp_usetls',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -234,7 +234,7 @@ return array(
'label' => $lng['serversettings']['mail_smtp_auth'],
'settinggroup' => 'system',
'varname' => 'mail_smtp_auth',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -242,7 +242,7 @@ return array(
'label' => $lng['serversettings']['mail_smtp_user'],
'settinggroup' => 'system',
'varname' => 'mail_smtp_user',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -250,7 +250,7 @@ return array(
'label' => $lng['serversettings']['mail_smtp_passwd'],
'settinggroup' => 'system',
'varname' => 'mail_smtp_passwd',
'type' => 'hiddenString',
'type' => 'password',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -258,7 +258,7 @@ return array(
'label' => $lng['serversettings']['apply_specialsettings_default'],
'settinggroup' => 'system',
'varname' => 'apply_specialsettings_default',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -266,7 +266,7 @@ return array(
'label' => $lng['serversettings']['apply_phpconfigs_default'],
'settinggroup' => 'system',
'varname' => 'apply_phpconfigs_default',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -274,10 +274,9 @@ return array(
'label' => $lng['admin']['domaindefaultalias'],
'settinggroup' => 'system',
'varname' => 'domaindefaultalias',
'type' => 'option',
'type' => 'select',
'default' => '0',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'0' => $lng['domains']['serveraliasoption_wildcard'],
'1' => $lng['domains']['serveraliasoption_www'],
'2' => $lng['domains']['serveraliasoption_none']
@@ -288,7 +287,7 @@ return array(
'label' => $lng['serversettings']['hide_incompatible_settings'],
'settinggroup' => 'system',
'varname' => 'hide_incompatible_settings',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),

43
actions/admin/settings/122.froxlorvhost.php
View File

@@ -18,6 +18,7 @@ return array(
'groups' => array(
'froxlorvhost' => array(
'title' => $lng['admin']['froxlorvhost'] . (call_user_func(array('\Froxlor\Settings\FroxlorVhostSettings', 'hasVhostContainerEnabled')) == false ? $lng['admin']['novhostcontainer'] : ''),
'icon' => 'fa-solid fa-wrench',
'fields' => array(
/**
* Webserver-Vhost
@@ -26,7 +27,7 @@ return array(
'label' => $lng['serversettings']['froxlordirectlyviahostname'],
'settinggroup' => 'system',
'varname' => 'froxlordirectlyviahostname',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -34,7 +35,7 @@ return array(
'label' => $lng['serversettings']['froxloraliases'],
'settinggroup' => 'system',
'varname' => 'froxloraliases',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^(([a-z0-9\-\._]+, ?)*[a-z0-9\-\._]+)?$/i',
'string_emptyallowed' => true,
'default' => '',
@@ -47,7 +48,7 @@ return array(
'label' => $lng['serversettings']['le_froxlor_enabled'],
'settinggroup' => 'system',
'varname' => 'le_froxlor_enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingClearCertificates',
'visible' => \Froxlor\Settings::Get('system.leenabled') && call_user_func(array(
@@ -59,7 +60,7 @@ return array(
'label' => $lng['serversettings']['le_froxlor_redirect'],
'settinggroup' => 'system',
'varname' => 'le_froxlor_redirect',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
@@ -71,9 +72,9 @@ return array(
'label' => $lng['admin']['domain_hsts_maxage'],
'settinggroup' => 'system',
'varname' => 'hsts_maxage',
'type' => 'int',
'int_min' => 0,
'int_max' => 94608000, // 3-years
'type' => 'number',
'min' => 0,
'max' => 94608000, // 3-years
'default' => 0,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
@@ -85,7 +86,7 @@ return array(
'label' => $lng['admin']['domain_hsts_incsub'],
'settinggroup' => 'system',
'varname' => 'hsts_incsub',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
@@ -97,7 +98,7 @@ return array(
'label' => $lng['admin']['domain_hsts_preload'],
'settinggroup' => 'system',
'varname' => 'hsts_preload',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
@@ -109,7 +110,7 @@ return array(
'label' => $lng['admin']['domain_honorcipherorder'],
'settinggroup' => 'system',
'varname' => 'honorcipherorder',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
@@ -121,7 +122,7 @@ return array(
'label' => $lng['admin']['domain_sessiontickets'],
'settinggroup' => 'system',
'varname' => 'sessiontickets',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
@@ -136,7 +137,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid_ownvhost'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_ownvhost',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -151,7 +152,7 @@ return array(
'label' => $lng['admin']['mod_fcgid_user'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_httpuser',
'type' => 'string',
'type' => 'text',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingWebserverFcgidFpmUser',
'websrv_avail' => array(
@@ -166,7 +167,7 @@ return array(
'label' => $lng['admin']['mod_fcgid_group'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_httpgroup',
'type' => 'string',
'type' => 'text',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -181,9 +182,8 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_defaultini_ownvhost',
'type' => 'option',
'type' => 'select',
'default' => '2',
'option_mode' => 'one',
'option_options_method' => array(
'\\Froxlor\\Http\\PhpConfig',
'getPhpConfigs'
@@ -204,7 +204,7 @@ return array(
'label' => $lng['phpfpm']['ownvhost'],
'settinggroup' => 'phpfpm',
'varname' => 'enabled_ownvhost',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('phpfpm.enabled') && call_user_func(array(
@@ -216,7 +216,7 @@ return array(
'label' => $lng['phpfpm']['vhost_httpuser'],
'settinggroup' => 'phpfpm',
'varname' => 'vhost_httpuser',
'type' => 'string',
'type' => 'text',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingWebserverFcgidFpmUser',
'visible' => \Froxlor\Settings::Get('phpfpm.enabled') && call_user_func(array(
@@ -228,7 +228,7 @@ return array(
'label' => $lng['phpfpm']['vhost_httpgroup'],
'settinggroup' => 'phpfpm',
'varname' => 'vhost_httpgroup',
'type' => 'string',
'type' => 'text',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('phpfpm.enabled') && call_user_func(array(
@@ -240,9 +240,8 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
'settinggroup' => 'phpfpm',
'varname' => 'vhost_defaultini',
'type' => 'option',
'type' => 'select',
'default' => '2',
'option_mode' => 'one',
'option_options_method' => array(
'\\Froxlor\\Http\\PhpConfig',
'getPhpConfigs'
@@ -260,7 +259,7 @@ return array(
'label' => $lng['serversettings']['dns_createhostnameentry'],
'settinggroup' => 'system',
'varname' => 'dns_createhostnameentry',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.bind_enable')

11
actions/admin/settings/125.cronjob.php
View File

@@ -18,12 +18,13 @@ return array(
'groups' => array(
'crond' => array(
'title' => $lng['admin']['cronsettings'],
'icon' => 'fa-solid fa-clock-rotate-left',
'fields' => array(
'system_cronconfig' => array(
'label' => $lng['serversettings']['system_cronconfig'],
'settinggroup' => 'system',
'varname' => 'cronconfig',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'default' => '/etc/cron.d/froxlor',
'save_method' => 'storeSettingField'
@@ -32,7 +33,7 @@ return array(
'label' => $lng['serversettings']['system_croncmdline'],
'settinggroup' => 'system',
'varname' => 'croncmdline',
'type' => 'string',
'type' => 'text',
'default' => '/usr/bin/nice -n 5 /usr/bin/php -q',
'save_method' => 'storeSettingField'
),
@@ -40,7 +41,7 @@ return array(
'label' => $lng['serversettings']['system_crondreload'],
'settinggroup' => 'system',
'varname' => 'crondreload',
'type' => 'string',
'type' => 'text',
'default' => '/etc/init.d/cron reload',
'save_method' => 'storeSettingField'
),
@@ -48,7 +49,7 @@ return array(
'label' => $lng['serversettings']['system_cron_allowautoupdate'],
'settinggroup' => 'system',
'varname' => 'cron_allowautoupdate',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -56,7 +57,7 @@ return array(
'label' => $lng['serversettings']['cron']['debug'],
'settinggroup' => 'system',
'varname' => 'debug_cron',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
)

80
actions/admin/settings/130.webserver.php
View File

@@ -20,15 +20,15 @@ return array(
'groups' => array(
'webserver' => array(
'title' => $lng['admin']['webserversettings'],
'icon' => 'fa-solid fa-server',
'fields' => array(
'system_webserver' => array(
'label' => $lng['admin']['webserver'],
'settinggroup' => 'system',
'varname' => 'webserver',
'type' => 'option',
'type' => 'select',
'default' => 'apache2',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'apache2' => 'Apache 2',
'lighttpd' => 'ligHTTPd',
'nginx' => 'Nginx'
@@ -44,7 +44,7 @@ return array(
'label' => $lng['serversettings']['apache_24'],
'settinggroup' => 'system',
'varname' => 'apache24',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -55,7 +55,7 @@ return array(
'label' => $lng['serversettings']['apache_itksupport'],
'settinggroup' => 'system',
'varname' => 'apacheitksupport',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'visible' => (\Froxlor\Settings::Get('system.mod_fcgid') == 0 && \Froxlor\Settings::Get('phpfpm.enabled') == 0),
@@ -67,7 +67,7 @@ return array(
'label' => $lng['serversettings']['http2_support'],
'settinggroup' => 'system',
'varname' => 'http2_support',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -80,7 +80,7 @@ return array(
'label' => $lng['serversettings']['dhparams_file'],
'settinggroup' => 'system',
'varname' => 'dhparams_file',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
@@ -91,7 +91,7 @@ return array(
'label' => $lng['admin']['webserver_user'],
'settinggroup' => 'system',
'varname' => 'httpuser',
'type' => 'string',
'type' => 'text',
'default' => 'www-data',
'save_method' => 'storeSettingWebserverFcgidFpmUser'
),
@@ -99,7 +99,7 @@ return array(
'label' => $lng['admin']['webserver_group'],
'settinggroup' => 'system',
'varname' => 'httpgroup',
'type' => 'string',
'type' => 'text',
'default' => 'www-data',
'save_method' => 'storeSettingField'
),
@@ -107,7 +107,7 @@ return array(
'label' => $lng['serversettings']['apacheconf_vhost'],
'settinggroup' => 'system',
'varname' => 'apacheconf_vhost',
'type' => 'string',
'type' => 'text',
'string_type' => 'filedir',
'default' => '/etc/apache2/sites-enabled/',
'save_method' => 'storeSettingField'
@@ -116,7 +116,7 @@ return array(
'label' => $lng['serversettings']['apacheconf_diroptions'],
'settinggroup' => 'system',
'varname' => 'apacheconf_diroptions',
'type' => 'string',
'type' => 'text',
'string_type' => 'filedir',
'default' => '/etc/apache2/sites-enabled/',
'save_method' => 'storeSettingField'
@@ -125,7 +125,7 @@ return array(
'label' => $lng['serversettings']['apacheconf_htpasswddir'],
'settinggroup' => 'system',
'varname' => 'apacheconf_htpasswddir',
'type' => 'string',
'type' => 'text',
'string_type' => 'confdir',
'default' => '/etc/apache2/htpasswd/',
'save_method' => 'storeSettingField'
@@ -134,7 +134,7 @@ return array(
'label' => $lng['serversettings']['logfiles_directory'],
'settinggroup' => 'system',
'varname' => 'logfiles_directory',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/var/customers/logs/',
'save_method' => 'storeSettingField'
@@ -143,8 +143,7 @@ return array(
'label' => $lng['serversettings']['logfiles_script'],
'settinggroup' => 'system',
'varname' => 'logfiles_script',
'type' => 'string',
'string_type' => '',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -155,7 +154,7 @@ return array(
'label' => $lng['serversettings']['logfiles_piped'],
'settinggroup' => 'system',
'varname' => 'logfiles_piped',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -166,7 +165,7 @@ return array(
'label' => $lng['serversettings']['logfiles_format'],
'settinggroup' => 'system',
'varname' => 'logfiles_format',
'type' => 'string',
'type' => 'text',
'default' => '',
'string_emptyallowed' => true,
'save_method' => 'storeSettingField',
@@ -180,10 +179,9 @@ return array(
'label' => $lng['serversettings']['logfiles_type'],
'settinggroup' => 'system',
'varname' => 'logfiles_type',
'type' => 'option',
'type' => 'select',
'default' => '1',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'1' => 'combined',
'2' => 'vhost_combined'
),
@@ -196,10 +194,9 @@ return array(
'label' => $lng['serversettings']['errorlog_level'],
'settinggroup' => 'system',
'varname' => 'errorlog_level',
'type' => 'option',
'type' => 'select',
'default' => (\Froxlor\Settings::Get('system.webserver') == 'nginx' ? 'error' : 'warn'),
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'emerg' => 'emerg',
'alert' => 'alert',
'crit' => 'crit',
@@ -219,7 +216,7 @@ return array(
'label' => $lng['serversettings']['customerssl_directory'],
'settinggroup' => 'system',
'varname' => 'customer_ssl_path',
'type' => 'string',
'type' => 'text',
'string_type' => 'confdir',
'default' => '/etc/ssl/froxlor-custom/',
'save_method' => 'storeSettingField'
@@ -228,7 +225,7 @@ return array(
'label' => $lng['serversettings']['phpappendopenbasedir'],
'settinggroup' => 'system',
'varname' => 'phpappendopenbasedir',
'type' => 'string',
'type' => 'text',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -237,7 +234,7 @@ return array(
'label' => $lng['serversettings']['deactivateddocroot'],
'settinggroup' => 'system',
'varname' => 'deactivateddocroot',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'string_emptyallowed' => true,
'default' => '',
@@ -247,7 +244,7 @@ return array(
'label' => $lng['serversettings']['default_vhostconf'],
'settinggroup' => 'system',
'varname' => 'default_vhostconf',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -255,7 +252,7 @@ return array(
'label' => $lng['serversettings']['default_sslvhostconf'],
'settinggroup' => 'system',
'varname' => 'default_sslvhostconf',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') == 1
@@ -264,7 +261,7 @@ return array(
'label' => $lng['serversettings']['includedefault_sslvhostconf'],
'settinggroup' => 'system',
'varname' => 'include_default_vhostconf',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -272,7 +269,7 @@ return array(
'label' => $lng['serversettings']['apache_globaldiropt'],
'settinggroup' => 'system',
'varname' => 'apacheglobaldiropt',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField',
'visible' => (\Froxlor\Settings::Get('system.mod_fcgid') == 0 && \Froxlor\Settings::Get('phpfpm.enabled') == 0),
@@ -284,7 +281,7 @@ return array(
'label' => $lng['serversettings']['apachereload_command'],
'settinggroup' => 'system',
'varname' => 'apachereload_command',
'type' => 'string',
'type' => 'text',
'default' => '/etc/init.d/apache2 reload',
'save_method' => 'storeSettingField'
),
@@ -292,7 +289,7 @@ return array(
'label' => $lng['serversettings']['phpreload_command'],
'settinggroup' => 'system',
'varname' => 'phpreload_command',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -303,7 +300,7 @@ return array(
'label' => $lng['serversettings']['nginx_php_backend'],
'settinggroup' => 'system',
'varname' => 'nginx_php_backend',
'type' => 'string',
'type' => 'text',
'default' => '127.0.0.1:8888',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -314,7 +311,7 @@ return array(
'label' => $lng['serversettings']['nginx_fastcgiparams'],
'settinggroup' => 'nginx',
'varname' => 'fastcgiparams',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'default' => '/etc/nginx/fastcgi_params',
'save_method' => 'storeSettingField',
@@ -326,7 +323,7 @@ return array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
'settinggroup' => 'defaultwebsrverrhandler',
'varname' => 'enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -334,7 +331,7 @@ return array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err401'],
'settinggroup' => 'defaultwebsrverrhandler',
'varname' => 'err401',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -346,7 +343,7 @@ return array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err403'],
'settinggroup' => 'defaultwebsrverrhandler',
'varname' => 'err403',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -358,7 +355,7 @@ return array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err404'],
'settinggroup' => 'defaultwebsrverrhandler',
'varname' => 'err404',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -366,7 +363,7 @@ return array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err500'],
'settinggroup' => 'defaultwebsrverrhandler',
'varname' => 'err500',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -378,7 +375,7 @@ return array(
'label' => $lng['serversettings']['customredirect_enabled'],
'settinggroup' => 'customredirect',
'varname' => 'enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -386,9 +383,8 @@ return array(
'label' => $lng['serversettings']['customredirect_default'],
'settinggroup' => 'customredirect',
'varname' => 'default',
'type' => 'option',
'type' => 'select',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => array('\\Froxlor\\Domain\\Domain', 'getRedirectCodes'),
'save_method' => 'storeSettingField'
)

58
actions/admin/settings/131.ssl.php
View File

@@ -20,12 +20,13 @@ return array(
'groups' => array(
'ssl' => array(
'title' => $lng['admin']['sslsettings'],
'icon' => 'fa-solid fa-shield',
'fields' => array(
'system_ssl_enabled' => array(
'label' => $lng['serversettings']['ssl']['use_ssl'],
'settinggroup' => 'system',
'varname' => 'use_ssl',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
@@ -34,10 +35,10 @@ return array(
'label' => $lng['serversettings']['ssl']['ssl_protocols'],
'settinggroup' => 'system',
'varname' => 'ssl_protocols',
'type' => 'option',
'type' => 'select',
'default' => 'TLSv1.2',
'option_mode' => 'multiple',
'option_options' => array(
'select_mode' => 'multiple',
'select_var' => array(
'TLSv1' => 'TLSv1',
'TLSv1.1' => 'TLSv1.1',
'TLSv1.2' => 'TLSv1.2',
@@ -49,7 +50,7 @@ return array(
'label' => $lng['serversettings']['ssl']['ssl_cipher_list'],
'settinggroup' => 'system',
'varname' => 'ssl_cipher_list',
'type' => 'string',
'type' => 'text',
'string_emptyallowed' => false,
'default' => 'ECDH+AESGCM:ECDH+AES256:!aNULL:!MD5:!DSS:!DH:!AES128',
'save_method' => 'storeSettingField'
@@ -58,7 +59,7 @@ return array(
'label' => $lng['serversettings']['ssl']['tlsv13_cipher_list'],
'settinggroup' => 'system',
'varname' => 'tlsv13_cipher_list',
'type' => 'string',
'type' => 'text',
'string_emptyallowed' => true,
'default' => '',
'visible' => \Froxlor\Settings::Get('system.webserver') == "apache2" && \Froxlor\Settings::Get('system.apache24') == 1,
@@ -68,7 +69,7 @@ return array(
'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_file',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.pem',
@@ -78,7 +79,7 @@ return array(
'label' => $lng['serversettings']['ssl']['ssl_key_file'],
'settinggroup' => 'system',
'varname' => 'ssl_key_file',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.key',
@@ -88,7 +89,7 @@ return array(
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_chainfile',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
@@ -98,7 +99,7 @@ return array(
'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
'settinggroup' => 'system',
'varname' => 'ssl_ca_file',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
@@ -108,8 +109,7 @@ return array(
'label' => $lng['serversettings']['ssl']['apache24_ocsp_cache_path'],
'settinggroup' => 'system',
'varname' => 'apache24_ocsp_cache_path',
'type' => 'string',
'string_type' => 'string',
'type' => 'text',
'string_emptyallowed' => false,
'default' => 'shmcb:/var/run/apache2/ocsp-stapling.cache(131072)',
'visible' => \Froxlor\Settings::Get('system.webserver') == "apache2" && \Froxlor\Settings::Get('system.apache24') == 1,
@@ -119,7 +119,7 @@ return array(
'label' => $lng['admin']['domain_sessionticketsenabled'],
'settinggroup' => 'system',
'varname' => 'sessionticketsenabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.use_ssl') && (\Froxlor\Settings::Get('system.webserver') == "nginx" || (\Froxlor\Settings::Get('system.webserver') == "apache2" && \Froxlor\Settings::Get('system.apache24') == 1))
@@ -128,7 +128,7 @@ return array(
'label' => $lng['serversettings']['leenabled'],
'settinggroup' => 'system',
'varname' => 'leenabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'cronmodule' => 'froxlor/letsencrypt',
'save_method' => 'storeSettingField'
@@ -137,7 +137,7 @@ return array(
'label' => $lng['serversettings']['acmeshpath'],
'settinggroup' => 'system',
'varname' => 'acmeshpath',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'default' => '/root/.acme.sh/acme.sh',
'save_method' => 'storeSettingField'
@@ -146,7 +146,7 @@ return array(
'label' => $lng['serversettings']['letsencryptacmeconf'],
'settinggroup' => 'system',
'varname' => 'letsencryptacmeconf',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'default' => '/etc/apache2/conf-enabled/acme.conf',
'save_method' => 'storeSettingField'
@@ -158,10 +158,9 @@ return array(
'label' => $lng['serversettings']['leapiversion'],
'settinggroup' => 'system',
'varname' => 'leapiversion',
'type' => 'option',
'type' => 'select',
'default' => '2',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'2' => 'ACME v2'
),
'save_method' => 'storeSettingField'
@@ -171,10 +170,9 @@ return array(
'label' => $lng['serversettings']['letsencryptca'],
'settinggroup' => 'system',
'varname' => 'letsencryptca',
'type' => 'option',
'type' => 'select',
'default' => 'letsencrypt',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'letsencrypt_test' => 'Let\'s Encrypt (Test / Staging)',
'letsencrypt' => 'Let\'s Encrypt (Live)',
'buypass_test' => 'Buypass (Test / Staging)',
@@ -187,7 +185,7 @@ return array(
'label' => $lng['serversettings']['letsencryptchallengepath'],
'settinggroup' => 'system',
'varname' => 'letsencryptchallengepath',
'type' => 'string',
'type' => 'text',
'string_emptyallowed' => false,
'default' => \Froxlor\Froxlor::getInstallDir(),
'save_method' => 'storeSettingField'
@@ -196,10 +194,9 @@ return array(
'label' => $lng['serversettings']['letsencryptkeysize'],
'settinggroup' => 'system',
'varname' => 'letsencryptkeysize',
'type' => 'option',
'type' => 'select',
'default' => '2048',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'2048' => '2048',
'3072' => '3072',
'4096' => '4096',
@@ -211,10 +208,9 @@ return array(
'label' => $lng['serversettings']['letsencryptecc'],
'settinggroup' => 'system',
'varname' => 'leecc',
'type' => 'option',
'type' => 'select',
'default' => '0',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'0' => '-',
'256' => 'ec-256',
'384' => 'ec-384'
@@ -225,7 +221,7 @@ return array(
'label' => $lng['serversettings']['letsencryptreuseold'],
'settinggroup' => 'system',
'varname' => 'letsencryptreuseold',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -233,7 +229,7 @@ return array(
'label' => $lng['serversettings']['le_domain_dnscheck'],
'settinggroup' => 'system',
'varname' => 'le_domain_dnscheck',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
)

25
actions/admin/settings/135.fcgid.php
View File

@@ -18,6 +18,7 @@ return array(
'groups' => array(
'fcgid' => array(
'title' => $lng['admin']['fcgid_settings'],
'icon' => 'fa-brands fa-php',
'websrv_avail' => array(
'apache2',
'lighttpd'
@@ -27,7 +28,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'plausibility_check_method' => array(
@@ -40,7 +41,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['configdir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_configdir',
'type' => 'string',
'type' => 'text',
'string_type' => 'confdir',
'default' => '/var/www/php-fcgi-scripts/',
'plausibility_check_method' => array(
@@ -53,7 +54,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_tmpdir',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/var/customers/tmp/',
'save_method' => 'storeSettingField'
@@ -62,7 +63,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['peardir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_peardir',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'string_delimiter' => ':',
'string_emptyallowed' => true,
@@ -73,8 +74,8 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['wrapper'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_wrapper',
'type' => 'option',
'option_options' => array(
'type' => 'select',
'select_var' => array(
0 => 'ScriptAlias',
1 => 'FcgidWrapper'
),
@@ -88,7 +89,8 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['starter'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_starter',
'type' => 'int',
'type' => 'number',
'min' => 0,
'default' => 0,
'save_method' => 'storeSettingField'
),
@@ -96,7 +98,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['maxrequests'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_maxrequests',
'type' => 'int',
'type' => 'number',
'default' => 250,
'save_method' => 'storeSettingField'
),
@@ -104,9 +106,8 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_defaultini',
'type' => 'option',
'type' => 'select',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => array(
'\\Froxlor\\Http\\PhpConfig',
'getPhpConfigs'),
@@ -116,7 +117,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_idle_timeout',
'type' => 'int',
'type' => 'number',
'default' => 30,
'save_method' => 'storeSettingField'
)
@@ -124,5 +125,3 @@ return array(
)
)
);
?>

26
actions/admin/settings/136.phpfpm.php
View File

@@ -18,12 +18,13 @@ return array(
'groups' => array(
'phpfpm' => array(
'title' => $lng['admin']['phpfpm_settings'],
'icon' => 'fa-brands fa-php',
'fields' => array(
'system_phpfpm_enabled' => array(
'label' => $lng['serversettings']['phpfpm'],
'settinggroup' => 'phpfpm',
'varname' => 'enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'plausibility_check_method' => array(
@@ -36,9 +37,8 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
'settinggroup' => 'phpfpm',
'varname' => 'defaultini',
'type' => 'option',
'type' => 'select',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => array(
'\\Froxlor\\Http\\PhpConfig',
'getPhpConfigs'
@@ -49,7 +49,7 @@ return array(
'label' => $lng['serversettings']['phpfpm_settings']['aliasconfigdir'],
'settinggroup' => 'phpfpm',
'varname' => 'aliasconfigdir',
'type' => 'string',
'type' => 'text',
'string_type' => 'confdir',
'default' => '/var/www/php-fpm/',
'save_method' => 'storeSettingField'
@@ -58,7 +58,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
'settinggroup' => 'phpfpm',
'varname' => 'tmpdir',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/var/customers/tmp/',
'save_method' => 'storeSettingField'
@@ -67,7 +67,7 @@ return array(
'label' => $lng['serversettings']['mod_fcgid']['peardir'],
'settinggroup' => 'phpfpm',
'varname' => 'peardir',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'string_delimiter' => ':',
'string_emptyallowed' => true,
@@ -78,7 +78,7 @@ return array(
'label' => $lng['serversettings']['phpfpm_settings']['envpath'],
'settinggroup' => 'phpfpm',
'varname' => 'envpath',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'string_delimiter' => ':',
'string_emptyallowed' => true,
@@ -89,7 +89,7 @@ return array(
'label' => $lng['serversettings']['phpfpm_settings']['ipcdir'],
'settinggroup' => 'phpfpm',
'varname' => 'fastcgi_ipcdir',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/var/lib/apache2/fastcgi/',
'save_method' => 'storeSettingField'
@@ -98,7 +98,7 @@ return array(
'label' => $lng['phpfpm']['use_mod_proxy'],
'settinggroup' => 'phpfpm',
'varname' => 'use_mod_proxy',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'visible' => \Froxlor\Settings::Get('system.apache24'),
'save_method' => 'storeSettingField'
@@ -107,7 +107,7 @@ return array(
'label' => $lng['phpfpm']['ini_flags'],
'settinggroup' => 'phpfpm',
'varname' => 'ini_flags',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -115,7 +115,7 @@ return array(
'label' => $lng['phpfpm']['ini_values'],
'settinggroup' => 'phpfpm',
'varname' => 'ini_values',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -123,7 +123,7 @@ return array(
'label' => $lng['phpfpm']['ini_admin_flags'],
'settinggroup' => 'phpfpm',
'varname' => 'ini_admin_flags',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -131,7 +131,7 @@ return array(
'label' => $lng['phpfpm']['ini_admin_values'],
'settinggroup' => 'phpfpm',
'varname' => 'ini_admin_values',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField'
)

11
actions/admin/settings/137.perl.php
View File

@@ -18,12 +18,13 @@ return array(
'groups' => array(
'perl' => array(
'title' => $lng['admin']['perl_settings'],
'icon' => 'fa-solid fa-code',
'fields' => array(
'perl_path' => array(
'label' => $lng['serversettings']['perl_path'],
'settinggroup' => 'system',
'varname' => 'perl_path',
'type' => 'string',
'type' => 'text',
'default' => '/usr/bin/perl',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -34,7 +35,7 @@ return array(
'label' => $lng['serversettings']['perl']['suexecworkaround'],
'settinggroup' => 'perl',
'varname' => 'suexecworkaround',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -45,7 +46,7 @@ return array(
'label' => $lng['serversettings']['perl']['suexeccgipath'],
'settinggroup' => 'perl',
'varname' => 'suexecpath',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/var/www/cgi-bin/',
'save_method' => 'storeSettingField',
@@ -57,7 +58,7 @@ return array(
'label' => $lng['serversettings']['perl_server'],
'settinggroup' => 'serversettings',
'varname' => 'perl_server',
'type' => 'string',
'type' => 'text',
'default' => 'unix:/var/run/nginx/cgiwrap-dispatch.sock',
'save_method' => 'storeSettingField',
'websrv_avail' => array(
@@ -68,5 +69,3 @@ return array(
)
)
);
?>

20
actions/admin/settings/140.statistics.php
View File

@@ -20,15 +20,15 @@ return array(
'groups' => array(
'statistics' => array(
'title' => $lng['admin']['statisticsettings'],
'icon' => 'fa-solid fa-chart-area',
'fields' => array(
'system_webalizer_quiet' => array(
'label' => $lng['serversettings']['webalizer_quiet'],
'settinggroup' => 'system',
'varname' => 'webalizer_quiet',
'type' => 'option',
'type' => 'select',
'default' => 2,
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
0 => $lng['admin']['webalizer']['normal'],
1 => $lng['admin']['webalizer']['quiet'],
2 => $lng['admin']['webalizer']['veryquiet']
@@ -40,7 +40,7 @@ return array(
'label' => $lng['serversettings']['awstats_enabled'],
'settinggroup' => 'system',
'varname' => 'awstats_enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -48,7 +48,7 @@ return array(
'label' => $lng['serversettings']['awstats_path'],
'settinggroup' => 'system',
'varname' => 'awstats_path',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/usr/bin/',
'save_method' => 'storeSettingField',
@@ -58,7 +58,7 @@ return array(
'label' => $lng['serversettings']['awstats_awstatspath'],
'settinggroup' => 'system',
'varname' => 'awstats_awstatspath',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/usr/bin/',
'save_method' => 'storeSettingField',
@@ -68,7 +68,7 @@ return array(
'label' => $lng['serversettings']['awstats_conf'],
'settinggroup' => 'system',
'varname' => 'awstats_conf',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/etc/awstats/',
'save_method' => 'storeSettingField',
@@ -78,7 +78,7 @@ return array(
'label' => $lng['serversettings']['awstats_icons'],
'settinggroup' => 'system',
'varname' => 'awstats_icons',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/usr/share/awstats/icon/',
'save_method' => 'storeSettingField',
@@ -88,7 +88,7 @@ return array(
'label' => $lng['serversettings']['awstats']['logformat'],
'settinggroup' => 'system',
'varname' => 'awstats_logformat',
'type' => 'string',
'type' => 'text',
'default' => '1',
'save_method' => 'storeSettingField',
'visible' => \Froxlor\Settings::Get('system.awstats_enabled') == 1
@@ -97,5 +97,3 @@ return array(
)
)
);
?>

43
actions/admin/settings/150.mail.php
View File

@@ -20,32 +20,33 @@ return array(
'groups' => array(
'mail' => array(
'title' => $lng['admin']['mailserversettings'],
'icon' => 'fa-solid fa-envelope',
'fields' => array(
'system_vmail_uid' => array(
'label' => $lng['serversettings']['vmail_uid'],
'settinggroup' => 'system',
'varname' => 'vmail_uid',
'type' => 'int',
'type' => 'number',
'default' => 2000,
'int_min' => 1,
'int_max' => 65535,
'min' => 2,
'max' => 65535,
'save_method' => 'storeSettingField'
),
'system_vmail_gid' => array(
'label' => $lng['serversettings']['vmail_gid'],
'settinggroup' => 'system',
'varname' => 'vmail_gid',
'type' => 'int',
'type' => 'number',
'default' => 2000,
'int_min' => 1,
'int_max' => 65535,
'min' => 2,
'max' => 65535,
'save_method' => 'storeSettingField'
),
'system_vmail_homedir' => array(
'label' => $lng['serversettings']['vmail_homedir'],
'settinggroup' => 'system',
'varname' => 'vmail_homedir',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/var/customers/mail/',
'save_method' => 'storeSettingField'
@@ -54,7 +55,7 @@ return array(
'label' => $lng['serversettings']['vmail_maildirname'],
'settinggroup' => 'system',
'varname' => 'vmail_maildirname',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => 'Maildir',
'string_emptyallowed' => true,
@@ -64,7 +65,7 @@ return array(
'label' => $lng['serversettings']['sendalternativemail'],
'settinggroup' => 'panel',
'varname' => 'sendalternativemail',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -72,7 +73,7 @@ return array(
'label' => $lng['serversettings']['mail_quota_enabled'],
'settinggroup' => 'system',
'varname' => 'mail_quota_enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -80,7 +81,7 @@ return array(
'label' => $lng['serversettings']['mail_quota'],
'settinggroup' => 'system',
'varname' => 'mail_quota',
'type' => 'int',
'type' => 'number',
'default' => 100,
'save_method' => 'storeSettingField'
),
@@ -88,7 +89,7 @@ return array(
'label' => $lng['serversettings']['catchall_enabled'],
'settinggroup' => 'catchall',
'varname' => 'catchall_enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingResetCatchall'
),
@@ -96,7 +97,7 @@ return array(
'label' => $lng['serversettings']['mailtraffic_enabled'],
'settinggroup' => 'system',
'varname' => 'mailtraffic_enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -104,10 +105,9 @@ return array(
'label' => $lng['serversettings']['mdaserver'],
'settinggroup' => 'system',
'varname' => 'mdaserver',
'type' => 'option',
'option_mode' => 'one',
'type' => 'select',
'default' => 'dovecot',
'option_options' => array(
'select_var' => array(
'courier' => 'Courier',
'dovecot' => 'Dovecot'
),
@@ -117,7 +117,7 @@ return array(
'label' => $lng['serversettings']['mdalog'],
'settinggroup' => 'system',
'varname' => 'mdalog',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'default' => '/var/log/mail.log',
'string_emptyallowed' => true,
@@ -127,10 +127,9 @@ return array(
'label' => $lng['serversettings']['mtaserver'],
'settinggroup' => 'system',
'varname' => 'mtaserver',
'type' => 'option',
'option_mode' => 'one',
'type' => 'select',
'default' => 'postfix',
'option_options' => array(
'select_var' => array(
'exim4' => 'Exim4',
'postfix' => 'Postfix'
),
@@ -140,7 +139,7 @@ return array(
'label' => $lng['serversettings']['mtalog'],
'settinggroup' => 'system',
'varname' => 'mtalog',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'default' => '/var/log/mail.log',
'string_emptyallowed' => true,
@@ -150,5 +149,3 @@ return array(
)
)
);
?>

8
actions/admin/settings/155.ftpserver.php
View File

@@ -20,15 +20,15 @@ return array(
'groups' => array(
'ftpserver' => array(
'title' => $lng['admin']['ftpserversettings'],
'icon' => 'fa-solid fa-arrow-right-arrow-left',
'fields' => array(
'ftpserver' => array(
'label' => $lng['admin']['ftpserver'],
'settinggroup' => 'system',
'varname' => 'ftpserver',
'type' => 'option',
'type' => 'select',
'default' => 'proftpd',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'proftpd' => 'Proftpd',
'pureftpd' => 'Pureftpd'
),
@@ -38,5 +38,3 @@ return array(
)
)
);
?>

40
actions/admin/settings/160.nameserver.php
View File

@@ -20,12 +20,13 @@ return array(
'groups' => array(
'nameserver' => array(
'title' => $lng['admin']['nameserversettings'],
'icon' => 'fa-solid fa-globe',
'fields' => array(
'nameserver_enable' => array(
'label' => $lng['serversettings']['bindenable'],
'settinggroup' => 'system',
'varname' => 'bind_enable',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField',
'overview_option' => true
@@ -34,7 +35,7 @@ return array(
'label' => $lng['serversettings']['dnseditorenable'],
'settinggroup' => 'system',
'varname' => 'dnsenabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -42,10 +43,9 @@ return array(
'label' => $lng['serversettings']['dns_server'],
'settinggroup' => 'system',
'varname' => 'dns_server',
'type' => 'option',
'type' => 'select',
'default' => 'Bind',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'Bind' => 'Bind9',
'PowerDNS' => 'PowerDNS'
),
@@ -55,7 +55,7 @@ return array(
'label' => $lng['serversettings']['bindconf_directory'],
'settinggroup' => 'system',
'varname' => 'bindconf_directory',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/etc/bind/',
'save_method' => 'storeSettingField'
@@ -64,7 +64,7 @@ return array(
'label' => $lng['serversettings']['bindreload_command'],
'settinggroup' => 'system',
'varname' => 'bindreload_command',
'type' => 'string',
'type' => 'text',
'default' => '/etc/init.d/bind9 reload',
'save_method' => 'storeSettingField'
),
@@ -72,7 +72,7 @@ return array(
'label' => $lng['serversettings']['nameservers'],
'settinggroup' => 'system',
'varname' => 'nameservers',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^(([a-z0-9\-\._]+, ?)*[a-z0-9\-\._]+)?$/i',
'string_emptyallowed' => true,
'default' => '',
@@ -82,7 +82,7 @@ return array(
'label' => $lng['serversettings']['mxservers'],
'settinggroup' => 'system',
'varname' => 'mxservers',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^(([0-9]+ [a-z0-9\-\._]+, ?)*[0-9]+ [a-z0-9\-\._]+)?$/i',
'string_emptyallowed' => true,
'default' => '',
@@ -92,7 +92,7 @@ return array(
'label' => $lng['serversettings']['axfrservers'],
'settinggroup' => 'system',
'varname' => 'axfrservers',
'type' => 'string',
'type' => 'text',
'string_type' => 'validate_ip_incl_private',
'string_delimiter' => ',',
'string_emptyallowed' => true,
@@ -103,10 +103,9 @@ return array(
'label' => $lng['serversettings']['powerdns_mode'],
'settinggroup' => 'system',
'varname' => 'powerdns_mode',
'type' => 'option',
'type' => 'select',
'default' => 'Native',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'Native' => 'Native',
'Master' => 'Master'
),
@@ -116,7 +115,7 @@ return array(
'label' => $lng['serversettings']['mail_also_with_mxservers'],
'settinggroup' => 'system',
'varname' => 'dns_createmailentry',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -124,7 +123,7 @@ return array(
'label' => $lng['serversettings']['caa_entry'],
'settinggroup' => 'system',
'varname' => 'dns_createcaaentry',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -132,7 +131,7 @@ return array(
'label' => $lng['serversettings']['caa_entry_custom'],
'settinggroup' => 'caa',
'varname' => 'caa_entry',
'type' => 'text',
'type' => 'textarea',
'default' => '',
'save_method' => 'storeSettingField'
),
@@ -140,18 +139,17 @@ return array(
'label' => $lng['serversettings']['defaultttl'],
'settinggroup' => 'system',
'varname' => 'defaultttl',
'type' => 'int',
'type' => 'number',
'default' => 604800, /* 1 week */
'int_min' => 3600, /* 1 hour */
'int_max' => 2147483647, /* integer max */
'min' => 3600, /* 1 hour */
'max' => 2147483647, /* integer max */
'save_method' => 'storeSettingField'
),
'system_soaemail' => array(
'label' => $lng['serversettings']['soaemail'],
'settinggroup' => 'system',
'varname' => 'soaemail',
'type' => 'string',
'string_type' => 'mail',
'type' => 'email',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'

23
actions/admin/settings/170.logger.php
View File

@@ -20,12 +20,13 @@ return array(
'groups' => array(
'logging' => array(
'title' => $lng['admin']['loggersettings'],
'icon' => 'fa-solid fa-file-lines',
'fields' => array(
'logger_enabled' => array(
'label' => $lng['serversettings']['logger']['enable'],
'settinggroup' => 'logger',
'varname' => 'enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
@@ -34,10 +35,9 @@ return array(
'label' => $lng['serversettings']['logger']['severity'],
'settinggroup' => 'logger',
'varname' => 'severity',
'type' => 'option',
'type' => 'select',
'default' => 1,
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
1 => $lng['admin']['logger']['normal'],
2 => $lng['admin']['logger']['paranoid']
),
@@ -47,10 +47,10 @@ return array(
'label' => $lng['serversettings']['logger']['types'],
'settinggroup' => 'logger',
'varname' => 'logtypes',
'type' => 'option',
'type' => 'select',
'default' => 'syslog,mysql',
'option_mode' => 'multiple',
'option_options' => array(
'select_mode' => 'multiple',
'select_var' => array(
'syslog' => 'syslog',
'file' => 'file',
'mysql' => 'mysql'
@@ -61,7 +61,7 @@ return array(
'label' => $lng['serversettings']['logger']['logfile'],
'settinggroup' => 'logger',
'varname' => 'logfile',
'type' => 'string',
'type' => 'text',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
@@ -71,10 +71,9 @@ return array(
'label' => $lng['serversettings']['logger']['logcron'],
'settinggroup' => 'logger',
'varname' => 'log_cron',
'type' => 'option',
'type' => 'select',
'default' => 0,
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
0 => $lng['serversettings']['logger']['logcronoption']['never'],
1 => $lng['serversettings']['logger']['logcronoption']['once'],
2 => $lng['serversettings']['logger']['logcronoption']['always']
@@ -85,5 +84,3 @@ return array(
)
)
);
?>

33
actions/admin/settings/180.dkim.php
View File

@@ -20,12 +20,13 @@ return array(
'groups' => array(
'dkim' => array(
'title' => $lng['admin']['dkimsettings'],
'icon' => 'fa-solid fa-fingerprint',
'fields' => array(
'dkim_enabled' => array(
'label' => $lng['dkim']['use_dkim'],
'settinggroup' => 'dkim',
'varname' => 'use_dkim',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingFieldInsertBindTask',
'overview_option' => true
@@ -34,7 +35,7 @@ return array(
'label' => $lng['dkim']['dkim_prefix'],
'settinggroup' => 'dkim',
'varname' => 'dkim_prefix',
'type' => 'string',
'type' => 'text',
'string_type' => 'dir',
'default' => '/etc/postfix/dkim/',
'save_method' => 'storeSettingField'
@@ -43,7 +44,7 @@ return array(
'label' => $lng['dkim']['privkeysuffix'],
'settinggroup' => 'dkim',
'varname' => 'privkeysuffix',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^[a-z0-9\._]+$/i',
'default' => '.priv',
'save_method' => 'storeSettingField'
@@ -52,7 +53,7 @@ return array(
'label' => $lng['dkim']['dkim_domains'],
'settinggroup' => 'dkim',
'varname' => 'dkim_domains',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^[a-z0-9\._]+$/i',
'default' => 'domains',
'save_method' => 'storeSettingField'
@@ -61,7 +62,7 @@ return array(
'label' => $lng['dkim']['dkim_dkimkeys'],
'settinggroup' => 'dkim',
'varname' => 'dkim_dkimkeys',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^[a-z0-9\._]+$/i',
'default' => 'dkim-keys.conf',
'save_method' => 'storeSettingField'
@@ -70,10 +71,10 @@ return array(
'label' => $lng['dkim']['dkim_algorithm'],
'settinggroup' => 'dkim',
'varname' => 'dkim_algorithm',
'type' => 'option',
'type' => 'select',
'default' => 'all',
'option_mode' => 'multiple',
'option_options' => array(
'select_mode' => 'multiple',
'select_var' => array(
'all' => 'All',
'sha1' => 'SHA1',
'sha256' => 'SHA256'
@@ -84,10 +85,9 @@ return array(
'label' => $lng['dkim']['dkim_servicetype'],
'settinggroup' => 'dkim',
'varname' => 'dkim_servicetype',
'type' => 'option',
'type' => 'select',
'default' => '0',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'0' => 'All',
'1' => 'E-Mail'
),
@@ -100,10 +100,9 @@ return array(
),
'settinggroup' => 'dkim',
'varname' => 'dkim_keylength',
'type' => 'option',
'type' => 'select',
'default' => '1024',
'option_mode' => 'one',
'option_options' => array(
'select_var' => array(
'1024' => '1024 Bit',
'2048' => '2048 Bit'
),
@@ -113,7 +112,7 @@ return array(
'label' => $lng['dkim']['dkim_notes'],
'settinggroup' => 'dkim',
'varname' => 'dkim_notes',
'type' => 'string',
'type' => 'text',
'string_regexp' => '/^[a-z0-9\._]+$/i',
'default' => '',
'save_method' => 'storeSettingFieldInsertBindTask'
@@ -122,7 +121,7 @@ return array(
'label' => $lng['dkim']['dkimrestart_command'],
'settinggroup' => 'dkim',
'varname' => 'dkimrestart_command',
'type' => 'string',
'type' => 'text',
'default' => '/etc/init.d/dkim-filter restart',
'save_method' => 'storeSettingField'
)
@@ -130,5 +129,3 @@ return array(
)
)
);
?>

7
actions/admin/settings/185.spf.php
View File

@@ -18,12 +18,13 @@ return array(
'groups' => array(
'spf' => array(
'title' => $lng['admin']['spfsettings'],
'icon' => 'fa-solid fa-clipboard-check',
'fields' => array(
'spf_enabled' => array(
'label' => $lng['spf']['use_spf'],
'settinggroup' => 'spf',
'varname' => 'use_spf',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
@@ -32,7 +33,7 @@ return array(
'label' => $lng['spf']['spf_entry'],
'settinggroup' => 'spf',
'varname' => 'spf_entry',
'type' => 'string',
'type' => 'text',
'default' => '"v=spf1 a mx -all"',
'save_method' => 'storeSettingField'
)
@@ -40,5 +41,3 @@ return array(
)
)
);
?>

18
actions/admin/settings/210.security.php
View File

@@ -20,12 +20,13 @@ return array(
'groups' => array(
'security' => array(
'title' => $lng['admin']['security_settings'],
'icon' => 'fa-solid fa-user-lock',
'fields' => array(
'panel_unix_names' => array(
'label' => $lng['serversettings']['unix_names'],
'settinggroup' => 'panel',
'varname' => 'unix_names',
'type' => 'bool',
'type' => 'checkbox',
'default' => true,
'save_method' => 'storeSettingField'
),
@@ -33,7 +34,7 @@ return array(
'label' => $lng['serversettings']['mailpwcleartext'],
'settinggroup' => 'system',
'varname' => 'mailpwcleartext',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -41,9 +42,8 @@ return array(
'label' => $lng['serversettings']['passwordcryptfunc'],
'settinggroup' => 'system',
'varname' => 'passwordcryptfunc',
'type' => 'option',
'type' => 'select',
'default' => 0,
'option_mode' => 'one',
'option_options_method' => array(
'\\Froxlor\\System\\Crypt',
'getAvailablePasswordHashes'
@@ -54,7 +54,7 @@ return array(
'label' => $lng['serversettings']['allow_error_report_admin'],
'settinggroup' => 'system',
'varname' => 'allow_error_report_admin',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -62,7 +62,7 @@ return array(
'label' => $lng['serversettings']['allow_error_report_customer'],
'settinggroup' => 'system',
'varname' => 'allow_error_report_customer',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -70,7 +70,7 @@ return array(
'label' => $lng['serversettings']['allow_allow_customer_shell'],
'settinggroup' => 'system',
'varname' => 'allow_customer_shell',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField'
),
@@ -78,7 +78,7 @@ return array(
'label' => $lng['serversettings']['available_shells'],
'settinggroup' => 'system',
'varname' => 'available_shells',
'type' => 'string',
'type' => 'text',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
@@ -87,7 +87,7 @@ return array(
'label' => $lng['serversettings']['froxlorusergroup'],
'settinggroup' => 'system',
'varname' => 'froxlorusergroup',
'type' => 'string',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
'plausibility_check_method' => array(

11
actions/admin/settings/220.quota.php
View File

@@ -17,12 +17,13 @@ return array(
'groups' => array(
'diskquota' => array(
'title' => $lng['diskquota'],
'icon' => 'fa-solid fa-sliders',
'fields' => array(
'diskquota_enabled' => array(
'label' => $lng['serversettings']['diskquota_enabled'],
'settinggroup' => 'system',
'varname' => 'diskquota_enabled',
'type' => 'bool',
'type' => 'checkbox',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
@@ -31,7 +32,7 @@ return array(
'label' => $lng['serversettings']['diskquota_repquota_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_repquota_path',
'type' => 'string',
'type' => 'text',
'default' => '/usr/sbin/repquota',
'save_method' => 'storeSettingField'
),
@@ -39,7 +40,7 @@ return array(
'label' => $lng['serversettings']['diskquota_quotatool_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_quotatool_path',
'type' => 'string',
'type' => 'text',
'default' => '/usr/bin/quotatool',
'save_method' => 'storeSettingField'
),
@@ -47,7 +48,7 @@ return array(
'label' => $lng['serversettings']['diskquota_customer_partition']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_customer_partition',
'type' => 'string',
'type' => 'text',
'default' => '/dev/root',
'save_method' => 'storeSettingField'
)
@@ -55,5 +56,3 @@ return array(
)
)
);
?>

14
admin_settings.php
View File

@@ -19,6 +19,7 @@
use Froxlor\Database\Database;
use Froxlor\Settings;
use Froxlor\Api\Commands\Froxlor;
use Froxlor\UI\Panel\UI;
const AREA = 'admin';
require __DIR__ . '/lib/init.php';
@@ -85,18 +86,15 @@ if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
$_part = isset($_POST['part']) ? $_POST['part'] : '';
}
$fields = \Froxlor\UI\Form::buildFormEx($settings_data, $_part);
$fields = \Froxlor\UI\Form::buildForm($settings_data, $_part);
$settings_page = '';
if ($_part == '') {
eval("\$settings_page .= \"" . \Froxlor\UI\Template::getTemplate("settings/settings_overview") . "\";");
if ($_part == '' || $_part = 'all') {
UI::twigBuffer('settings/index.html.twig', ['fields' => $fields]);
} else {
eval("\$settings_page .= \"" . \Froxlor\UI\Template::getTemplate("settings/settings") . "\";");
UI::twigBuffer('settings/detailpart.html.twig', ['fields' => $fields]);
}
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/settings_form_begin") . "\";");
eval("echo \$settings_page;");
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/settings_form_end") . "\";");
UI::twigOutputBuffer();
}
} elseif ($page == 'phpinfo' && $userinfo['change_serversettings'] == '1') {
ob_start();

1
lib/Froxlor/PhpHelper.php
View File

@@ -172,7 +172,6 @@ class PhpHelper
public static function loadConfigArrayDir()
{
// Workaround until we use gettext
global $lng, $theme;
// we now use dynamic function parameters

7
lib/Froxlor/UI/Data.php
View File

@@ -1,4 +1,5 @@
<?php
namespace Froxlor\UI;
class Data
@@ -15,7 +16,7 @@ class Data
return $newfieldvalue;
}
public static function getFormFieldDataOption($fieldname, $fielddata, $input)
public static function getFormFieldDataSelect($fieldname, $fielddata, $input)
{
if (isset($input[$fieldname])) {
$newfieldvalue = $input[$fieldname];
@@ -30,7 +31,7 @@ class Data
return $newfieldvalue;
}
public static function getFormFieldDataInt($fieldname, $fielddata, $input)
public static function getFormFieldDataNumber($fieldname, $fielddata, $input)
{
if (isset($input[$fieldname])) {
$newfieldvalue = (int) $input[$fieldname];
@@ -41,7 +42,7 @@ class Data
return $newfieldvalue;
}
public static function getFormFieldDataBool($fieldname, $fielddata, $input)
public static function getFormFieldDataCheckbox($fieldname, $fielddata, $input)
{
if (isset($input[$fieldname]) && ($input[$fieldname] === '1' || $input[$fieldname] === 1 || $input[$fieldname] === true || strtolower($input[$fieldname]) === 'yes' || strtolower($input[$fieldname]) === 'ja')) {
$newfieldvalue = '1';

15
lib/Froxlor/UI/Fields.php
View File

@@ -20,14 +20,14 @@ class Fields
return $returnvalue;
}
public static function getFormFieldOutputOption($fieldname, $fielddata, $do_show = true)
public static function getFormFieldOutputSelect($fieldname, $fielddata, $do_show = true)
{
$returnvalue = '';
if (isset($fielddata['option_options']) && is_array($fielddata['option_options']) && ! empty($fielddata['option_options'])) {
if (isset($fielddata['select_var']) && is_array($fielddata['select_var']) && ! empty($fielddata['select_var'])) {
if (isset($fielddata['option_mode']) && $fielddata['option_mode'] == 'multiple') {
$multiple = true;
$fielddata['value'] = explode(',', $fielddata['value']);
$fielddata['selected'] = explode(',', $fielddata['selected']);
} else {
$multiple = false;
}
@@ -44,12 +44,15 @@ class Fields
return $returnvalue;
}
public static function prefetchFormFieldDataOption($fieldname, $fielddata)
/**
* fetch select-options via callback function
*/
public static function prefetchFormFieldDataSelect($fieldname, $fielddata)
{
$returnvalue = array();
if ((! isset($fielddata['option_options']) || ! is_array($fielddata['option_options']) || empty($fielddata['option_options'])) && (isset($fielddata['option_options_method']))) {
$returnvalue['options'] = call_user_func($fielddata['option_options_method']);
if ((! isset($fielddata['select_var']) || ! is_array($fielddata['select_var']) || empty($fielddata['select_var'])) && (isset($fielddata['option_options_method']))) {
$returnvalue['select_var'] = call_user_func($fielddata['option_options_method']);
}
return $returnvalue;

189
lib/Froxlor/UI/Form.php
View File

@@ -1,51 +1,23 @@
<?php
namespace Froxlor\UI;
use Froxlor\Settings;
class Form
{
public static function buildForm($form)
public static function buildForm(array $form, string $part = ''): array
{
$fields = '';
if (\Froxlor\Validate\Form::validateFormDefinition($form)) {
foreach ($form['groups'] as $groupname => $groupdetails) {
if (isset($groupdetails['title']) && $groupdetails['title'] != '') {
$fields .= self::getFormGroupOutput($groupname, $groupdetails);
}
if (\Froxlor\Validate\Form::validateFieldDefinition($groupdetails)) {
// Prefetch form fields
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
$groupdetails['fields'][$fieldname] = self::arrayMergePrefix($fielddetails, $fielddetails['type'], self::prefetchFormFieldData($fieldname, $fielddetails));
$form['groups'][$groupname]['fields'][$fieldname] = $groupdetails['fields'][$fieldname];
}
// Collect form field output
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
$fields .= self::getFormFieldOutput($fieldname, $fielddetails);
}
}
}
}
return $fields;
}
public static function buildFormEx($form, $part = '')
{
$fields = '';
$fields = [];
if (\Froxlor\Validate\Form::validateFormDefinition($form)) {
foreach ($form['groups'] as $groupname => $groupdetails) {
// show overview
if ($part == '') {
if ($part == '' || $part == 'all') {
if (isset($groupdetails['title']) && $groupdetails['title'] != '') {
$fields .= self::getFormOverviewGroupOutput($groupname, $groupdetails);
$fields[] = self::getFormOverviewGroupOutput($groupname, $groupdetails);
}
} elseif ($part != '' && ($groupname == $part || $part == 'all')) {
} elseif ($part != '' && $groupname == $part) {
// only show one section
/**
* this part checks for the 'websrv_avail' entry in the settings-array
@@ -56,7 +28,7 @@ class Form
$do_show = true;
if (isset($groupdetails['websrv_avail']) && is_array($groupdetails['websrv_avail'])) {
$websrv = Settings::Get('system.webserver');
if (! in_array($websrv, $groupdetails['websrv_avail'])) {
if (!in_array($websrv, $groupdetails['websrv_avail'])) {
$do_show = false;
}
}
@@ -68,24 +40,18 @@ class Form
$do_show = $groupdetails['visible'];
}
// if ($do_show) {
if (isset($groupdetails['title']) && $groupdetails['title'] != '') {
$fields .= self::getFormGroupOutput($groupname, $groupdetails);
}
$fields['_group'] = [
'title' => $groupdetails['title'] ?? 'unknown group',
'do_show' => $do_show
];
if (\Froxlor\Validate\Form::validateFieldDefinition($groupdetails)) {
// Prefetch form fields
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
$groupdetails['fields'][$fieldname] = self::arrayMergePrefix($fielddetails, $fielddetails['type'], self::prefetchFormFieldData($fieldname, $fielddetails));
$form['groups'][$groupname]['fields'][$fieldname] = $groupdetails['fields'][$fieldname];
}
// Collect form field output
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
$fields .= self::getFormFieldOutput($fieldname, $fielddetails);
$fields[$fieldname] = self::getFormFieldOutput($fieldname, $fielddetails);
$fields[$fieldname] = array_merge($fields[$fieldname], self::prefetchFormFieldData($fieldname, $fielddetails));
}
}
// }
}
}
}
@@ -148,7 +114,7 @@ class Form
$question = $plausibility_check[1];
unset($plausibility_check[1]);
$targetname = implode(' ', $plausibility_check);
if (! isset($input[$question])) {
if (!isset($input[$question])) {
if (is_array($url_params) && isset($url_params['filename'])) {
$filename = $url_params['filename'];
unset($url_params['filename']);
@@ -200,7 +166,7 @@ class Form
if (\Froxlor\Validate\Form::validateFieldDefinition($groupdetails)) {
// Prefetch form fields
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
if (! $only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
if (!$only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
$groupdetails['fields'][$fieldname] = self::arrayMergePrefix($fielddetails, $fielddetails['type'], self::prefetchFormFieldData($fieldname, $fielddetails));
$form['groups'][$groupname]['fields'][$fieldname] = $groupdetails['fields'][$fieldname];
}
@@ -214,7 +180,7 @@ class Form
if (\Froxlor\Validate\Form::validateFieldDefinition($groupdetails)) {
// Validate fields
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
if (! $only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
if (!$only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
$newfieldvalue = self::getFormFieldData($fieldname, $fielddetails, $input);
if ($newfieldvalue != $fielddetails['value']) {
if (($error = \Froxlor\Validate\Form::validateFormField($fieldname, $fielddetails, $newfieldvalue)) != true) {
@@ -236,7 +202,7 @@ class Form
if (\Froxlor\Validate\Form::validateFieldDefinition($groupdetails)) {
// Check fields for plausibility
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
if (! $only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
if (!$only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
if (($plausibility_check = self::checkPlausibilityFormField($fieldname, $fielddetails, $submitted_fields[$fieldname], $submitted_fields)) !== false) {
if (is_array($plausibility_check) && isset($plausibility_check[0])) {
if ($plausibility_check[0] == \Froxlor\Validate\Check::FORMFIELDS_PLAUSIBILITY_CHECK_OK) {
@@ -252,7 +218,7 @@ class Form
$question = $plausibility_check[1];
unset($plausibility_check[1]);
$targetname = implode(' ', $plausibility_check);
if (! isset($input[$question])) {
if (!isset($input[$question])) {
if (is_array($url_params) && isset($url_params['filename'])) {
$filename = $url_params['filename'];
unset($url_params['filename']);
@@ -279,7 +245,7 @@ class Form
if (\Froxlor\Validate\Form::validateFieldDefinition($groupdetails)) {
// Save fields
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
if (! $only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
if (!$only_enabledisable || ($only_enabledisable && isset($fielddetails['overview_option']))) {
if (isset($changed_fields[$fieldname])) {
if (($saved_field = self::saveFormField($fieldname, $fielddetails, self::manipulateFormFieldData($fieldname, $fielddetails, $changed_fields[$fieldname]))) !== false) {
$saved_fields = array_merge($saved_fields, $saved_field);
@@ -306,7 +272,7 @@ class Form
'\\Froxlor\\Settings\\Store',
$fielddata['save_method']
), $fielddata, $newfieldvalue);
} elseif (is_array($fielddata) && ! isset($fielddata['save_method'])) {
} elseif (is_array($fielddata) && !isset($fielddata['save_method'])) {
$returnvalue = true;
} else {
$returnvalue = false;
@@ -322,7 +288,7 @@ class Form
'\\Froxlor\\Settings\\Store',
$fielddata['save_method']
), $fieldname, $fielddata, $newfieldvalue);
} elseif (is_array($fielddata) && ! isset($fielddata['save_method'])) {
} elseif (is_array($fielddata) && !isset($fielddata['save_method'])) {
$returnvalue = array();
} else {
$returnvalue = false;
@@ -330,87 +296,79 @@ class Form
return $returnvalue;
}
public static function getFormGroupOutput($groupname, $groupdetails)
{
global $lng, $theme;
eval("\$group = \"" . \Froxlor\UI\Template::getTemplate("settings/settings_group") . "\";");
return $group;
}
public static function getFormOverviewGroupOutput($groupname, $groupdetails)
{
global $lng, $filename, $s, $theme;
$group = '';
$title = $groupdetails['title'];
$part = $groupname;
global $lng;
$activated = true;
$option = '';
$option = [];
if (isset($groupdetails['fields'])) {
foreach ($groupdetails['fields'] as $fieldname => $fielddetails) {
if (isset($fielddetails['overview_option']) && $fielddetails['overview_option'] == true) {
if ($fielddetails['type'] != 'option' && $fielddetails['type'] != 'bool') {
\Froxlor\UI\Response::standard_error('overviewsettingoptionisnotavalidfield');
if ($fielddetails['type'] != 'select' && $fielddetails['type'] != 'checkbox' && $fielddetails['type'] != 'option' && $fielddetails['type'] != 'bool') {
// throw exception here as this is most likely an internal issue
// if we messed up the arrays
\Froxlor\UI\Response::standard_error('overviewsettingoptionisnotavalidfield', '', true);
}
if ($fielddetails['type'] == 'option') {
$options_array = $fielddetails['option_options'];
$options = '';
if ($fielddetails['type'] == 'select') {
$options_array = $fielddetails['select_var'];
$options = [];
foreach ($options_array as $value => $vtitle) {
$options .= \Froxlor\UI\HTML::makeoption($vtitle, $value, Settings::Get($fielddetails['settinggroup'] . '.' . $fielddetails['varname']));
$options[] = [
'title' => $vtitle,
'value' => $value,
'default' => Settings::Get($fielddetails['settinggroup'] . '.' . $fielddetails['varname'])
];
}
$option .= $fielddetails['label'] . ':&nbsp;';
$option .= '<select class="dropdown_noborder" name="' . $fieldname . '">';
$option .= $options;
$option .= '</select>';
$option['type'] = 'select';
$option['label'] = $fielddetails['label'];
$option['fieldname'] = $fieldname;
$option['options'] = $options;
$activated = true;
} else {
$option .= $lng['admin']['activated'] . ':&nbsp;';
$option .= \Froxlor\UI\HTML::makeyesno($fieldname, '1', '0', Settings::Get($fielddetails['settinggroup'] . '.' . $fielddetails['varname']));
$option['type'] = 'bool';
$option['label'] = $lng['admin']['activated'];
$option['fieldname'] = $fieldname;
$option['value'] = Settings::Get($fielddetails['settinggroup'] . '.' . $fielddetails['varname']);
$activated = (int) Settings::Get($fielddetails['settinggroup'] . '.' . $fielddetails['varname']);
}
}
}
}
$item = [
'title' => $groupdetails['title'],
'icon' => $groupdetails['icon'] ?? 'fa-solid fa-circle-question',
'part' => $groupname,
'activated' => $activated,
'option' => $option
];
/**
* this part checks for the 'websrv_avail' entry in the settings
* if found, we check if the current webserver is in the array.
* If this
* is not the case, we change the setting type to "hidden", #502
* If this is not the case, we change the setting type to "hidden", #502
*/
$do_show = true;
if (isset($groupdetails['websrv_avail']) && is_array($groupdetails['websrv_avail'])) {
$websrv = Settings::Get('system.webserver');
if (! in_array($websrv, $groupdetails['websrv_avail'])) {
$do_show = false;
$title .= sprintf($lng['serversettings']['option_unavailable_websrv'], implode(", ", $groupdetails['websrv_avail']));
// hack disabled flag into select-box
$option = str_replace('<select class', '<select disabled="disabled" class', $option);
if (!in_array($websrv, $groupdetails['websrv_avail'])) {
$item['info'] = sprintf($lng['serversettings']['option_unavailable_websrv'], implode(", ", $groupdetails['websrv_avail']));
$option['visible'] = false;
}
}
eval("\$group = \"" . \Froxlor\UI\Template::getTemplate("settings/settings_overviewgroup") . "\";");
return $group;
return $item;
}
public static function getFormFieldOutput($fieldname, $fielddata)
public static function getFormFieldOutput($fieldname, $fielddata): array
{
global $lng;
$returnvalue = '';
if (is_array($fielddata) && isset($fielddata['type']) && $fielddata['type'] != '' && method_exists('\\Froxlor\\UI\\Fields', 'getFormFieldOutput' . ucfirst($fielddata['type']))) {
if (isset($fielddata['label']) && is_array($fielddata['label'])) {
if (isset($fielddata['label']['title']) && isset($fielddata['label']['description'])) {
$fielddata['label'] = '<b>' . $fielddata['label']['title'] . '</b><br />' . $fielddata['label']['description'];
} else {
$fielddata['label'] = implode(' ', $fielddata['label']);
}
}
$returnvalue = [];
if (is_array($fielddata) && isset($fielddata['type']) && $fielddata['type'] != '' /* && method_exists('\\Froxlor\\UI\\Fields', 'getFormFieldOutput' . ucfirst($fielddata['type'])) */) {
if (! isset($fielddata['value'])) {
if (!isset($fielddata['value'])) {
if (isset($fielddata['default'])) {
$fielddata['value'] = $fielddata['default'];
} else {
@@ -418,6 +376,18 @@ class Form
}
}
// set value according to type
switch ($fielddata['type']) {
case 'select':
$fielddata['selected'] = $fielddata['value'];
unset($fielddata['value']);
break;
case 'checkbox':
$fielddata['checked'] = (bool) $fielddata['value'];
$fielddata['value'] = 1;
break;
}
/**
* this part checks for the 'websrv_avail' entry in the settings-array
* if found, we check if the current webserver is in the array.
@@ -427,9 +397,9 @@ class Form
$do_show = true;
if (isset($fielddata['websrv_avail']) && is_array($fielddata['websrv_avail'])) {
$websrv = Settings::Get('system.webserver');
if (! in_array($websrv, $fielddata['websrv_avail'])) {
if (!in_array($websrv, $fielddata['websrv_avail'])) {
$do_show = false;
$fielddata['label'] .= sprintf($lng['serversettings']['option_unavailable_websrv'], implode(", ", $fielddata['websrv_avail']));
$fielddata['note'] = sprintf($lng['serversettings']['option_unavailable_websrv'], implode(", ", $fielddata['websrv_avail']));
}
}
@@ -438,17 +408,24 @@ class Form
// be false due to websrv_avail
if (isset($fielddata['visible']) && $do_show) {
$do_show = $fielddata['visible'];
if (! $do_show) {
$fielddata['label'] .= $lng['serversettings']['option_unavailable'];
if (!$do_show) {
$fielddata['note'] = $lng['serversettings']['option_unavailable'];
}
}
if (!$do_show) {
$fielddata['visible'] = false;
}
/*
if ($do_show || (!$do_show && Settings::Get('system.hide_incompatible_settings') == '0')) {
$returnvalue = call_user_func(array(
'\\Froxlor\\UI\\Fields',
'getFormFieldOutput' . ucfirst($fielddata['type'])
), $fieldname, $fielddata, $do_show);
}
*/
$returnvalue = $fielddata;
}
return $returnvalue;
}

39
lib/Froxlor/Validate/Form/Data.php
View File

@@ -1,8 +1,25 @@
<?php
namespace Froxlor\Validate\Form;
class Data
{
public static function validateFormFieldText($fieldname, $fielddata, $newfieldvalue)
{
return self::validateFormFieldString($fieldname, $fielddata, $newfieldvalue);
}
public static function validateFormFieldEmail($fieldname, $fielddata, $newfieldvalue)
{
$fielddata['string_type'] == 'mail';
return self::validateFormFieldString($fieldname, $fielddata, $newfieldvalue);
}
public static function validateFormFieldUrl($fieldname, $fielddata, $newfieldvalue)
{
$fielddata['string_type'] == 'url';
return self::validateFormFieldString($fieldname, $fielddata, $newfieldvalue);
}
public static function validateFormFieldString($fieldname, $fielddata, $newfieldvalue)
{
@@ -42,7 +59,7 @@ class Data
} else {
// add trailing slash to validate path if needed
// refs #331
if (substr($newfieldvalue, - 1) != '/') {
if (substr($newfieldvalue, -1) != '/') {
$newfieldvalue .= '/';
}
$returnvalue = ($newfieldvalue == \Froxlor\FileDir::makeCorrectDir($newfieldvalue));
@@ -55,7 +72,7 @@ class Data
} else {
// add trailing slash to validate path if needed
// refs #331
if (substr($newfieldvalue, - 1) != '/') {
if (substr($newfieldvalue, -1) != '/') {
$newfieldvalue .= '/';
}
// if this is a configuration directory, check for stupidity of admins :p
@@ -128,7 +145,7 @@ class Data
}
}
public static function validateFormFieldBool($fieldname, $fielddata, $newfieldvalue)
public static function validateFormFieldCheckbox($fieldname, $fielddata, $newfieldvalue)
{
if ($newfieldvalue === '1' || $newfieldvalue === 1 || $newfieldvalue === true || strtolower($newfieldvalue) === 'yes' || strtolower($newfieldvalue) === 'ja' || $newfieldvalue === '0' || $newfieldvalue === 0 || $newfieldvalue === false || strtolower($newfieldvalue) === 'no' || strtolower($newfieldvalue) === 'nein' || strtolower($newfieldvalue) === '') {
return true;
@@ -200,7 +217,7 @@ class Data
} elseif (isset($fielddata['string_type']) && $fielddata['string_type'] == 'dir') {
// add trailing slash to validate path if needed
// refs #331
if (substr($newfieldvalue, - 1) != '/') {
if (substr($newfieldvalue, -1) != '/') {
$newfieldvalue .= '/';
}
$returnvalue = ($newfieldvalue == \Froxlor\FileDir::makeCorrectDir($newfieldvalue));
@@ -236,30 +253,30 @@ class Data
}
}
public static function validateFormFieldInt($fieldname, $fielddata, $newfieldvalue)
public static function validateFormFieldNumber($fieldname, $fielddata, $newfieldvalue)
{
if (isset($fielddata['int_min']) && (int) $newfieldvalue < (int) $fielddata['int_min']) {
if (isset($fielddata['min']) && (int) $newfieldvalue < (int) $fielddata['min']) {
return ('intvaluetoolow');
}
if (isset($fielddata['int_max']) && (int) $newfieldvalue > (int) $fielddata['int_max']) {
if (isset($fielddata['max']) && (int) $newfieldvalue > (int) $fielddata['max']) {
return ('intvaluetoohigh');
}
return true;
}
public static function validateFormFieldOption($fieldname, $fielddata, $newfieldvalue)
public static function validateFormFieldSelect($fieldname, $fielddata, $newfieldvalue)
{
$returnvalue = true;
if (isset($fielddata['option_mode']) && $fielddata['option_mode'] == 'multiple') {
$options = explode(',', $newfieldvalue);
foreach ($options as $option) {
$returnvalue = ($returnvalue && isset($fielddata['option_options'][$option]));
$returnvalue = ($returnvalue && isset($fielddata['select_var'][$option]));
}
} else {
$returnvalue = isset($fielddata['option_options'][$newfieldvalue]);
$returnvalue = isset($fielddata['select_var'][$newfieldvalue]);
}
if ($returnvalue === true || $fielddata['visible'] == false) {
@@ -272,7 +289,7 @@ class Data
}
}
public static function validateFormFieldText($fieldname, $fielddata, $newfieldvalue)
public static function validateFormFieldTextarea($fieldname, $fielddata, $newfieldvalue)
{
$returnvalue = 'stringformaterror';

108
lng/czech.lng.php
View File

@@ -318,7 +318,7 @@ $lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account
$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.';
$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number';
$lng['admin']['webserver'] = 'Webový server';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="text-danger">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
/**
* Serversettings
@@ -408,7 +408,7 @@ $lng['admin']['ipsandports']['add'] = 'Přidat IP/Port';
$lng['admin']['ipsandports']['edit'] = 'Upravit IP/Port';
$lng['admin']['ipsandports']['ipandport'] = 'IP/Port';
$lng['admin']['ipsandports']['ip'] = 'IP';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="text-danger">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
$lng['admin']['ipsandports']['port'] = 'Port';
// ADDED IN 1.2.13-rc3
@@ -596,7 +596,7 @@ $lng['error']['norepymailiswrong'] = 'The "Noreply-address" is wrong. Only a val
// ADDED IN 1.2.19-svn1
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Konfigurace adresářů';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/<br /><br /><div class="red">POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.</div>';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Kde by fcgid-konfigurační soubory měly být uloženy? Pokud nepoužíváš vlastně kompilovanou suexec knihovnu, tak tato cesta musí být pod /var/www/<br /><br /><div class="text-danger">POZNÁMKA: Obsah této složky se pravidělně promazává, takže se vyhýbej manuálnímu uklání dat zde.</div>';
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Dočasný adresář';
// ADDED IN 1.2.19-svn4
@@ -705,7 +705,7 @@ $lng['admin']['caneditphpsettings'] = 'Může změnit doménové nastavení spoj
$lng['admin']['allips'] = 'Všechny IP';
$lng['panel']['nosslipsavailable'] = 'Momentálně zde nejsou žádné ssl ip/port kombinace pro tento server';
$lng['dkim']['use_dkim']['title'] = 'Aktivovat DKIM podporu?';
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="red">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="text-danger">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
$lng['error']['invalidmysqlhost'] = 'Invalid MySQL host address: %s';
$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'You cannot enable Webalizer and AWstats at the same time, please chose one of them';
$lng['serversettings']['webalizer_enabled'] = 'Povolit webalizer statistiky';
@@ -1043,12 +1043,12 @@ $lng['serversettings']['defaultttl'] = 'Domain TTL for bind in seconds (default
// ADDED IN FROXLOR 0.9.6-svn3
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Enable default errordocuments for all customers';
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL for error 401';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL for error 403';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL for error 404';
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL for error 500';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
// ADDED IN FROXLOR 0.9.6-svn5
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Default PHP configuration for new domains';
@@ -1062,7 +1062,7 @@ $lng['serversettings']['ftpserver']['desc'] = 'If pureftpd is selected the .ftpq
$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'New ftp-user created';
$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nyou have just added a new ftp-user. Here is the entered information:\n\nUsername: {USR_NAME}\nPassword: {USR_PASS}\nPath: {USR_PATH}\n\nYours sincerely, your administrator";
$lng['domains']['redirectifpathisurl'] = 'Redirect code (default: empty)';
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="red">NOTE:</strong>Changes are only applied if the given path is an URL.';
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="text-danger">NOTE:</strong>Changes are only applied if the given path is an URL.';
$lng['serversettings']['customredirect_enabled']['title'] = 'Allow customer redirects';
$lng['serversettings']['customredirect_enabled']['description'] = 'Allow customers to choose the http-status code for redirects which will be used';
$lng['serversettings']['customredirect_default']['title'] = 'Default redirect';
@@ -1142,64 +1142,14 @@ $lng['admin']['templates']['PMA_URI'] = 'Odkaz k phpMyAdmin (pokud je postytnut)
$lng['admin']['notgiven'] = '[not given]';
$lng['admin']['templates']['USR_NAME'] = 'FTP uživatelské jméno';
$lng['admin']['templates']['USR_PASS'] = 'FTP heslo';
$lng['admin']['templates']['USR_PATH'] = 'FTP homedir (relative to customer-docroot)';
// ADDED IN FROXLOR 0.9.12-svn4
$lng['serversettings']['awstats_awstatspath'] = 'Path to AWStats \'awstats.pl\'';
// ADDED IN FROXLOR 0.9.12-svn6
$lng['extras']['htpasswdauthname'] = 'Authentication reason (AuthName)';
$lng['extras']['directoryprotection_edit'] = 'edit directory protection';
$lng['admin']['templates']['forgotpwd'] = 'Notification-mails for password-reset';
$lng['admin']['templates']['password_reset'] = 'Customer-notification for passwort-reset';
$lng['admin']['store_defaultindex'] = 'Store default index-file to customers docroot';
// ADDED IN FROXLOR 0.9.14
$lng['serversettings']['mod_fcgid']['defaultini_ownvhost'] = 'Default PHP configuration for Froxlor-vHost';
$lng['serversettings']['awstats_icons']['title'] = 'Path to AWstats icons folder';
$lng['serversettings']['awstats_icons']['description'] = 'e.g. /usr/share/awstats/htdocs/icon/';
$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Path to the SSL CertificateChainFile';
$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
$lng['admin']['ipsandports']['docroot']['title'] = 'Custom docroot (empty = point to Froxlor)';
$lng['admin']['ipsandports']['docroot']['description'] = 'You can define a custom document-root (the destination for a request) for this ip/port combination here.<br /><strong>ATTENTION:</strong> Please be careful with what you enter here!';
$lng['serversettings']['login_domain_login'] = 'Allow login with domains';
$lng['panel']['unlock'] = 'Unlock';
$lng['question']['customer_reallyunlock'] = 'Do you really want to unlock customer %s?';
// ADDED IN FROXLOR 0.9.15
$lng['serversettings']['perl_server']['title'] = 'Perl umístění na serveru';
$lng['serversettings']['perl_server']['description'] = 'Default is set for using the guide found at: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
$lng['serversettings']['nginx_php_backend']['description'] = 'this is where the PHP process is listening for requests from nginx, can be a unix socket of ip:port combination<br />*NOT used with php-fpm';
$lng['serversettings']['phpreload_command']['title'] = 'PHP reload command';
$lng['serversettings']['phpreload_command']['description'] = 'this is used to reload the PHP backend if any is used<br />Default: blank<br />*NOT used with php-fpm';
// ADDED IN FROXLOR 0.9.16
$lng['error']['intvaluetoolow'] = 'Zadané číslo je přiliš malé (pole %s)';
$lng['error']['intvaluetoohigh'] = 'Zadané číslo je příliš vysoké (pole %s)';
$lng['admin']['phpfpm_settings'] = 'PHP-FPM';
$lng['serversettings']['phpfpm']['title'] = 'Zapnout php-fpm';
$lng['serversettings']['phpfpm']['description'] = '<b>This needs a special webserver configuration see FPM-handbook for <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> or <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
$lng['serversettings']['phpfpm_settings']['configdir'] = 'Configuration directory of php-fpm';
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configuration Alias-directory of php-fpm';
$lng['serversettings']['phpfpm_settings']['reload'] = 'php-fpm restart command';
$lng['serversettings']['phpfpm_settings']['pm'] = 'Process manager control (pm)';
$lng['serversettings']['phpfpm_settings']['max_children']['title'] = 'The number of child processes';
$lng['serversettings']['phpfpm_settings']['max_children']['description'] = 'The number of child processes to be created when pm is set to \'static\' and the maximum number of child processes to be created when pm is set to \'dynamic/ondemand\'<br />Equivalent to the PHP_FCGI_CHILDREN';
$lng['serversettings']['phpfpm_settings']['start_servers']['title'] = 'The number of child processes created on startup';
$lng['serversettings']['phpfpm_settings']['start_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'';
$lng['serversettings']['phpfpm_settings']['min_spare_servers']['title'] = 'The desired minimum number of idle server processes';
$lng['serversettings']['phpfpm_settings']['min_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'<br />Note: Mandatory when pm is set to \'dynamic\'';
$lng['serversettings']['phpfpm_settings']['max_spare_servers']['title'] = 'The desired maximum number of idle server processes';
$lng['serversettings']['phpfpm_settings']['max_spare_servers']['description'] = 'Note: Used only when pm is set to \'dynamic\'<br />Note: Mandatory when pm is set to \'dynamic\'';
$lng['serversettings']['phpfpm_settings']['max_requests']['title'] = 'Requests per child before respawning';
$lng['serversettings']['phpfpm_settings']['max_requests']['description'] = 'For endless request processing specify \'0\'. Equivalent to PHP_FCGI_MAX_REQUESTS.';
$lng['error']['phpfpmstillenabled'] = 'PHP-FPM is currently active. Please deactivate it before activating FCGID';
$lng['error']['fcgidstillenabled'] = 'FCGID is currently active. Please deactivate it before activating PHP-FPM';
$lng['phpfpm']['vhost_httpuser'] = 'Local user to use for PHP-FPM (Froxlor vHost)';
$lng['phpfpm']['vhost_httpgroup'] = 'Local group to use for PHP-FPM (Froxlor vHost)';
$lng['phpfpm']['ownvhost']['title'] = 'Enable PHP-FPM for the Froxlor vHost';
$lng['phpfpm']['ownvhost']['description'] = 'If enabled, Froxlor will also be running under a local user';
// ADDED IN FROXLOR 0.9.17
$lng['crondesc']['cron_usage_report'] = 'Web- and traffic-reports';
@@ -1562,7 +1512,7 @@ $lng['serversettings']['catchall_enabled']['description'] = 'Do you want to prov
// ADDED IN 0.9.28.svn6
$lng['serversettings']['apache_24']['title'] = 'Použít modifikace pro Apache 2.4';
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
$lng['serversettings']['apache_24']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Path to fastcgi_params file';
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specify the path to nginx\'s fastcgi_params file including filename';
@@ -1606,13 +1556,13 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="text-danger">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
// Added in Froxlor 0.9.30
$lng['crondesc']['cron_mailboxsize'] = 'Calculating of mailbox-sizes';
$lng['domains']['ipandport_multi']['title'] = 'IP adresa(y)';
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="red">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="text-danger">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL IP adresa(y)';
$lng['domains']['ssl_redirect']['title'] = 'SSL přesměrování';
$lng['domains']['ssl_redirect']['description'] = 'This option creates redirects for non-ssl vhosts so that all requests are redirected to the SSL-vhost.<br /><br />e.g. a request to <strong>http</strong>://domain.tld/ will redirect you to <strong>https</strong>://domain.tld/';
@@ -1696,7 +1646,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Command to execut
$lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.';
$lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.';
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="red">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="text-danger"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="text-danger">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
$lng['error']['passwordshouldnotbeusername'] = 'The password should not be the same as the username.';
// Added in Froxlor 0.9.33
@@ -1715,7 +1665,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
$lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list';
$lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.';
$lng['phpfpm']['use_mod_proxy']['title'] = 'Použít mod_proxy / mod_proxy_fcgi';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="text-danger">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['error']['no_phpinfo'] = 'Omlouváme se, ale phpinfo() nelze načíst';
$lng['admin']['movetoadmin'] = 'Přesunout zákazníka';
@@ -1737,10 +1687,10 @@ $lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID and PHP-FPM cannot be act
// Added in Froxlor 0.9.34
$lng['admin']['configfiles']['legend'] = '<h3>You are about to configure a service/daemon</h3>';
$lng['admin']['configfiles']['commands'] = '<span class="red">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
$lng['admin']['configfiles']['files'] = '<span class="red">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="red">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
$lng['admin']['configfiles']['commands'] = '<span class="text-danger">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
$lng['admin']['configfiles']['files'] = '<span class="text-danger">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="text-danger">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
$lng['serversettings']['apache_itksupport']['title'] = 'Use modifications for Apache ITK-MPM';
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
$lng['integrity_check']['databaseCharset'] = 'Character set of database (should be UTF-8)';
$lng['integrity_check']['domainIpTable'] = 'IP &lt;&dash;&gt; domain references';
$lng['integrity_check']['subdomainSslRedirect'] = 'False SSL-redirect flag for non-ssl domains';
@@ -1823,9 +1773,9 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
// Added for let's encrypt
$lng['admin']['letsencrypt']['title'] = 'Používat Let\'s Encrypt';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> This feature is still in beta.';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> This feature is still in beta.';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely';
$lng['panel']['letsencrypt'] = 'Používá Let\'s encrypt';
@@ -1885,8 +1835,8 @@ $lng['crondesc']['cron_backup'] = 'Process backup jobs';
$lng['error']['backupfunctionnotenabled'] = 'The backup function is not enabled';
$lng['serversettings']['backupenabled']['title'] = "Povolit zálohy pro zákazníky";
$lng['serversettings']['backupenabled']['description'] = "If activated, the customer will be able to schedule backup jobs (cron-backup) which generates an archive within his docroot (subdirectory chosable by customer)";
$lng['extras']['path_protection_label'] = '<strong class="red">Important</strong>';
$lng['extras']['path_protection_info'] = '<strong class="red">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
$lng['extras']['path_protection_label'] = '<strong class="text-danger">Important</strong>';
$lng['extras']['path_protection_info'] = '<strong class="text-danger">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Backup job for customer %loginname%';
$lng['error']['dns_domain_nodns'] = 'DNS pro tuto doménu je vypnuto';
@@ -1926,7 +1876,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Select i
// Added in froxlor 0.9.38-rc1
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Please note: Shell access allows the user to execute various binaries on your system. Use with extreme caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="text-danger">Please note: Shell access allows the user to execute various binaries on your system. Use with extreme caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
$lng['serversettings']['available_shells']['title'] = 'List of available shells';
$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.<br><br>Note that the default shell <strong>/bin/false</strong> will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case';
$lng['panel']['shell'] = 'Shell';
@@ -1935,8 +1885,8 @@ $lng['serversettings']['le_froxlor_enabled']['description'] = "If activated, the
$lng['serversettings']['le_froxlor_redirect']['title'] = "Enable SSL-redirect for the froxlor vhost";
$lng['serversettings']['le_froxlor_redirect']['description'] = "If activated, all http requests to your froxlor will be redirected to the corresponding SSL site.";
$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost settings';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="red">Available only for: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="red">Option not available due to other settings.</em>';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="text-danger">Available only for: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="text-danger">Option not available due to other settings.</em>';
$lng['serversettings']['letsencryptacmeconf']['title'] = "Path to the acme.conf snippet";
$lng['serversettings']['letsencryptacmeconf']['description'] = "File name of the config snippet which allows the web server to serve the acme challenge.";
$lng['admin']['hostname'] = 'Hostname';
@@ -1961,18 +1911,18 @@ $lng['admin']['domain_hsts_preload']['title'] = 'Include domain in <a href="http
$lng['admin']['domain_hsts_preload']['description'] = 'If you would like this domain to be included in the HSTS preload list maintained by Chrome (and used by Firefox and Safari), then use activate this.<br>Sending the preload directive from your site can have PERMANENT CONSEQUENCES and prevent users from accessing your site and any of its subdomains.<br>Please read the details at <a href="https://hstspreload.appspot.com/#removal" target="_blank">hstspreload.appspot.com/#removal</a> before sending the header with "preload".';
$lng['serversettings']['http2_support']['title'] = 'HTTP2 Support';
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="red">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="text-danger">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['error']['noipportgiven'] = 'No IP/port given';
// Added in froxlor 0.9.38.8
$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling';
$lng['admin']['domain_ocsp_stapling']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/OCSP_stapling">Wikipedia</a> for a detailed explanation of OCSP stapling';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="red">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="text-danger">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: path to the OCSP stapling cache';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Configures the cache used to store OCSP responses which get included in TLS handshakes.';
$lng['serversettings']['nssextrausers']['title'] = 'Use libnss-extrausers instead of libnss-mysql';
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="red">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="text-danger">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
$lng['admin']['domain_http2']['title'] = 'HTTP2 support';
$lng['admin']['domain_http2']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/HTTP/2">Wikipedia</a> for a detailed explanation of HTTP2';
$lng['admin']['testmail'] = 'SMTP test';
@@ -2012,7 +1962,7 @@ $lng['question']['plan_reallydelete'] = 'Do you really want to delete the hostin
$lng['admin']['notryfiles']['title'] = 'No autogenerated try_files';
$lng['admin']['notryfiles']['description'] = 'Say yes here if you want to specify a custom try_files directive in specialsettings (needed for some wordpress plugins for example).';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Override FPM-daemon settings (pm, max_children, etc.)';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="red">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="text-danger">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
$lng['panel']['backuppath']['title'] = 'Destination path for the backup';
$lng['panel']['backuppath']['description'] = 'This is the path where the backups will be stored. If backup of web-data is selected, all files from the homedir are stored excluding the backup-folder specified here.';
@@ -2032,7 +1982,7 @@ $lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD';
$lng['serversettings']['enable_api']['title'] = 'Enable external API usage';
$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
$lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <code>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096</code>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['2fa']['2fa'] = '2FA možnosti';
$lng['2fa']['2fa_enabled'] = 'Aktivovat dvoufázové ověření (2FA)';
$lng['login']['2fa'] = 'Dvoufázové ověření (2FA)';
@@ -2057,7 +2007,7 @@ $lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted th
$lng['panel']['alternative_cmdline_config'] = 'Alternatively, just run the following command as root-user in your shell to configure the services automatically';
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database';
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%';
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
$lng['admin']['novhostcontainer'] = '<br><br><small class="text-danger">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
$lng['serversettings']['errorlog_level']['title'] = 'Error log-level';
$lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.';
$lng['serversettings']['letsencryptecc']['title'] = "Issue ECC / ECDSA certificate";

6
lng/dutch.lng.php
View File

@@ -953,12 +953,12 @@ $lng['serversettings']['defaultttl'] = 'Standaard TTL voor domeinen in seconden
// ADDED IN FROXLOR 0.9.6-svn3
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Standaard foutdocumenten voor alle klanten activeren';
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'Bestand/URL voor foutcode 401';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Wordt niet ondersteund in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Wordt niet ondersteund in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'Bestand/URL voor foutcode 403';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Wordt niet ondersteund in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Wordt niet ondersteund in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'Bestand/URL voor foutcode 404';
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'Bestand/URL voor foutcode 500';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Wordt niet ondersteund in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Wordt niet ondersteund in: lighttpd</div>';
// ADDED IN FROXLOR 0.9.6-svn5
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Standaard PHP-configuratie voor nieuwe domeinen';

54
lng/english.lng.php
View File

@@ -322,7 +322,7 @@ $lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account
$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.';
$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number';
$lng['admin']['webserver'] = 'Webserver';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="text-danger">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
/**
* Serversettings
@@ -412,7 +412,7 @@ $lng['admin']['ipsandports']['add'] = 'Add IP/Port';
$lng['admin']['ipsandports']['edit'] = 'Edit IP/Port';
$lng['admin']['ipsandports']['ipandport'] = 'IP/Port';
$lng['admin']['ipsandports']['ip'] = 'IP';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="text-danger">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
$lng['admin']['ipsandports']['port'] = 'Port';
// ADDED IN 1.2.13-rc3
@@ -600,7 +600,7 @@ $lng['error']['norepymailiswrong'] = 'The "Noreply-address" is wrong. Only a val
// ADDED IN 1.2.19-svn1
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Configuration directory';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Where should all fcgid-configuration files be stored? If you don\'t use a self compiled suexec binary, which is the normal situation, this path must be under /var/www/<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Where should all fcgid-configuration files be stored? If you don\'t use a self compiled suexec binary, which is the normal situation, this path must be under /var/www/<br /><br /><div class="text-danger">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Temp directory';
// ADDED IN 1.2.19-svn4
@@ -711,7 +711,7 @@ $lng['admin']['caneditphpsettings'] = 'Can change php-related domain settings?';
$lng['admin']['allips'] = 'All IP\'s';
$lng['panel']['nosslipsavailable'] = 'There are currently no ssl ip/port combinations for this server';
$lng['dkim']['use_dkim']['title'] = 'Activate DKIM support?';
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="red">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
$lng['dkim']['use_dkim']['description'] = 'Would you like to use the Domain Keys (DKIM) system?<br/><em class="text-danger">Note: DKIM is only supported using dkim-filter, not opendkim (yet)</em>';
$lng['error']['invalidmysqlhost'] = 'Invalid MySQL host address: %s';
$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'You cannot enable Webalizer and AWstats at the same time, please chose one of them';
$lng['serversettings']['webalizer_enabled'] = 'Enable webalizer statistics';
@@ -1049,12 +1049,12 @@ $lng['serversettings']['defaultttl'] = 'Domain TTL for bind in seconds (default
// ADDED IN FROXLOR 0.9.6-svn3
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Enable default errordocuments for all customers';
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL for error 401';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL for error 403';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL for error 404';
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL for error 500';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Not supported in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Not supported in: lighttpd</div>';
// ADDED IN FROXLOR 0.9.6-svn5
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Default PHP configuration for new domains';
@@ -1068,7 +1068,7 @@ $lng['serversettings']['ftpserver']['desc'] = 'If pureftpd is selected the .ftpq
$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'New ftp-user created';
$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hello {CUST_NAME},\n\nyou have just added a new ftp-user. Here is the entered information:\n\nUsername: {USR_NAME}\nPassword: {USR_PASS}\nPath: {USR_PATH}\n\nYours sincerely, your administrator";
$lng['domains']['redirectifpathisurl'] = 'Redirect code (default: empty)';
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="red">NOTE:</strong>Changes are only applied if the given path is an URL.';
$lng['domains']['redirectifpathisurlinfo'] = 'You only need to select one of these if you entered an URL as path<br/><strong class="text-danger">NOTE:</strong>Changes are only applied if the given path is an URL.';
$lng['serversettings']['customredirect_enabled']['title'] = 'Allow customer redirects';
$lng['serversettings']['customredirect_enabled']['description'] = 'Allow customers to choose the http-status code for redirects which will be used';
$lng['serversettings']['customredirect_default']['title'] = 'Default redirect';
@@ -1185,7 +1185,7 @@ $lng['error']['intvaluetoolow'] = 'The given number is too low (field %s)';
$lng['error']['intvaluetoohigh'] = 'The given number is too high (field %s)';
$lng['admin']['phpfpm_settings'] = 'PHP-FPM';
$lng['serversettings']['phpfpm']['title'] = 'Enable php-fpm';
$lng['serversettings']['phpfpm']['description'] = '<b>This needs a special webserver configuration see FPM-handbook for <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> or <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
$lng['serversettings']['phpfpm']['description'] = '<b>This needs a special webserver configuration see <a target="_blank" href="https://docs.froxlor.org/general/configuration/php-fpm.html">PHP-FPM handbook</a></b>';
$lng['serversettings']['phpfpm_settings']['configdir'] = 'Configuration directory of php-fpm';
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configuration Alias-directory of php-fpm';
$lng['serversettings']['phpfpm_settings']['reload'] = 'php-fpm restart command';
@@ -1568,7 +1568,7 @@ $lng['serversettings']['catchall_enabled']['description'] = 'Do you want to prov
// ADDED IN 0.9.28.svn6
$lng['serversettings']['apache_24']['title'] = 'Use modifications for Apache 2.4';
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
$lng['serversettings']['apache_24']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache version 2.4 or higher installed<br />otherwise your webserver will not be able to start';
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Path to fastcgi_params file';
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specify the path to nginx\'s fastcgi_params file including filename';
@@ -1614,13 +1614,13 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="text-danger">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
// Added in Froxlor 0.9.30
$lng['crondesc']['cron_mailboxsize'] = 'Calculating of mailbox-sizes';
$lng['domains']['ipandport_multi']['title'] = 'IP address(es)';
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="red">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
$lng['domains']['ipandport_multi']['description'] = 'Specify one or more IP address for the domain.<br /><br /><div class="text-danger">NOTE: IP addresses cannot be changed when the domain is configured as <strong>alias-domain</strong> of another domain.</div>';
$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL IP address(es)';
$lng['domains']['ssl_redirect']['title'] = 'SSL redirect';
$lng['domains']['ssl_redirect']['description'] = 'This option creates redirects for non-ssl vhosts so that all requests are redirected to the SSL-vhost.<br /><br />e.g. a request to <strong>http</strong>://domain.tld/ will redirect you to <strong>https</strong>://domain.tld/';
@@ -1704,7 +1704,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Command to execut
$lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.';
$lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.';
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="red">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="text-danger"><b>ATTENTION:</b></div> This settings allows the cronjob to bypass the version-check of froxlors files and database and runs the database-updates in case a version-mismatch occurs.<br><br><div class="text-danger">Auto-update will always set default values for new settings or changes. This might not always suite your system. Please think twice before activating this option</div>';
$lng['error']['passwordshouldnotbeusername'] = 'The password should not be the same as the username.';
// Added in Froxlor 0.9.33
@@ -1723,7 +1723,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
$lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list';
$lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.';
$lng['phpfpm']['use_mod_proxy']['title'] = 'Use mod_proxy / mod_proxy_fcgi';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch) or newer</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="text-danger">Must be enabled when using Debian 9.x (Stretch) or newer</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['error']['no_phpinfo'] = 'Sorry, unable to read phpinfo()';
$lng['admin']['movetoadmin'] = 'Move customer';
@@ -1745,10 +1745,10 @@ $lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID and PHP-FPM cannot be act
// Added in Froxlor 0.9.34
$lng['admin']['configfiles']['legend'] = '<h3>You are about to configure a service/daemon</h3>';
$lng['admin']['configfiles']['commands'] = '<span class="red">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
$lng['admin']['configfiles']['files'] = '<span class="red">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="red">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
$lng['admin']['configfiles']['commands'] = '<span class="text-danger">Commands:</span> These commands are to be executed line by line as root-user in a shell. It is safe to copy the whole block and paste it into the shell.';
$lng['admin']['configfiles']['files'] = '<span class="text-danger">Config files:</span> The commands before the textfields should open an editor with the target file. Just copy and paste the contents into the editor and save the file.<br><span class="text-danger">Please note:</span> The MySQL-password has not been replaced for security reasons. Please replace "FROXLOR_MYSQL_PASSWORD" on your own or use the javascript form below to replace it on-site. If you forgot your MySQL-password you\'ll find it in "lib/userdata.inc.php"';
$lng['serversettings']['apache_itksupport']['title'] = 'Use modifications for Apache ITK-MPM';
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="red">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
$lng['serversettings']['apache_itksupport']['description'] = '<strong class="text-danger">ATTENTION:</strong> use only if you actually have apache itk-mpm enabled<br />otherwise your webserver will not be able to start';
$lng['integrity_check']['databaseCharset'] = 'Character set of database (should be UTF-8)';
$lng['integrity_check']['domainIpTable'] = 'IP &lt;&dash;&gt; domain references';
$lng['integrity_check']['subdomainSslRedirect'] = 'False SSL-redirect flag for non-ssl domains';
@@ -1831,7 +1831,7 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
// Added for let's encrypt
$lng['admin']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="text-danger">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
@@ -1935,7 +1935,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Select i
// Added in froxlor 0.9.38-rc1
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Allow customers to enable shell access for ftp-users';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Please note: Shell access allows the user to execute various binaries on your system. Use with extrem caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="text-danger">Please note: Shell access allows the user to execute various binaries on your system. Use with extrem caution. Please only activate this if you REALLY know what you are doing!!!</strong>';
$lng['serversettings']['available_shells']['title'] = 'List of available shells';
$lng['serversettings']['available_shells']['description'] = 'Comma separated list of shells that are available for the customer to chose from for their ftp-users.<br><br>Note that the default shell <strong>/bin/false</strong> will always be a choice (if enabled), even if this setting is empty. It is the default value for ftp-users in any case';
$lng['panel']['shell'] = 'Shell';
@@ -1944,8 +1944,8 @@ $lng['serversettings']['le_froxlor_enabled']['description'] = "If activated, the
$lng['serversettings']['le_froxlor_redirect']['title'] = "Enable SSL-redirect for the froxlor vhost";
$lng['serversettings']['le_froxlor_redirect']['description'] = "If activated, all http requests to your froxlor will be redirected to the corresponding SSL site.";
$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost settings';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="red">Available only for: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="red">Option not available due to other settings.</em>';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="text-danger">Available only for: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="text-danger">Option not available due to other settings.</em>';
$lng['serversettings']['letsencryptacmeconf']['title'] = "Path to the acme.conf snippet";
$lng['serversettings']['letsencryptacmeconf']['description'] = "File name of the config snippet which allows the web server to serve the acme challenge.";
$lng['admin']['hostname'] = 'Hostname';
@@ -1970,18 +1970,18 @@ $lng['admin']['domain_hsts_preload']['title'] = 'Include domain in <a href="http
$lng['admin']['domain_hsts_preload']['description'] = 'If you would like this domain to be included in the HSTS preload list maintained by Chrome (and used by Firefox and Safari), then use activate this.<br>Sending the preload directive from your site can have PERMANENT CONSEQUENCES and prevent users from accessing your site and any of its subdomains.<br>Please read the details at <a href="https://hstspreload.appspot.com/#removal" target="_blank">hstspreload.appspot.com/#removal</a> before sending the header with "preload".';
$lng['serversettings']['http2_support']['title'] = 'HTTP2 Support';
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="red">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['serversettings']['http2_support']['description'] = 'enable HTTP2 support for ssl.<br><em class="text-danger">ENABLE ONLY IF YOUR WEBSERVER SUPPORTS THIS FEATURE (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['error']['noipportgiven'] = 'No IP/port given';
// Added in froxlor 0.9.38.8
$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling';
$lng['admin']['domain_ocsp_stapling']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/OCSP_stapling">Wikipedia</a> for a detailed explanation of OCSP stapling';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="red">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="text-danger">WARNING:</strong> Nginx version 1.3.7 or above is required for OCSP stapling. If your version is older, the webserver will NOT start correctly while OCSP stapling is enabled!';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: path to the OCSP stapling cache';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Configures the cache used to store OCSP responses which get included in TLS handshakes.';
$lng['serversettings']['nssextrausers']['title'] = 'Use libnss-extrausers instead of libnss-mysql';
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="red">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
$lng['serversettings']['nssextrausers']['description'] = 'Do not read users from the database but from files. Please only activate if you have already gone through the required configuration steps (system -> libnss-extrausers).<br><strong class="text-danger">For Debian/Ubuntu only (or if you have compiled libnss-extrausers yourself!)</strong>';
$lng['admin']['domain_http2']['title'] = 'HTTP2 support';
$lng['admin']['domain_http2']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/HTTP/2">Wikipedia</a> for a detailed explanation of HTTP2';
$lng['admin']['testmail'] = 'SMTP test';
@@ -2021,7 +2021,7 @@ $lng['question']['plan_reallydelete'] = 'Do you really want to delete the hostin
$lng['admin']['notryfiles']['title'] = 'No autogenerated try_files';
$lng['admin']['notryfiles']['description'] = 'Say yes here if you want to specify a custom try_files directive in specialsettings (needed for some wordpress plugins for example).';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Override FPM-daemon settings (pm, max_children, etc.)';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="red">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="text-danger">Only used if "Override FPM-daemon settings" is set to "Yes"</span>';
$lng['panel']['backuppath']['title'] = 'Destination path for the backup';
$lng['panel']['backuppath']['description'] = 'This is the path where the backups will be stored. If backup of web-data is selected, all files from the homedir are stored excluding the backup-folder specified here.';
@@ -2041,7 +2041,7 @@ $lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD';
$lng['serversettings']['enable_api']['title'] = 'Enable external API usage';
$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
$lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/ssl/webserver/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/ssl/webserver/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <code>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096</code>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['2fa']['2fa'] = '2FA options';
$lng['2fa']['2fa_enabled'] = 'Activate Two-factor authentication (2FA)';
$lng['login']['2fa'] = 'Two-factor authentication (2FA)';
@@ -2066,7 +2066,7 @@ $lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted th
$lng['panel']['alternative_cmdline_config'] = 'Alternatively, just run the following command as root-user in your shell to configure the services automatically';
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database';
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%';
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
$lng['admin']['novhostcontainer'] = '<br><br><small class="text-danger">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
$lng['serversettings']['errorlog_level']['title'] = 'Error log-level';
$lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.';
$lng['serversettings']['letsencryptecc']['title'] = "Issue ECC / ECDSA certificate";

54
lng/german.lng.php
View File

@@ -317,7 +317,7 @@ $lng['admin']['templates']['USERNAME'] = 'Wird mit dem Benutzernamen des neuen K
$lng['admin']['templates']['PASSWORD'] = 'Wird mit dem Passwort des neuen Kundenkontos ersetzt.';
$lng['admin']['templates']['EMAIL'] = 'Wird mit der Adresse des neuen E-Mail-Kontos ersetzt.';
$lng['admin']['templates']['CUSTOMER_NO'] = 'Wir mit der Kunden-Nummer ersetzt';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">WARNUNG:</strong> Bei der Verwendung einer Zonendatei müssen alle benötigten Records aller Subdomains ebenfalls manuell verwaltet werden.';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="text-danger">WARNUNG:</strong> Bei der Verwendung einer Zonendatei müssen alle benötigten Records aller Subdomains ebenfalls manuell verwaltet werden.';
/**
* Serversettings
@@ -406,7 +406,7 @@ $lng['admin']['ipsandports']['add'] = 'IP-Adresse/Port hinzufügen';
$lng['admin']['ipsandports']['edit'] = 'IP-Adresse/Port bearbeiten';
$lng['admin']['ipsandports']['ipandport'] = 'IP-Adresse/Port';
$lng['admin']['ipsandports']['ip'] = 'IP-Adresse';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Hinweis: Obwohl private IP Adressen erlaubt sind, kann es bei manchen Features wie DNS zu ungewolltem Verhalten kommen.<br>Verwende private Adressen nur wenn du sicher bist.</div>';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="text-danger">Hinweis: Obwohl private IP Adressen erlaubt sind, kann es bei manchen Features wie DNS zu ungewolltem Verhalten kommen.<br>Verwende private Adressen nur wenn du sicher bist.</div>';
$lng['admin']['ipsandports']['port'] = 'Port';
// ADDED IN 1.2.13-rc3
@@ -593,7 +593,7 @@ $lng['admin']['domain_nocustomeraddingavailable'] = 'Es können derzeit keine Do
// ADDED IN 1.2.19-svn
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Konfigurations-Verzeichnis';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Wo sollen alle Konfigurationsdateien von fcgid liegen? Wenn Sie keine selbst kompilierte suexec Binary benutzen, was in der Regel der Fall ist, muss dieser Pfad unter /var/www/ liegen.<br /><br /><div class="red">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Wo sollen alle Konfigurationsdateien von fcgid liegen? Wenn Sie keine selbst kompilierte suexec Binary benutzen, was in der Regel der Fall ist, muss dieser Pfad unter /var/www/ liegen.<br /><br /><div class="text-danger">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Temporäres Verzeichnis';
// ADDED IN 1.2.19-svn4
@@ -704,7 +704,7 @@ $lng['admin']['caneditphpsettings'] = 'Kann PHP-bezogene Domaineinstellungen vor
$lng['admin']['allips'] = 'Alle IP-Adressen';
$lng['panel']['nosslipsavailable'] = 'Für diesen Server wurden noch keine SSL IP/Port Kombinationen eingetragen';
$lng['dkim']['use_dkim']['title'] = 'DKIM-Support aktivieren?';
$lng['dkim']['use_dkim']['description'] = 'Wollen Sie das Domain-Keys-System (DKIM) benutzen?<br/><em class="red">Hinweis: Derzeit wird DKIM nur via dkim-filter unterstützt, nicht opendkim.</em>';
$lng['dkim']['use_dkim']['description'] = 'Wollen Sie das Domain-Keys-System (DKIM) benutzen?<br/><em class="text-danger">Hinweis: Derzeit wird DKIM nur via dkim-filter unterstützt, nicht opendkim.</em>';
$lng['error']['invalidmysqlhost'] = 'Ungültige MySQL-Host-Adresse: "%s"';
$lng['error']['cannotuseawstatsandwebalizeratonetime'] = 'Webalizer und AWstats können nicht zur gleichen Zeit aktiviert werden, bitte wählen Sie eines aus.';
$lng['serversettings']['webalizer_enabled'] = 'Nutze Webalizer-Statistiken';
@@ -1038,12 +1038,12 @@ $lng['serversettings']['defaultttl'] = 'Domain TTL für Bind in Sekunden (defaul
// ADDED IN FROXLOR 0.9.6-svn3
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Verwende Standard-Fehlerdokumente für alle Kunden';
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'Datei/URL für Fehler 401';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Nicht unterstützt in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Nicht unterstützt in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'Datei/URL für Fehler 403';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Nicht unterstützt in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Nicht unterstützt in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'Datei/URL für Fehler 404';
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'Datei/URL für Fehler 500';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Nicht unterstützt in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Nicht unterstützt in: lighttpd</div>';
// ADDED IN FROXLOR 0.9.6-svn5
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Voreingestellte PHP-Konfiguration für neue Domains';
@@ -1057,7 +1057,7 @@ $lng['serversettings']['ftpserver']['desc'] = 'Wenn pureftpd ausgewählt ist, we
$lng['mails']['new_ftpaccount_by_customer']['subject'] = 'Neuer FTP-Benutzer erstellt';
$lng['mails']['new_ftpaccount_by_customer']['mailbody'] = "Hallo {CUST_NAME},\n\ndu hast gerade einen neuen FTP-Benutzer angelegt. Hier die angegebenen Informationen:\n\nBenutzername: {USR_NAME}\nPasswort: {USR_PASS}\nPfad: {USR_PATH}\n\nVielen Dank, Ihr Administrator";
$lng['domains']['redirectifpathisurl'] = 'Redirect-Code (Standard: leer)';
$lng['domains']['redirectifpathisurlinfo'] = 'Der Redirect-Code kann gewählt werden, wenn der eingegebene Pfad eine URL ist.<br/><strong class="red">HINWEIS:</strong>Änderungen werden nur wirksam wenn der Pfad eine URL ist.';
$lng['domains']['redirectifpathisurlinfo'] = 'Der Redirect-Code kann gewählt werden, wenn der eingegebene Pfad eine URL ist.<br/><strong class="text-danger">HINWEIS:</strong>Änderungen werden nur wirksam wenn der Pfad eine URL ist.';
$lng['serversettings']['customredirect_enabled']['title'] = 'Erlaube Kunden-Redirect';
$lng['serversettings']['customredirect_enabled']['description'] = 'Erlaubt es Kunden den HTTP-Status Code für einen Redirect zu wählen';
$lng['serversettings']['customredirect_default']['title'] = 'Standard-Redirect';
@@ -1161,7 +1161,7 @@ $lng['error']['intvaluetoolow'] = 'Die angegebene Zahl ist zu klein (Feld "%s")'
$lng['error']['intvaluetoohigh'] = 'Die angegebene Zahl ist zu groß (Feld "%s")';
$lng['admin']['phpfpm_settings'] = 'PHP-FPM';
$lng['serversettings']['phpfpm']['title'] = 'Aktiviere PHP-FPM';
$lng['serversettings']['phpfpm']['description'] = '<b>Dies benötigt eine spezielle Webserver-Konfiguration, siehe FPM-Handbuch für <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> oder <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
$lng['serversettings']['phpfpm']['description'] = '<b>Dies benötigt eine spezielle Webserver-Konfiguration, siehe <a target="_blank" href="https://docs.froxlor.org/general/configuration/php-fpm.html">PHP-FPM Handbuch</a></b>';
$lng['serversettings']['phpfpm_settings']['configdir'] = 'Pfad zu php-fpm-Konfigurationen';
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Alias-Ordner der php-fpm Konfiguration';
$lng['serversettings']['phpfpm_settings']['reload'] = 'Kommando zum Neustarten von php-fpm';
@@ -1292,7 +1292,7 @@ $lng['serversettings']['catchall_enabled']['description'] = 'Möchten Sie Ihren
// ADDED IN 0.9.28.svn6
$lng['serversettings']['apache_24']['title'] = 'Anpassungen für Apache 2.4 verwenden';
$lng['serversettings']['apache_24']['description'] = '<div class="red">Achtung: Bitte nur verwenden, wenn wirklich Apache mit Version 2.4 oder höher installiert ist, ansonsten wird der Webserver nicht starten.</div>';
$lng['serversettings']['apache_24']['description'] = '<div class="text-danger">Achtung: Bitte nur verwenden, wenn wirklich Apache mit Version 2.4 oder höher installiert ist, ansonsten wird der Webserver nicht starten.</div>';
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Pfad zur fastcgi_params Datei';
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Geben Sie den Pfad zu nginx\'s fastcgi_params Datei an. Inklusive Dateiname!';
@@ -1338,13 +1338,13 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'Der angegebene Key (Private
$lng['error']['sslcertificateinvalidca'] = 'Das angegebene CA-Zertifikat scheint nicht gültig zu sein.';
$lng['error']['sslcertificateinvalidchain'] = 'Das angegebene CertificateChainFile scheint nicht gültig zu sein.';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver-Kunden-SSL-Zertifikatsverzeichnis';
$lng['serversettings']['customerssl_directory']['description'] = 'Wo sollen kundenspezifizierte SSL-Zertifikate erstellt werden?<br /><br /><div class="red">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Wo sollen kundenspezifizierte SSL-Zertifikate erstellt werden?<br /><br /><div class="text-danger">ACHTUNG: Der Inhalt dieses Ordners wird regelmäßig geleert, daher sollten dort keinerlei Daten manuell abgelegt werden.</div>';
$lng['admin']['phpfpm.ininote'] = 'Nicht alle gewünschten Werte können in der php-fpm-pool-Konfiguration verwendet werden.';
// Added in Froxlor 0.9.30
$lng['crondesc']['cron_mailboxsize'] = 'Berechnung der Mailbox-Größen';
$lng['domains']['ipandport_multi']['title'] = 'IP-Adresse(n)';
$lng['domains']['ipandport_multi']['description'] = 'Definieren Sie eine oder mehrere IP-Adresse(n) für diese Domain.<br /><br /><div class="red">Hinweis: Die IP-Adressen können nicht geändert werden, sollte die Domain als <strong>Alias-Domain</strong> für eine andere Domain konfiguriert worden sein.</div>';
$lng['domains']['ipandport_multi']['description'] = 'Definieren Sie eine oder mehrere IP-Adresse(n) für diese Domain.<br /><br /><div class="text-danger">Hinweis: Die IP-Adressen können nicht geändert werden, sollte die Domain als <strong>Alias-Domain</strong> für eine andere Domain konfiguriert worden sein.</div>';
$lng['domains']['ipandport_ssl_multi']['title'] = 'SSL-IP-Adresse(n)';
$lng['domains']['ssl_redirect']['title'] = 'SSL-Weiterleitung';
$lng['domains']['ssl_redirect']['description'] = 'Diese Option erstellt für alle Nicht-SSL-vHosts eine Weiterleitung (Redirect), so dass alle Anfragen an den SSL-vHost übermittelt werden (z. B. würde eine Anfrage an <strong>http</strong>://domain.tld/ weitergeleitet werden zu <strong>https</strong>://domain.tld/).';
@@ -1427,7 +1427,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Befehl zum Ausfü
$lng['error']['cannotdeletehostnamephpconfig'] = 'Diese PHP-Konfiguration ist dem Froxlor-Vhost zugewiesen und kann daher nicht gelöscht werden.';
$lng['error']['cannotdeletedefaultphpconfig'] = 'Diese PHP-Konfiguration ist als Standard hinterlegt und kann daher nicht gelöscht werden.';
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Erlaube automatische Datenbank-Aktualisierungen';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<strong class="red">WARNUNG:</strong> Diese Einstellung erlaubt es dem Cronjob die Prüfung der Dateien- und Datenbank-Version zu umgehen und bei einem Versions-Unterschied die Datenbank-Aktualisierungen automatisiert auszuführen.<br /><br/><div class="red">Das automatische Update setzt für neue Einstellungen und Änderungen immer die default-Werte. Diese müssen nicht zwingend zu dem genutzten System passen. Bitte zwei mal nachdenken, bevor diese Option aktiviert wird.</div>';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<strong class="text-danger">WARNUNG:</strong> Diese Einstellung erlaubt es dem Cronjob die Prüfung der Dateien- und Datenbank-Version zu umgehen und bei einem Versions-Unterschied die Datenbank-Aktualisierungen automatisiert auszuführen.<br /><br/><div class="text-danger">Das automatische Update setzt für neue Einstellungen und Änderungen immer die default-Werte. Diese müssen nicht zwingend zu dem genutzten System passen. Bitte zwei mal nachdenken, bevor diese Option aktiviert wird.</div>';
$lng['error']['passwordshouldnotbeusername'] = 'Das Passwort sollte nicht mit dem Benutzernamen übereinstimmen.';
// Added in Froxlor 0.9.33
@@ -1446,7 +1446,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
$lng['serversettings']['panel_password_special_char']['title'] = 'Sonderzeichen-Liste';
$lng['serversettings']['panel_password_special_char']['description'] = 'Mindestens eines dieser Sonderzeichen muss in dem Passwort vorkommen, sofern die Sonderzeichen-Option aktiviert ist.';
$lng['phpfpm']['use_mod_proxy']['title'] = 'Verwende mod_proxy / mod_proxy_fcgi';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Muss gesetzt sein bei Debian 9.x (Stretch) oder neuer</strong>. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="text-danger">Muss gesetzt sein bei Debian 9.x (Stretch) oder neuer</strong>. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus';
$lng['error']['no_phpinfo'] = 'Entschuldigung, es ist nicht möglich die phpinfo() auszulesen.';
$lng['admin']['movetoadmin'] = 'Kunde verschieben';
@@ -1468,10 +1468,10 @@ $lng['error']['fcgidandphpfpmnogoodtogether'] = 'FCGID und PHP-FPM können nicht
// Added in Froxlor 0.9.34
$lng['admin']['configfiles']['legend'] = '<h3>Sie konfigurieren nun einen Service/Daemon.</h3>';
$lng['admin']['configfiles']['commands'] = '<span class="red">Kommandos:</span> Die angezeigten Befehle müssen als Benutzer root in einer Shell ausgeführt werden. Es kann auch problemlos der ganze Block kopiert und in die Shell eingefügt werden.';
$lng['admin']['configfiles']['files'] = '<span class="red">Konfigurationsdateien:</span> Der Befehl direkt vor dem Textfeld sollte einen Editor mit der Zieldatei öffnen. Der Inhalt kann nun einfach kopiert und in den Editor eingefügt und die Datei gespeichert werden.<br><span class="red">Bitte beachten:</span> Das MySQL-Passwort wurde aus Sicherheitsgründen nicht ersetzt. Bitte ersetzen Sie "FROXLOR_MYSQL_PASSWORD" manuell oder nutzen Sie das folgende Formular, um es temporär auf dieser Seite zu setzen. Falls das Passwort vergessen wurde, findet es sich in der Datei "lib/userdata.inc.php".';
$lng['admin']['configfiles']['commands'] = '<span class="text-danger">Kommandos:</span> Die angezeigten Befehle müssen als Benutzer root in einer Shell ausgeführt werden. Es kann auch problemlos der ganze Block kopiert und in die Shell eingefügt werden.';
$lng['admin']['configfiles']['files'] = '<span class="text-danger">Konfigurationsdateien:</span> Der Befehl direkt vor dem Textfeld sollte einen Editor mit der Zieldatei öffnen. Der Inhalt kann nun einfach kopiert und in den Editor eingefügt und die Datei gespeichert werden.<br><span class="text-danger">Bitte beachten:</span> Das MySQL-Passwort wurde aus Sicherheitsgründen nicht ersetzt. Bitte ersetzen Sie "FROXLOR_MYSQL_PASSWORD" manuell oder nutzen Sie das folgende Formular, um es temporär auf dieser Seite zu setzen. Falls das Passwort vergessen wurde, findet es sich in der Datei "lib/userdata.inc.php".';
$lng['serversettings']['apache_itksupport']['title'] = 'Anpassungen für Apache ITK-MPM verwenden';
$lng['serversettings']['apache_itksupport']['description'] = '<div class="red">Achtung: Bitte nur verwenden, wenn wirklich Apache itk-mpm verwendet wird, ansonsten wird der Webserver nicht starten.</div>';
$lng['serversettings']['apache_itksupport']['description'] = '<div class="text-danger">Achtung: Bitte nur verwenden, wenn wirklich Apache itk-mpm verwendet wird, ansonsten wird der Webserver nicht starten.</div>';
$lng['integrity_check']['databaseCharset'] = 'Characterset der Datenbank (sollte UTF-8 sein)';
$lng['integrity_check']['domainIpTable'] = 'IP &lt;&dash;&gt; Domain Verkn&uuml;pfung';
$lng['integrity_check']['subdomainSslRedirect'] = 'Falsches SSL-redirect Flag bei nicht-SSL Domains';
@@ -1482,7 +1482,7 @@ $lng['admin']['mod_fcgid_umask']['title'] = 'Umask (Standard: 022)';
// Added for let's encrypt
$lng['admin']['letsencrypt']['title'] = 'SSL Zertifikat erstellen (Let\'s Encrypt)';
$lng['admin']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von <a href="https://letsencrypt.org">Let\'s Encrypt</a>. Das Zertifikat wird automatisch erstellt und verlängert.<br><strong class="red">ACHTUNG:</strong> Wenn Wildcards aktiviert sind, wird diese Option automatisch deaktiviert.';
$lng['admin']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von <a href="https://letsencrypt.org">Let\'s Encrypt</a>. Das Zertifikat wird automatisch erstellt und verlängert.<br><strong class="text-danger">ACHTUNG:</strong> Wenn Wildcards aktiviert sind, wird diese Option automatisch deaktiviert.';
$lng['customer']['letsencrypt']['title'] = 'SSL Zertifikat erstellen (Let\'s Encrypt)';
$lng['customer']['letsencrypt']['description'] = 'Holt ein kostenloses Zertifikat von <a href="https://letsencrypt.org">Let\'s Encrypt</a>. Das Zertifikat wird automatisch erstellt und verlängert.';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Die Nutzung von Let\'s Encrypt ist nur möglich, wenn die Domain mindestens eine IP/Port - Kombination mit aktiviertem SSL zugewiesen hat.';
@@ -1585,7 +1585,7 @@ $lng['serversettings']['panel_customer_hide_options']['description'] = 'Wählen
// Added in froxlor 0.9.38-rc1
$lng['serversettings']['allow_allow_customer_shell']['title'] = 'Erlaube Kunden für FTP Benutzer eine Shell auszuwählen';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="red">Bitte beachten: Shell Zugriff gestattet dem Benutzer verschiedene Programme auf Ihrem System auszuführen. Mit großer Vorsicht verwenden. Bitte aktiviere dies nur wenn WIRKLICH bekannt ist, was das bedeutet!!!</strong>';
$lng['serversettings']['allow_allow_customer_shell']['description'] = '<strong class="text-danger">Bitte beachten: Shell Zugriff gestattet dem Benutzer verschiedene Programme auf Ihrem System auszuführen. Mit großer Vorsicht verwenden. Bitte aktiviere dies nur wenn WIRKLICH bekannt ist, was das bedeutet!!!</strong>';
$lng['serversettings']['available_shells']['title'] = 'Liste der verfügbaren Shells';
$lng['serversettings']['available_shells']['description'] = 'Komma-getrennte Liste von Shells, die der Kunde für seine FTP-Konten wählen kann.<br><br>Hinweis: Die Standard-Shell <strong>/bin/false</strong> wird immer eine Auswahlmöglichkeit sein (wenn aktiviert), auch wenn diese Einstellung leer ist. Sie ist in jedem Fall der Standardwert für alle FTP-Konten';
$lng['serversettings']['le_froxlor_enabled']['title'] = "Let's Encrypt für den froxlor Vhost verwenden";
@@ -1593,8 +1593,8 @@ $lng['serversettings']['le_froxlor_enabled']['description'] = "Wenn dies aktivie
$lng['serversettings']['le_froxlor_redirect']['title'] = "SSL-Weiterleitung für den froxlor Vhost aktivieren";
$lng['serversettings']['le_froxlor_redirect']['description'] = "Wenn dies aktiviert ist, werden alle HTTP Anfragen an die entsprechende SSL Seite weitergeleitet.";
$lng['admin']['froxlorvhost'] = 'Froxlor VirtualHost Einstellungen';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="red">Nur verfügbar für: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="red">Option aufgrund anderer Einstellungen nicht verfügbar.</em>';
$lng['serversettings']['option_unavailable_websrv'] = '<br><em class="text-danger">Nur verfügbar für: %s</em>';
$lng['serversettings']['option_unavailable'] = '<br><em class="text-danger">Option aufgrund anderer Einstellungen nicht verfügbar.</em>';
$lng['serversettings']['letsencryptacmeconf']['title'] = "Pfad zu acme.conf";
$lng['serversettings']['letsencryptacmeconf']['description'] = "Dateiname der Konfiguration, die dem Webserver erlaubt, die ACME-Challenges zu bedienen.";
$lng['admin']['hostname'] = 'Hostname';
@@ -1619,18 +1619,18 @@ $lng['admin']['domain_hsts_preload']['title'] = 'Füge Domain in die <a href="ht
$lng['admin']['domain_hsts_preload']['description'] = 'Wenn die Domain in die HSTS preload Liste, verwaltet von Chrome (und genutzt von Firefox und Safari), hinzugefügt werden soll, dann aktivieren Sie diese Einstellung.<br>Die preload-Direktive zu senden kann PERMANTENTE KONSEQUENZEN haben und dazu führen, dass Benutzer auf diese Domain und auch Subdomains nicht zugreifen können.<br>Beachten Sie die Details unter <a href="https://hstspreload.appspot.com/#removal" target="_blank">hstspreload.appspot.com/#removal</a> bevor ein Header mit "preload" gesendet wird.';
$lng['serversettings']['http2_support']['title'] = 'HTTP2 Unterstützung';
$lng['serversettings']['http2_support']['description'] = 'Aktiviere HTTP2 Unterstützung für SSL.<br><em class="red">NUR AKTIVIEREN, WENN DER WEBSERVER DIESE FUNKTION UNTERSTÜTZT (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['serversettings']['http2_support']['description'] = 'Aktiviere HTTP2 Unterstützung für SSL.<br><em class="text-danger">NUR AKTIVIEREN, WENN DER WEBSERVER DIESE FUNKTION UNTERSTÜTZT (nginx version 1.9.5+, apache2 version 2.4.17+)</em>';
$lng['error']['noipportgiven'] = 'Keine IP/Port angegeben';
// Added in froxlor 0.9.38.8
$lng['admin']['domain_ocsp_stapling']['title'] = 'OCSP stapling';
$lng['admin']['domain_ocsp_stapling']['description'] = 'Siehe <a target="_blank" href="https://de.wikipedia.org/wiki/Online_Certificate_Status_Protocol_stapling">Wikipedia</a> für eine ausführliche Beschreibung von OCSP-Stapling';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="red">WARNUNG:</strong> Nginx unterstützt OCSP-Stapling erst ab Version 1.3.7. Wenn Ihre Version älter ist, wird der Webserver bei aktiviertem OCSP-Stapling NICHT korrekt starten.';
$lng['admin']['domain_ocsp_stapling']['nginx_version_warning'] = '<br /><strong class="text-danger">WARNUNG:</strong> Nginx unterstützt OCSP-Stapling erst ab Version 1.3.7. Wenn Ihre Version älter ist, wird der Webserver bei aktiviertem OCSP-Stapling NICHT korrekt starten.';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['title'] = 'Apache 2.4: Pfad zum OCSP-Stapling-Cache';
$lng['serversettings']['ssl']['apache24_ocsp_cache_path']['description'] = 'Konfiguriert den Cache-Pfad zum Zwischenspeichern der OCSP-Antworten,<br />die an TLS-Handshakes angehängt werden.';
$lng['serversettings']['nssextrausers']['title'] = 'Verwende libnss-extrausers anstatt libnss-mysql';
$lng['serversettings']['nssextrausers']['description'] = 'Lese Benutzer nicht direkt aus der Datenbank sondern über Dateien. Bitte nur aktivieren, wenn die entsprechende Konfiguration vorgenommen wurde (System -> libnss-extrausers).<br><strong class="red">Nur für Debian/Ubuntu (oder wenn libnss-extrausers manuell kompiliert wurde!)</strong>';
$lng['serversettings']['nssextrausers']['description'] = 'Lese Benutzer nicht direkt aus der Datenbank sondern über Dateien. Bitte nur aktivieren, wenn die entsprechende Konfiguration vorgenommen wurde (System -> libnss-extrausers).<br><strong class="text-danger">Nur für Debian/Ubuntu (oder wenn libnss-extrausers manuell kompiliert wurde!)</strong>';
$lng['admin']['domain_http2']['title'] = 'HTTP2 Unterstützung';
$lng['admin']['domain_http2']['description'] = 'Siehe <a target="_blank" href="https://de.wikipedia.org/wiki/Hypertext_Transfer_Protocol#HTTP.2F2">Wikipedia</a> für eine ausführliche Beschreibung von HTTP2';
$lng['admin']['testmail'] = 'SMTP Test';
@@ -1669,7 +1669,7 @@ $lng['question']['plan_reallydelete'] = 'Wollen Sie den Hosting-Plan "%s" wirkli
$lng['admin']['notryfiles']['title'] = 'Keine generierte try_files Anweisung';
$lng['admin']['notryfiles']['description'] = 'Wählen Sie "Ja", wenn eine eigene try_files Direktive in den "eigenen Vhost Einstellungen" angegeben werden soll (z.B. nötig für manche Wordpress Plugins).';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig'] = 'Überschreibe FPM-Daemon Einstellungen (pm, max_children, etc.)';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="red">Nur verwendet wenn "Überschreibe FPM-Daemon Einstellungen" auf "Ja" gestellt ist</span>';
$lng['serversettings']['phpfpm_settings']['override_fpmconfig_addinfo'] = '<br /><span class="text-danger">Nur verwendet wenn "Überschreibe FPM-Daemon Einstellungen" auf "Ja" gestellt ist</span>';
$lng['panel']['backuppath']['title'] = 'Pfad zur Ablage der Backups';
$lng['panel']['backuppath']['description'] = 'In diesem Ordner werden die Backups abgelegt. Wenn das Sichern von Web-Daten aktiviert ist, werden alle Dateien aus dem Heimatverzeichnis gesichert, exklusive des hier angegebenen Backup-Ordners.';
@@ -1687,7 +1687,7 @@ $lng['apikeys']['valid_until_help'] = 'Datum Gültigkeitsende, Format JJJJ-MM-TT
$lng['serversettings']['enable_api']['title'] = 'Aktiviere externe API Nutzung';
$lng['serversettings']['enable_api']['description'] = 'Um die froxlor API nutzen zu können, muss diese Option aktiviert sein. Für detaillierte Informationen siehe <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
$lng['serversettings']['dhparams_file']['title'] = 'DHParams Datei (Diffie–Hellman key exchange)';
$lng['serversettings']['dhparams_file']['description'] = 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.<br>Beispiel: /etc/ssl/webserver/dhparams.pem<br><br>Existiert die Datei nicht, wird sie wie folgt erstellt: <em>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096<em>. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.';
$lng['serversettings']['dhparams_file']['description'] = 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.<br>Beispiel: /etc/ssl/webserver/dhparams.pem<br><br>Existiert die Datei nicht, wird sie wie folgt erstellt: <code>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096</code>. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.';
$lng['2fa']['2fa'] = '2FA Optionen';
$lng['2fa']['2fa_enabled'] = 'Aktiviere Zwei-Faktor Authentifizierung (2FA)';
$lng['login']['2fa'] = 'Zwei-Faktor Authentifizierung (2FA)';
@@ -1712,7 +1712,7 @@ $lng['panel']['settings_before_configuration'] = 'Stelle sicher, dass die Einste
$lng['panel']['alternative_cmdline_config'] = 'Alternativ, führe den folgenden Befehl als root-Benutzer auf der Shell aus, um die Dienste automatisch zu konfigurieren.';
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Lösche Domain %domain% von PowerDNS Datenbank';
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Lösche SSL Dateien von Domain %domain%';
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">Keine der IPs und Ports hat die Option "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" aktiviert, einige Einstellungen sind daher nicht verfügbar.</small>';
$lng['admin']['novhostcontainer'] = '<br><br><small class="text-danger">Keine der IPs und Ports hat die Option "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" aktiviert, einige Einstellungen sind daher nicht verfügbar.</small>';
$lng['serversettings']['errorlog_level']['title'] = 'Ausführlichkeit des Fehlerprotokolls';
$lng['serversettings']['errorlog_level']['description'] = 'Steuert die Ausführlichkeit des Fehlerprotokolls. Voreinstellung ist "warn" bei Apache und "error" bei Nginx.';
$lng['serversettings']['letsencryptecc']['title'] = "ECC / ECDSA Zertifikate ausstellen";

16
lng/italian.lng.php
View File

@@ -974,12 +974,12 @@ $lng['serversettings']['defaultttl'] = 'Dominio TTL per impegnare in secondi (pr
// ADDED IN FROXLOR 0.9.6-svn3
$lng['serversettings']['defaultwebsrverrhandler_enabled'] = 'Abilita errordocuments in automatico per tutti i clienti';
$lng['serversettings']['defaultwebsrverrhandler_err401']['title'] = 'File/URL per l\'errore 401';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="red">Non supportato in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err401']['description'] = '<div class="text-danger">Non supportato in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['title'] = 'File/URL per l\'errore 403';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="red">Non supportato in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err403']['description'] = '<div class="text-danger">Non supportato in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err404'] = 'File/URL per l\'errore 404';
$lng['serversettings']['defaultwebsrverrhandler_err500']['title'] = 'File/URL per l\'errore 500';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="red">Non supportato in: lighttpd</div>';
$lng['serversettings']['defaultwebsrverrhandler_err500']['description'] = '<div class="text-danger">Non supportato in: lighttpd</div>';
// ADDED IN FROXLOR 0.9.6-svn5
$lng['serversettings']['mod_fcgid']['defaultini'] = 'Configurazione di default di PHP per i nuovi domini';
@@ -1227,7 +1227,7 @@ $lng['admin']['store_defaultindex'] = 'Archivio del file indice predefinito al p
$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Percorso al file catena dei certificati SSL';
$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Principalmente Bundle CA, o similare, presubilmente vuoi impostare questo se hai acquistato un certificato SSL.';
$lng['serversettings']['phpfpm']['title'] = 'Abilita php-fpm';
$lng['serversettings']['phpfpm']['description'] = '<b>Questa impostazione richiede una configurazione speciale del server web. Vedi il manuale FPM per <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/apache2-with-php-fpm">Apache2</a> o <a target="blank" href="https://github.com/Froxlor/Froxlor/wiki/nginx-with-php-fpm">nginx</a></b>';
$lng['serversettings']['phpfpm']['description'] = '<b>Questa impostazione richiede una configurazione speciale del server web. Vedi il <a target="_blank" href="https://docs.froxlor.org/general/configuration/php-fpm.html">manuale PHP-FPM</a></b>';
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configurazione cartella Alias per php-fpm';
$lng['gender']['title'] = 'Titolo';
$lng['gender']['male'] = 'Sig.';
@@ -1512,7 +1512,7 @@ $lng['error']['featureisdisabled'] = 'Funzionalità %s è disabilitata. Perfavor
$lng['serversettings']['catchall_enabled']['title'] = 'Usa Catchall';
$lng['serversettings']['catchall_enabled']['description'] = 'Vuoi offrire ai tuoi clienti la funzionalità di catchall?';
$lng['serversettings']['apache_24']['title'] = 'Usa impostazioni per Apache 2.4';
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENZIONE:</strong> spunta soltanto se hai installato la versione 2.4 o superiore di Apache<br />altrimenti il tuo server Web non si avvierà';
$lng['serversettings']['apache_24']['description'] = '<strong class="text-danger">ATTENZIONE:</strong> spunta soltanto se hai installato la versione 2.4 o superiore di Apache<br />altrimenti il tuo server Web non si avvierà';
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Percorso al file fastcgi_params';
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specifica il percorso al file fastcgi_params di nginx includendo il nome del file';
$lng['serversettings']['documentroot_use_default_value']['title'] = 'Usa il nome del dominio come valore predefinito per il percorso DocumentRoot (radice dei documenti)';
@@ -1547,11 +1547,11 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'La chiave privata fornita n
$lng['error']['sslcertificateinvalidca'] = 'Il certificato CA fornito non sembra essere un certificato valido';
$lng['error']['sslcertificateinvalidchain'] = 'I dati della catena di certificato non sembrano essere un certificato valido';
$lng['serversettings']['customerssl_directory']['title'] = 'Cartella dei certificati ssl clienti del Webserver';
$lng['serversettings']['customerssl_directory']['description'] = 'Dove devono esssere creati i certificati ssl cliente?<br /><br /><div class="red">NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Dove devono esssere creati i certificati ssl cliente?<br /><br /><div class="text-danger">NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.</div>';
$lng['admin']['phpfpm.ininote'] = 'Non tutti i valori che potresti volere settare possono essere usati nella configurazione del pool php-fpm.';
$lng['crondesc']['cron_mailboxsize'] = 'Calcolo dimensioni caselle di posta';
$lng['domains']['ipandport_multi']['title'] = 'Indirizzi IP';
$lng['domains']['ipandport_multi']['description'] = 'Specifica uno o più indirizzi IP per il dominio.<br /><br /><div class="red">NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come <strong>alias-domain</strong> di un altro dominio.</div>';
$lng['domains']['ipandport_multi']['description'] = 'Specifica uno o più indirizzi IP per il dominio.<br /><br /><div class="text-danger">NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come <strong>alias-domain</strong> di un altro dominio.</div>';
$lng['domains']['ipandport_ssl_multi']['title'] = 'Indirizzi IP SSL';
$lng['domains']['ssl_redirect']['title'] = 'Reindirizzamento SSL';
$lng['domains']['ssl_redirect']['description'] = 'Questa opzione crea un reindirizzamento per vhosts non-sll in modo che tutte le richieste vengono reindirizzate ai SSL-vhost.<br /><br />praticamente una richiesta a <strong>http</strong>://dominio.tld/ ti reindirizzera a <strong>https</strong>://dominio.tld/';
@@ -1632,7 +1632,7 @@ $lng['serversettings']['system_croncmdline']['description'] = 'Commando per eseg
$lng['error']['cannotdeletehostnamephpconfig'] = 'Questa configurazione PHP è utilizzata dal vhost Froxlor e non può essere eliminata.';
$lng['error']['cannotdeletedefaultphpconfig'] = 'Questa configurazione PHP è impostata come predefinita e non può essere eliminata.';
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Permetti aggiornamenti automatici del database';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENZIONE:</b></div> Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.<br><br><div class="red">l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione</div>';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="text-danger"><b>ATTENZIONE:</b></div> Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.<br><br><div class="text-danger">l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione</div>';
$lng['error']['passwordshouldnotbeusername'] = 'La password deve essere diversa dal nome utente.';
$lng['admin']['customer_show_news_feed'] = "Mostra feed di notizie personalizzati sul cruscotto dei clienti";
$lng['admin']['customer_news_feed_url'] = "Feed RSS- per il feed di notizie personalizzato";

33
templates/Froxlor/form/formfields.html.twig
View File

@@ -1,14 +1,21 @@
{% macro fieldrow(id, field, norow = false) %}
{% if field.visible is not defined or (field.visible is defined and field.visible) %}
{% macro fieldrow(id, field, norow = false, nohide = false) %}
{% if field.visible is not defined or (field.visible is defined and field.visible) or nohide == true %}
{% if norow == false and field.type != 'hidden' %}
<div class="row mb-3">
<div class="row mb-3 pb-1 border-bottom">
{% if field.label is iterable %}
<label for="{{ id }}" class="col-sm-4 col-form-label">{{ field.label.title|raw }}
{% if field.label.description is defined and field.label.description is not empty %}<br><small>{{ field.label.description|raw }}</small>
{% endif %}
</label>
{% else %}
<label for="{{ id }}" class="col-sm-4 col-form-label">{{ field.label|raw }}
{% if field.desc is defined and field.desc is not empty %}<br><small>{{ field.desc|raw }}</small>
{% endif %}
</label>
{% endif %}
<div class="col-sm-8{% if field.type == 'infotext' %} d-flex align-items-center{% endif %}">
{% endif %}
{% if field.type == 'text' or field.type == 'password' or field.type == 'number' or field.type == 'file' or field.type == 'email' or field.type == 'hidden' %}
{% if field.type == 'text' or field.type == 'password' or field.type == 'number' or field.type == 'file' or field.type == 'email' or field.type == 'url' or field.type == 'hidden' %}
{{ _self.input(id, field) }}
{% elseif field.type == 'textul' %}
{{ _self.input_ul(id, field) }}
@@ -26,6 +33,12 @@
{{ _self.itemlist(id, field) }}
{% elseif field.type == 'infotext' %}
{{ _self.infotext(id, field) }}
{% else %}
<div class="alert alert-warning" role="alert">Unknown field-type
{{ field.type }}</div>
{% endif %}
{% if field.note is defined and field.note is not empty %}
<small class="text-info">{{ field.note|raw }}</small>
{% endif %}
{% if norow == false and field.type != 'hidden' %}
</div>
@@ -38,7 +51,7 @@
{% if field.is_array is defined and field.is_array == 1 and field.values is not empty %}
{% for subfield in field.values %}
<div class="form-check form-switch">
<input type="checkbox" value="{{ subfield.value }}" name="{{ id }}[]" class="form-check-input" {% if field.value is defined and subfield.value in field.value %} checked="checked" {% endif %}>
<input type="checkbox" {% if field.visible is defined and field.visible == false %} disabled {% endif %} value="{{ subfield.value }}" name="{{ id }}[]" class="form-check-input" {% if field.value is defined and subfield.value in field.value %} checked="checked" {% endif %}>
<label class="form-check-label">
{{ subfield.label|raw }}
</label>
@@ -46,7 +59,7 @@
{% endfor %}
{% else %}
<div class="form-check form-switch">
<input type="checkbox" value="{{ field.value }}" id="{{ id }}" name="{{ id }}" class="form-check-input {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" {% if field.checked is defined and field.checked == 1 %} checked="checked" {% endif %}>
<input type="checkbox" {% if field.visible is defined and field.visible == false %} disabled {% endif %} value="{{ field.value }}" id="{{ id }}" name="{{ id }}" class="form-check-input {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" {% if field.checked is defined and field.checked == 1 %} checked="checked" {% endif %}>
</div>
{% endif %}
{% endmacro %}
@@ -87,7 +100,7 @@
{% if field.next_to is defined %}
<div class="input-group">
{% endif %}
<input type="{{ field.type }}" {% if field.type == 'number' and field.min is defined %} min="{{ field.min }}" {% endif %} {% if field.type == 'number' and field.max is defined %} max="{{ field.max }}" {% endif %} {% if field.type != 'number' and field.maxlength is defined %} maxlength="{{ field.maxlength }}" {% endif %} id="{{ id }}" name="{{ id }}" value="{{ field.value }}" class="form-control {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" {% if field.mandatory is defined and field.mandatory %} required {% endif %} {% if field.readonly is defined and field.readonly %} readonly {% endif %} {% if field.autocomplete is defined %} autocomplete="{{ field.autocomplete }}" {% endif %} {% if field.placeholder is defined %} placeholder="{{ field.placeholder }}" {% endif %}/>
<input type="{{ field.type }}" {% if field.visible is defined and field.visible == false %} disabled {% endif %} {% if field.type == 'number' and field.min is defined %} min="{{ field.min }}" {% endif %} {% if field.type == 'number' and field.max is defined %} max="{{ field.max }}" {% endif %} {% if field.type != 'number' and field.maxlength is defined %} maxlength="{{ field.maxlength }}" {% endif %} id="{{ id }}" name="{{ id }}" value="{{ field.value }}" class="form-control {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" {% if field.mandatory is defined and field.mandatory %} required {% endif %} {% if field.readonly is defined and field.readonly %} readonly {% endif %} {% if field.autocomplete is defined %} autocomplete="{{ field.autocomplete }}" {% endif %} {% if field.placeholder is defined %} placeholder="{{ field.placeholder }}" {% endif %}/>
{% if field.type == 'hidden' and field.display is defined %}
<input type="text" readonly class="form-control-plaintext" value="{{ field.display }}">
{% endif %}
@@ -125,9 +138,9 @@
{% if field.next_to is defined %}
<div class="input-group">
{% endif %}
<select class="form-select {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" name="{{ id }}" id="{{ id }}" {% if field.mandatory is defined and field.mandatory %} required {% endif %}>
<select {% if field.visible is defined and field.visible == false %} disabled {% endif %} class="form-select {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" name="{{ id }}{% if field.select_mode is defined and field.select_mode == 'multiple' %}[]{% endif %}" id="{{ id }}" {% if field.mandatory is defined and field.mandatory %} required {% endif %} {% if field.select_mode is defined and field.select_mode == 'multiple' %} multiple="multiple" {% endif %}>
{% for val,txt in field.select_var %}
<option value="{{ val }}" {% if field.selected is defined and field.selected == val %} selected="selected" {% endif %}>{{ txt|raw }}</option>
<option value="{{ val }}" {% if field.selected is defined and ((field.selected is not iterable and field.selected == val) or (field.selected is iterable and val in field.selected|keys)) %} selected="selected" {% endif %}>{{ txt|raw }}</option>
{% endfor %}
</select>
{% if field.next_to is defined %}
@@ -142,7 +155,7 @@
{% endmacro %}
{% macro textarea(id, field) %}
<textarea {% if field.rows is defined %} rows="{{ field.rows }}" {% endif %} {% if field.cols is defined %} cols="{{ field.cols }}" {% endif %} id="{{ id }}" name="{{ id }}" class="form-control {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" {% if field.mandatory is defined and field.mandatory %} required {% endif %} {% if field.readonly is defined and field.readonly %} readonly {% endif %} {% if field.placeholder is defined %} placeholder="{{ field.placeholder }}" {% endif %}>{{ field.value }}</textarea>
<textarea {% if field.visible is defined and field.visible == false %} disabled {% endif %} rows="{{ field.rows|default('12') }}" cols="{{ field.cols|default('60') }}" id="{{ id }}" name="{{ id }}" class="form-control {% if field.valid is defined and field.valid == false %}is-invalid{% endif %}" {% if field.mandatory is defined and field.mandatory %} required {% endif %} {% if field.readonly is defined and field.readonly %} readonly {% endif %} {% if field.placeholder is defined %} placeholder="{{ field.placeholder }}" {% endif %}>{{ field.value }}</textarea>
{% endmacro %}
{% macro link(id, field) %}

16
templates/Froxlor/settings/detailpart.html.twig Normal file
View File

@@ -0,0 +1,16 @@
{% extends "Froxlor/settings/index.html.twig" %}
{% block settings %}
{% import "Froxlor/form/formfields.html.twig" as formfields %}
<div class="card mb-3">
<div class="card-body">
{% for id,setting in fields %}
{% if id != '_group' %}
{{ formfields.fieldrow(id, setting, false, true) }}
{% endif %}
{% endfor %}
</div>
</div>
{% endblock %}

48
templates/Froxlor/settings/index.html.twig Normal file
View File

@@ -0,0 +1,48 @@
{% extends "Froxlor/userarea.html.twig" %}
{% block content %}
<div class="row">
<div class="col-12 col-md-10 order-2 order-md-1">
<form action="{{ action|default(filename) }}" method="post" enctype="application/x-www-form-urlencoded" class="form">
<h3 class="page-header">
<i class="fa-solid fa-gears"></i>
{{ lng('admin.serversettings') }}{% if fields._group is defined %}&nbsp;&raquo;&nbsp;{{ fields._group.title }}{% endif %}
</h3>
{% block settings %}
<div class="row row-cols-2 row-cols-md-4 row-cols-xl-6 g-3">
{% for field in fields %}
<div class="col">
<div class="card h-100 border {% if field.activated %}border-primary{% else %}border-secondary bg-light{% endif %}">
<div class="card-body text-center">
{% if field.activated %}
<a href="{{ linker({'section':'settings','page':'overview','part':field.part}) }}" class="btn btn-link stretched-link">
<i class="{{ field.icon }} fa-4x"></i>
</a>
{% else %}
<i class="{{ field.icon }} fa-4x"></i>
{% endif %}
<p class="card-text mt-2">{{ field.title }}{% if field.info is defined and field.info is not empty %}<br><small>{{ field.info|raw }}</small>{% endif %}</p>
</div>
</div>
</div>
{% endfor %}
</div>
{% endblock %}
</form>
</div>
<div class="col-12 col-md-2 order-1 order-md-2">
<a class="btn btn-primary d-block mb-2" href="{{ linker({'section':'settings','page':'overview','part':'all'}) }}">
<i class="fa-solid fa-grip me-1"></i>
{{ lng('admin.configfiles.overview') }}</a>
<a class="btn btn-secondary d-block mb-2" href="{{ linker({'section':'settings','page':'importexport'}) }}">
<i class="fa-solid fa-file-import me-1"></i>
{{ lng('admin.configfiles.importexport') }}</a>
</div>
</div>
{% endblock %}