merged with v0.10.33

lng/dutch.lng.php

@@ -558,10 +558,6 @@ $lng['traffic']['sumhttp'] = 'Samenvatting HTTP-verkeer in';
 $lng['traffic']['sumftp'] = 'Samenvatting FTP-verkeer in';
 $lng['traffic']['summail'] = 'Samenvatting Mail-verkeer in';
 
-// ADDED IN 1.2.19-svn4.5
-
-$lng['serversettings']['no_robots']['title'] = 'Zoekmachines toestaan uw Froxlor-installatie te indexeren';
-
 // ADDED IN 1.2.19-svn6
 
 $lng['admin']['loggersettings'] = 'Instellingen voor logs';
@@ -591,7 +587,7 @@ $lng['panel']['reseller'] = 'wederverkoper';
 $lng['panel']['admin'] = 'beheerder';
 $lng['panel']['customer'] = 'klant(en)';
 $lng['error']['nomessagetosend'] = 'U hebt geen bericht opgegeven.';
-$lng['error']['noreceipientsgiven'] = 'U hebt geen ontvanger opgegeven';
+$lng['error']['norecipientsgiven'] = 'U hebt geen ontvanger opgegeven';
 $lng['admin']['emaildomain'] = 'Emaildomein';
 $lng['admin']['email_only'] = 'Alleen email?';
 $lng['admin']['wwwserveralias'] = 'Voeg een "www." ServerAlias toe';
@@ -599,14 +595,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Is dit een SSL-poort?';
 $lng['admin']['ipsandports']['ssl_cert_file'] = 'Pad naar SSL-certificaat';
 $lng['panel']['send'] = 'verzenden';
 $lng['admin']['subject'] = 'Onderwerp';
-$lng['admin']['receipient'] = 'Ontvanger';
+$lng['admin']['recipient'] = 'Ontvanger';
 $lng['admin']['message'] = 'Bericht schrijven';
 $lng['admin']['text'] = 'Bericht';
 $lng['menu']['message'] = 'Berichten';
 $lng['error']['errorsendingmail'] = 'Het versturen van het bericht naar "%s" is mislukt';
 $lng['error']['cannotreaddir'] = 'De map "%s" kan niet gelezen worden';
 $lng['message']['success'] = 'Bericht verzonden naar ontvangers %s';
-$lng['message']['noreceipients'] = 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn';
+$lng['message']['norecipients'] = 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn';
 $lng['admin']['sslsettings'] = 'Instellingen voor SSL';
 $lng['cronjobs']['notyetrun'] = 'Nog niet uitgevoerd';
 $lng['serversettings']['default_vhostconf']['title'] = 'Standaard vhost-instellingen';
@@ -866,11 +862,11 @@ $lng['update']['noupdatesavail'] = '<strong>U gebruikt reeds de meest recente ve
 $lng['admin']['specialsettingsforsubdomains'] = 'Speciale instellingen toepassen op alle subdomeinen (*.example.com)';
 $lng['serversettings']['specialsettingsforsubdomains']['description'] = 'Indien "Ja" zullen deze aangepaste VHost-instellingen worden toegepast op alle subdomeinen.';
 $lng['tasks']['outstanding_tasks'] = 'Uitstaande cron-taken';
-$lng['tasks']['rebuild_webserverconfig'] = 'Bezig met opnieuw opbouwen van de configuratie van de webserver';
-$lng['tasks']['adding_customer'] = 'Klant met naam %loginname% wordt toegevoegd';
-$lng['tasks']['rebuild_bindconfig'] = 'Opnieuw opbouwen bind-configuratie';
-$lng['tasks']['creating_ftpdir'] = 'Map aanmaken voor nieuwe FTP-gebruiker';
-$lng['tasks']['deleting_customerfiles'] = 'Verwijderen klantbestanden van %loginname%';
+$lng['tasks']['REBUILD_VHOST'] = 'Bezig met opnieuw opbouwen van de configuratie van de webserver';
+$lng['tasks']['CREATE_HOME'] = 'Klant met naam %loginname% wordt toegevoegd';
+$lng['tasks']['REBUILD_DNS'] = 'Opnieuw opbouwen bind-configuratie';
+$lng['tasks']['CREATE_FTP'] = 'Map aanmaken voor nieuwe FTP-gebruiker';
+$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Verwijderen klantbestanden van %loginname%';
 $lng['tasks']['noneoutstanding'] = 'Er zijn op dit moment geen uitstaande taken voor Froxlor';
 
 // ADDED IN FROXLOR 0.9.1
@@ -1080,8 +1076,6 @@ $lng['panel']['unlock'] = 'ontgrendelen';
 $lng['question']['customer_reallyunlock'] = 'Weet u zeker dat u klant %s? wilt ontgrendelen';
 
 // ADDED IN FROXLOR 0.9.15-svn1
-$lng['serversettings']['perl_server']['title'] = 'Server locatie Perl';
-$lng['serversettings']['perl_server']['description'] = 'Standaard is ingesteld op de gids: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
 $lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
 $lng['serversettings']['nginx_php_backend']['description'] = 'dit is waar het PHP-proces luistert naar verzoeken van nginx, kan een unix socket van ip:poort combinatie zijn';
 $lng['serversettings']['phpreload_command']['title'] = 'Commando voor het herladen van PHP';

lng/english.lng.php

@@ -60,8 +60,8 @@ $lng['customer']['phone'] = 'Phone';
 $lng['customer']['fax'] = 'Fax';
 $lng['customer']['email'] = 'Email';
 $lng['customer']['customernumber'] = 'Customer ID';
-$lng['customer']['diskspace'] = 'Webspace (MiB)';
-$lng['customer']['traffic'] = 'Traffic (GiB)';
+$lng['customer']['diskspace'] = 'Webspace';
+$lng['customer']['traffic'] = 'Traffic';
 $lng['customer']['mysqls'] = 'MySQL-databases';
 $lng['customer']['emails'] = 'Email-addresses';
 $lng['customer']['accounts'] = 'Email-accounts';
@@ -71,6 +71,7 @@ $lng['customer']['subdomains'] = 'Subdomains';
 $lng['customer']['domains'] = 'Domains';
 $lng['customer']['unlimited'] = '∞';
 $lng['customer']['mib'] = 'MiB';
+$lng['customer']['gib'] = 'GiB';
 
 /**
  * Customermenue
@@ -205,6 +206,7 @@ $lng['error']['mydomain'] = '\'Domain\'';
 $lng['error']['mydocumentroot'] = '\'Documentroot\'';
 $lng['error']['loginnameexists'] = 'Loginname %s already exists';
 $lng['error']['emailiswrong'] = 'Email-address %s contains invalid characters or is incomplete';
+$lng['error']['alternativeemailiswrong'] = 'The given alternative email address %s to send the credentials to seems to be invalid';
 $lng['error']['loginnameiswrong'] = 'Loginname "%s" contains illegal characters.';
 $lng['error']['loginnameiswrong2'] = 'Loginname contains too many characters. Only %s characters are allowed.';
 $lng['error']['userpathcombinationdupe'] = 'Combination of username and path already exists';
@@ -318,6 +320,7 @@ $lng['admin']['templates']['COMPANY'] = 'Replaces with the customer\'s company n
 $lng['admin']['templates']['USERNAME'] = 'Replaced with the customer\'s account username.';
 $lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account password.';
 $lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.';
+$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number';
 $lng['admin']['webserver'] = 'Webserver';
 $lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
 
@@ -330,7 +333,7 @@ $lng['serversettings']['session_timeout']['description'] = 'How long does a user
 $lng['serversettings']['accountprefix']['title'] = 'Customer prefix';
 $lng['serversettings']['accountprefix']['description'] = 'Which prefix should customer accounts have?';
 $lng['serversettings']['mysqlprefix']['title'] = 'SQL Prefix';
-$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix';
+$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix</br>Use "DBNAME" as the value, a database name field is used together with the customer name as a prefix.';
 $lng['serversettings']['ftpprefix']['title'] = 'FTP Prefix';
 $lng['serversettings']['ftpprefix']['description'] = 'Which prefix should ftp accounts have?<br/><b>If you change this you also have to change the Quota SQL Query in your FTP Server config file in case you use it!</b> ';
 $lng['serversettings']['documentroot_prefix']['title'] = 'Home directory';
@@ -412,6 +415,7 @@ $lng['admin']['ipsandports']['add'] = 'Add IP/Port';
 $lng['admin']['ipsandports']['edit'] = 'Edit IP/Port';
 $lng['admin']['ipsandports']['ipandport'] = 'IP/Port';
 $lng['admin']['ipsandports']['ip'] = 'IP';
+$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
 $lng['admin']['ipsandports']['port'] = 'Port';
 
 // ADDED IN 1.2.13-rc3
@@ -620,16 +624,12 @@ $lng['traffic']['months'][9] = "September";
 $lng['traffic']['months'][10] = "October";
 $lng['traffic']['months'][11] = "November";
 $lng['traffic']['months'][12] = "December";
-$lng['traffic']['mb'] = "Traffic (MiB)";
+$lng['traffic']['mb'] = "Traffic";
 $lng['traffic']['distribution'] = '<font color="#019522">FTP</font> | <font color="#0000FF">HTTP</font> | <font color="#800000">Mail</font>';
 $lng['traffic']['sumhttp'] = 'Total HTTP-Traffic';
 $lng['traffic']['sumftp'] = 'Total FTP-Traffic';
 $lng['traffic']['summail'] = 'Total Mail-Traffic';
 
-// ADDED IN 1.2.19-svn4.5
-
-$lng['serversettings']['no_robots']['title'] = 'Allow searchengine-robots to index your Froxlor installation';
-
 // ADDED IN 1.2.19-svn6
 
 $lng['admin']['loggersettings'] = 'Log settings';
@@ -664,7 +664,7 @@ $lng['panel']['reseller'] = 'reseller';
 $lng['panel']['admin'] = 'admin';
 $lng['panel']['customer'] = 'customer/s';
 $lng['error']['nomessagetosend'] = 'You did not enter a message.';
-$lng['error']['noreceipientsgiven'] = 'You did not specify any recipient';
+$lng['error']['norecipientsgiven'] = 'You did not specify any recipient';
 $lng['admin']['emaildomain'] = 'Emaildomain';
 $lng['admin']['email_only'] = 'Only email?';
 $lng['admin']['wwwserveralias'] = 'Add a "www." ServerAlias';
@@ -672,18 +672,18 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Is this an SSL Port?';
 $lng['admin']['ipsandports']['ssl_cert_file'] = 'Path to the SSL Certificate';
 $lng['panel']['send'] = 'send';
 $lng['admin']['subject'] = 'Subject';
-$lng['admin']['receipient'] = 'Recipient';
+$lng['admin']['recipient'] = 'Recipient';
 $lng['admin']['message'] = 'Write a Message';
 $lng['admin']['text'] = 'Message';
 $lng['menu']['message'] = 'Messages';
 $lng['error']['errorsendingmail'] = 'The message to "%s" failed';
 $lng['error']['cannotreaddir'] = 'Unable to read directory "%s"';
 $lng['message']['success'] = 'Successfully sent message to %s recipients';
-$lng['message']['noreceipients'] = 'No e-mail has been sent because there are no recipients in the database';
+$lng['message']['norecipients'] = 'No e-mail has been sent because there are no recipients in the database';
 $lng['admin']['sslsettings'] = 'SSL settings';
 $lng['cronjobs']['notyetrun'] = 'Not yet run';
 $lng['serversettings']['default_vhostconf']['title'] = 'Default vHost-settings';
-$lng['admin']['specialsettings_replacements'] = "You can use the following variables:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code><br/>";
+$lng['admin']['specialsettings_replacements'] = "You can use the following variables:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code>, <code>{FPMSOCKET}</code> (if applicable)<br/>";
 $lng['serversettings']['default_vhostconf']['description'] = 'The content of this field will be included into this ip/port vHost container directly. ' . $lng['admin']['specialsettings_replacements'] . ' Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!';
 $lng['serversettings']['apache_globaldiropt']['title'] = 'Directory options for customer-prefix';
 $lng['serversettings']['apache_globaldiropt']['description'] = 'The content of this field will be included into the 05_froxlor_dirfix_nofcgid.conf apache config. If empty, the default value is used:<br><br>apache >=2.4<br><code>Require all granted<br>AllowOverride All</code><br><br>apache <=2.2<br><code>Order allow,deny<br>allow from all</code>';
@@ -702,6 +702,8 @@ $lng['dkim']['dkim_dkimkeys']['title'] = 'KeyList filename';
 $lng['dkim']['dkim_dkimkeys']['description'] = '<em>Filename</em> of the  DKIM KeyList parameter specified in the dkim-milter configuration';
 $lng['dkim']['dkimrestart_command']['title'] = 'Milter restart command';
 $lng['dkim']['dkimrestart_command']['description'] = 'Please specify the restart command for the DKIM milter service';
+$lng['dkim']['privkeysuffix']['title'] = 'Private keys suffix';
+$lng['dkim']['privkeysuffix']['description'] = 'You can specify an (optional) filename extension/suffix for the generate dkim private keys. Some services like dkim-filter requires this to be empty';
 
 // ADDED IN 1.2.19-svn9
 
@@ -806,7 +808,7 @@ $lng['serversettings']['mail_quota_enabled']['enforcelink'] = 'Click here to enf
 $lng['question']['admin_quotas_reallywipe'] = 'Do you really want to wipe all quotas on table mail_users? This cannot be reverted!';
 $lng['question']['admin_quotas_reallyenforce'] = 'Do you really want to enforce the default quota to all Users? This cannot be reverted!';
 $lng['error']['vmailquotawrong'] = 'The quotasize must be positive number.';
-$lng['customer']['email_quota'] = 'E-mail quota (MiB)';
+$lng['customer']['email_quota'] = 'E-mail quota';
 $lng['customer']['email_imap'] = 'E-mail IMAP';
 $lng['customer']['email_pop3'] = 'E-mail POP3';
 $lng['customer']['mail_quota'] = 'Mailquota';
@@ -853,7 +855,7 @@ $lng['admin']['phpconfig']['pear_dir'] = 'Will be replaced with the global setti
 $lng['admin']['phpconfig']['open_basedir_c'] = 'Will insert a ; (semicolon) to comment-out/disable open_basedir when set';
 $lng['admin']['phpconfig']['open_basedir'] = 'Will be replaced with the open_basedir setting of the domain.';
 $lng['admin']['phpconfig']['tmp_dir'] = 'Will be replaced with the temporary directory of the domain.';
-$lng['admin']['phpconfig']['open_basedir_global'] = 'Will be replaced with the global value of the path which will be attached to the open_basedir.';
+$lng['admin']['phpconfig']['open_basedir_global'] = 'Will be replaced with the global value of the path which will be attached to the open_basedir (see webserver settings).';
 $lng['admin']['phpconfig']['customer_email'] = 'Will be replaced with the e-mail address of the customer who owns this domain.';
 $lng['admin']['phpconfig']['admin_email'] = 'Will be replaced with e-mail address of the admin who owns this domain.';
 $lng['admin']['phpconfig']['domain'] = 'Will be replaced with the domain.';
@@ -928,7 +930,7 @@ $lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Default vHost-settin
 $lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
 $lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
 $lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
-$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentification, set this only if you know what it is.';
+$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentication, set this only if you know what it is.';
 
 $lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
 
@@ -959,11 +961,11 @@ $lng['update']['noupdatesavail'] = '<strong>You already have the latest Froxlor
 $lng['admin']['specialsettingsforsubdomains'] = 'Apply specialsettings to all subdomains (*.example.com)';
 $lng['serversettings']['specialsettingsforsubdomains']['description'] = 'If yes these custom vHost-settings will be added to all subdomains; if no subdomain-specialsettings are being removed.';
 $lng['tasks']['outstanding_tasks'] = 'Outstanding cron-tasks';
-$lng['tasks']['rebuild_webserverconfig'] = 'Rebuilding webserver-configuration';
-$lng['tasks']['adding_customer'] = 'Adding new customer %loginname%';
-$lng['tasks']['rebuild_bindconfig'] = 'Rebuilding bind-configuration';
-$lng['tasks']['creating_ftpdir'] = 'Creating directory for new ftp-user';
-$lng['tasks']['deleting_customerfiles'] = 'Deleting customer-files %loginname%';
+$lng['tasks']['REBUILD_VHOST'] = 'Rebuilding webserver-configuration';
+$lng['tasks']['CREATE_HOME'] = 'Adding new customer %loginname%';
+$lng['tasks']['REBUILD_DNS'] = 'Rebuilding bind-configuration';
+$lng['tasks']['CREATE_FTP'] = 'Creating directory for new ftp-user';
+$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Deleting customer-files %loginname%';
 $lng['tasks']['noneoutstanding'] = 'There are currently no outstanding tasks for Froxlor';
 
 // ADDED IN FROXLOR 0.9.1
@@ -1174,8 +1176,8 @@ $lng['panel']['unlock'] = 'Unlock';
 $lng['question']['customer_reallyunlock'] = 'Do you really want to unlock customer %s?';
 
 // ADDED IN FROXLOR 0.9.15
-$lng['serversettings']['perl_server']['title'] = 'Perl server location';
-$lng['serversettings']['perl_server']['description'] = 'Default is set for using the guide found at: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
+$lng['serversettings']['perl_server']['title'] = 'Perl server socket location';
+$lng['serversettings']['perl_server']['description'] = 'A simple guide can be found at: <a target="blank" href="https://www.nginx.com/resources/wiki/start/topics/examples/fcgiwrap/">nginx.com</a>';
 $lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
 $lng['serversettings']['nginx_php_backend']['description'] = 'this is where the PHP process is listening for requests from nginx, can be a unix socket of ip:port combination<br />*NOT used with php-fpm';
 $lng['serversettings']['phpreload_command']['title'] = 'PHP reload command';
@@ -1529,7 +1531,7 @@ $lng['serversettings']['diskquota_enabled'] = 'Quota activated?';
 $lng['serversettings']['diskquota_repquota_path']['description'] = 'Path to repquota';
 $lng['serversettings']['diskquota_quotatool_path']['description'] = 'Path to quotatool';
 $lng['serversettings']['diskquota_customer_partition']['description'] = 'Partition, on which the customer files are stored';
-$lng['tasks']['diskspace_set_quota'] = 'Set quota on filesystem';
+$lng['tasks']['CREATE_QUOTA'] = 'Set quota on filesystem';
 $lng['error']['session_timeout'] = 'Value too low';
 $lng['error']['session_timeout_desc'] = 'You should not set the session timeout lower than 1 minute.';
 
@@ -1541,9 +1543,9 @@ $lng['mysql']['size'] = 'Size';
 
 $lng['error']['invalidhostname'] = 'Hostname needs to be a valid domain. It can\'t be empty nor can it consist only of whitespaces';
 
-$lng['traffic']['http'] = 'HTTP (MiB)';
-$lng['traffic']['ftp'] = 'FTP (MiB)';
-$lng['traffic']['mail'] = 'Mail (MiB)';
+$lng['traffic']['http'] = 'HTTP';
+$lng['traffic']['ftp'] = 'FTP';
+$lng['traffic']['mail'] = 'Mail';
 
 // ADDED IN 0.9.27-svn1
 $lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Idle Timeout';
@@ -1559,7 +1561,7 @@ $lng['admin']['speciallogwarning'] = 'WARNING: By changing this setting you will
 // ADDED IN 0.9.28-svn2
 $lng['serversettings']['vmail_maildirname']['title'] = 'Maildir name';
 $lng['serversettings']['vmail_maildirname']['description'] = 'Maildir directory into user\'s account. Normally \'Maildir\', in some implementations \'.maildir\', and directly into user\'s directory if left blank.';
-$lng['tasks']['remove_emailacc_files'] = 'Delete customer e-mail data.';
+$lng['tasks']['DELETE_EMAIL_DATA'] = 'Delete customer e-mail data.';
 
 // ADDED IN 0.9.28-svn5
 $lng['error']['operationnotpermitted'] = 'Operation not permitted!';
@@ -1598,12 +1600,14 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Allow admins to chan
 $lng['serversettings']['panel_allow_theme_change_customer'] = 'Allow customers to change the theme';
 $lng['serversettings']['axfrservers']['title'] = 'AXFR servers';
 $lng['serversettings']['axfrservers']['description'] = 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.';
+$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode';
+$lng['serversettings']['powerdns_mode']['description'] = 'Select the PoweDNS mode: Native for no replication (Default) / Master if DNS replication is needed.';
 $lng['panel']['ssleditor'] = 'SSL settings for this domain';
 $lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete certificate content in the textbox';
 $lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
 $lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
 $lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
-$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentification, set this only if you know what it is.';
+$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentication, set this only if you know what it is.';
 $lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
 $lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
 $lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
@@ -1613,7 +1617,7 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
 $lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
 $lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
 $lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
-$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regulary so avoid storing data in there manually.</div>';
+$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
 $lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
 
 // Added in Froxlor 0.9.30
@@ -1688,8 +1692,8 @@ $lng['panel']['ftpdesc'] = 'FTP description';
 $lng['admin']['cronsettings'] = 'Cronjob settings';
 $lng['serversettings']['system_cronconfig']['title'] = 'Cron configuration file';
 $lng['serversettings']['system_cronconfig']['description'] = 'Path to the cron-service configuration-file. This file will be updated regularly and automatically by froxlor.<br />Note: Please <b>be sure</b> to use the same filename as for the main froxlor cronjob (default: /etc/cron.d/froxlor)!<br><br>If you are using <b>FreeBSD</b>, please specify <i>/etc/crontab</i> here!';
-$lng['tasks']['remove_ftpacc_files'] = 'Delete customer ftp-account data.';
-$lng['tasks']['regenerating_crond'] = 'Rebuilding the cron.d-file';
+$lng['tasks']['DELETE_FTP_DATA'] = 'Delete customer ftp-account data.';
+$lng['tasks']['REBUILD_CRON'] = 'Rebuilding the cron.d-file';
 $lng['serversettings']['system_crondreload']['title'] = 'Cron-daemon reload command';
 $lng['serversettings']['system_crondreload']['description'] = 'Specify the command to execute in order to reload your systems cron-daemon';
 $lng['admin']['integritycheck'] = 'Database validation';
@@ -1699,7 +1703,7 @@ $lng['admin']['integrityresult'] = 'Result';
 $lng['admin']['integrityfix'] = 'Fix problems automatically';
 $lng['question']['admin_integritycheck_reallyfix'] = 'Do you really want to try fixing all database integrity problems automatically?';
 $lng['serversettings']['system_croncmdline']['title'] = 'Cron execution command (php-binary)';
-$lng['serversettings']['system_croncmdline']['description'] = 'Command to execute our cronjobs. Change this only if you know what you are doing (default: "/usr/bin/nice -n 5 /usr/bin/php5 -q")!';
+$lng['serversettings']['system_croncmdline']['description'] = 'Command to execute our cronjobs. Change this only if you know what you are doing (default: "/usr/bin/nice -n 5 /usr/bin/php -q")!';
 $lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.';
 $lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.';
 $lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates';
@@ -1722,7 +1726,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
 $lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list';
 $lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.';
 $lng['phpfpm']['use_mod_proxy']['title'] = 'Use mod_proxy / mod_proxy_fcgi';
-$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
+$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch) or newer</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
 $lng['error']['no_phpinfo'] = 'Sorry, unable to read phpinfo()';
 
 $lng['admin']['movetoadmin'] = 'Move customer';
@@ -1830,15 +1834,15 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
 
 // Added for let's encrypt
 $lng['admin']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
-$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
+$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
 $lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
-$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> This feature is still in beta.';
+$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.';
 $lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
 $lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely';
 $lng['panel']['letsencrypt'] = 'Using Let\'s encrypt';
 $lng['crondesc']['cron_letsencrypt'] = 'updating Let\'s Encrypt certificates';
-$lng['serversettings']['letsencryptca']['title'] = "Let's Encrypt environment";
-$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt certificates.";
+$lng['serversettings']['letsencryptca']['title'] = "ACME environment";
+$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt / ZeroSSL certificates.";
 $lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt country code";
 $lng['serversettings']['letsencryptcountrycode']['description'] = "2 letter country code used to generate Let's Encrypt certificates.";
 $lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt state";
@@ -1894,7 +1898,7 @@ $lng['serversettings']['backupenabled']['title'] = "Enable backup for customers"
 $lng['serversettings']['backupenabled']['description'] = "If activated, the customer will be able to schedule backup jobs (cron-backup) which generates an archive within his docroot (subdirectory chosable by customer)";
 $lng['extras']['path_protection_label'] = '<strong class="red">Important</strong>';
 $lng['extras']['path_protection_info'] = '<strong class="red">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
-$lng['tasks']['backup_customerfiles'] = 'Backup job for customer %loginname%';
+$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Backup job for customer %loginname%';
 
 $lng['error']['dns_domain_nodns'] = 'DNS is not enabled for this domain';
 $lng['error']['dns_content_empty'] = 'No content given';
@@ -1906,6 +1910,7 @@ $lng['error']['dns_mx_needdom'] = 'The MX content value must be a valid domain-n
 $lng['error']['dns_mx_noalias'] = 'The MX-content value cannot be an CNAME entry.';
 $lng['error']['dns_cname_invaliddom'] = 'Invalid domain-name for CNAME record';
 $lng['error']['dns_cname_nomorerr'] = 'There already exists a resource-record with the same record-name. It can not be used as CNAME.';
+$lng['error']['dns_other_nomorerr'] = 'There already exists a CNAME record with the same record-name. It can not be used for another type.';
 $lng['error']['dns_ns_invaliddom'] = 'Invalid domain-name for NS record';
 $lng['error']['dns_srv_prioempty'] = 'Invalid SRV priority given';
 $lng['error']['dns_srv_invalidcontent'] = 'Invalid SRV content, must contain of fields weight, port and target, e.g.: 5 5060 sipserver.example.com.';
@@ -1919,7 +1924,7 @@ $lng['dnseditor']['records'] = 'records';
 $lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
 $lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
 $lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
-$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are prefered, only missing entries will be automatically generated.';
+$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.';
 $lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
 $lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
 
@@ -1984,8 +1989,8 @@ $lng['admin']['domain_http2']['title'] = 'HTTP2 support';
 $lng['admin']['domain_http2']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/HTTP/2">Wikipedia</a> for a detailed explanation of HTTP2';
 $lng['admin']['testmail'] = 'SMTP test';
 $lng['success']['testmailsent'] = 'Test mail sent successfully';
-$lng['serversettings']['disable_le_selfcheck']['title'] = "Disable Let's Encrypt local self-check";
-$lng['serversettings']['disable_le_selfcheck']['description'] = "If activated, froxlor will <strong>not</strong> perform its self-check for token accessibility. Needed for NATed IP's or similar.";
+$lng['serversettings']['le_domain_dnscheck']['title'] = "Validate DNS of domains when using Let's Encrypt";
+$lng['serversettings']['le_domain_dnscheck']['description'] = "If activated, froxlor will validate whether the domain which requests a Let's Encrypt certificate resolves to at least one of the system ip addresses.";
 $lng['menue']['phpsettings']['fpmdaemons'] = 'PHP-FPM versions';
 $lng['admin']['phpsettings']['activephpconfigs'] = 'In use for php-config(s)';
 $lng['admin']['phpsettingsforsubdomains'] = 'Apply php-config to all subdomains:';
@@ -1994,7 +1999,7 @@ $lng['serversettings']['leapiversion']['title'] = "Choose Let's Encrypt ACME imp
 $lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
 $lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
 $lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
-$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protcol versions.<br /><br /><b>Default value is:</b><pre>TLSv1, TLSv1.2</pre>';
+$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protocol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
 $lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
 $lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
 $lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
@@ -2037,9 +2042,9 @@ $lng['apikeys']['allowed_from_help'] = 'Comma separated list of ip addresses. De
 $lng['apikeys']['valid_until'] = 'Valid until';
 $lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD';
 $lng['serversettings']['enable_api']['title'] = 'Enable external API usage';
-$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://api.froxlor.org/" target="_new">https://api.froxlor.org/</a>';
+$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
 $lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)';
-$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
+$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/ssl/webserver/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
 $lng['2fa']['2fa'] = '2FA options';
 $lng['2fa']['2fa_enabled'] = 'Activate Two-factor authentication (2FA)';
 $lng['login']['2fa'] = 'Two-factor authentication (2FA)';
@@ -2062,8 +2067,8 @@ $lng['panel']['ihave_configured'] = 'I have configured the services';
 $lng['panel']['system_is_configured'] = 'System is already set as configured';
 $lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted the settings prior to configuring the services here';
 $lng['panel']['alternative_cmdline_config'] = 'Alternatively, just run the following command as root-user in your shell to configure the services automatically';
-$lng['tasks']['remove_pdns_domain'] = 'Delete domain %s from PowerDNS database';
-$lng['tasks']['remove_ssl_domain'] = 'Delete ssl files of domain %s';
+$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database';
+$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%';
 $lng['admin']['novhostcontainer'] = '<br><br><small class="red">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
 $lng['serversettings']['errorlog_level']['title'] = 'Error log-level';
 $lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.';
@@ -2081,7 +2086,7 @@ $lng['serversettings']['default_sslvhostconf']['title'] = 'Default SSL vHost-set
 $lng['serversettings']['includedefault_sslvhostconf'] = 'Include non-SSL vHost-settings in SSL-vHost';
 $lng['admin']['ownsslvhostsettings'] = 'Own SSL vHost-settings';
 $lng['admin']['ipsandports']['ssl_default_vhostconf_domain'] = 'Default SSL vHost-settings for every domain container';
-$lng['customer']['total_diskspace'] = 'Total diskspace (MiB)';
+$lng['customer']['total_diskspace'] = 'Total diskspace';
 $lng['admin']['domain_override_tls'] = 'Override system TLS settings';
 $lng['domains']['isaliasdomainof'] = 'Is aliasdomain for %s';
 $lng['serversettings']['apply_specialsettings_default']['title'] = 'Default value for "' . $lng['admin']['specialsettingsforsubdomains'] . "' setting when editing a domain";
@@ -2099,3 +2104,41 @@ $lng['serversettings']['phpfpm_settings']['custom_config']['description'] = 'Add
 
 $lng['serversettings']['awstats']['logformat']['title'] = 'LogFormat setting';
 $lng['serversettings']['awstats']['logformat']['description'] = 'If you use customized logformat for your webserver, you need change the awstats LogFormat too.<br/>Default is 1. For more information check documentation <a target="_blank" href="https://awstats.sourceforge.io/docs/awstats_config.html#LogFormat">here</a>.';
+$lng['error']['cannotdeletesuperadmin'] = 'The first admin cannot be deleted.';
+$lng['error']['no_wwwcnamae_ifwwwalias'] = 'Cannot set CNAME record for "www" as domain is set to generate a www-alias. Please change settings to either "No alias" or "Wildcard alias"';
+$lng['serversettings']['hide_incompatible_settings'] = 'Hide incompatible settings';
+
+$lng['serversettings']['soaemail'] = 'Mail address to use in SOA records (defaults to sender address from panel settings if empty)';
+$lng['imprint'] = 'Legal notes';
+$lng['serversettings']['imprint_url']['title'] = 'URL to legal notes / imprint';
+$lng['serversettings']['imprint_url']['description'] = 'Specify an URL to your legal notes / imprint site. The link will be visible on the login screen and on the footer when logged in.';
+$lng['terms'] = 'Terms of use';
+$lng['serversettings']['terms_url']['title'] = 'URL to terms of use';
+$lng['serversettings']['terms_url']['description'] = 'Specify an URL to your terms of use site. The link will be visible on the login screen and on the footer when logged in.';
+$lng['privacy'] = 'Privacy policy';
+$lng['serversettings']['privacy_url']['title'] = 'URL to privacy policy';
+$lng['serversettings']['privacy_url']['description'] = 'Specify an URL to your privacy policy site / imprint site. The link will be visible on the login screen and on the footer when logged in.';
+$lng['admin']['domaindefaultalias'] = 'Default ServerAlias value for new domains';
+
+$lng['serversettings']['logo_image_header']['title'] = 'Logo Image (Header)';
+$lng['serversettings']['logo_image_header']['description'] = 'Upload your own logo image to be shown in the header after login (recommended height 30px)';
+$lng['serversettings']['logo_image_login']['title'] = 'Logo Image (Login)';
+$lng['serversettings']['logo_image_login']['description'] = 'Upload your own logo image to be shown during login';
+$lng['panel']['image_field_delete'] = 'Delete the existing current image';
+$lng['serversettings']['logo_overridetheme']['title'] = 'Overwrites logo defined in theme by "Logo Image" (Header and Login, see below)';
+$lng['serversettings']['logo_overridetheme']['description'] = 'This needs to be set to "true" if you intend to use your uploaded logo; alternatively you can still use the theme-based "logo_custom.png" and "logo_custom_login.png" possibility.';
+$lng['serversettings']['logo_overridecustom']['title'] = 'Overwrite custom logo (logo_custom.png and logo_custom_login.png) defined in theme by "Logo Image" (Header and Login, see below)';
+$lng['serversettings']['logo_overridecustom']['description'] = 'Set this to "true" if you want to ignore theme-specific custom logos for header and login and use "Logo Image"';
+$lng['serversettings']['createstdsubdom_default']['title'] = 'Preselected value for "'.$lng['admin']['stdsubdomain_add'].'" when creating a customer';
+$lng['serversettings']['froxlorusergroup']['title'] = 'Custom system group for all customer users';
+$lng['serversettings']['froxlorusergroup']['description'] = 'Usage of libnss-extrausers (system-settings) is required for this to take effect. An empty value skips creation or removes existing group.';
+$lng['error']['local_group_exists'] = 'The given group already exists on the system.';
+$lng['error']['local_group_invalid'] = 'The given group name is invalid';
+$lng['error']['invaliddnsforletsencrypt'] = 'The domains DNS does not include any of the chosen IP addresses. Let\'s Encrypt certificate generation not possible.';
+$lng['error']['notallowedphpconfigused'] = 'Trying to use php-config which is not assigned to customer';
+
+$lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'] = 'Assign this configuration to all currently existing customers';
+$lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'] = 'Set this to "true" if you want to assign this configuration to all currently existing customers so it can be used by them. This setting is not permanent but can be run multiple times.';
+$lng['error']['pathmustberelative'] = 'The user does not have the permission to specify directories outside the customers home-directory. Please specify a relative path (no leading /).';
+$lng['serversettings']['acmeshpath']['title'] = 'Path to acme.sh';
+$lng['serversettings']['acmeshpath']['description'] = 'Set this to where acme.sh is installed to, including the acme.sh script<br>Default is <b>/root/.acme.sh/acme.sh</b>';

lng/french.lng.php

@@ -598,10 +598,6 @@ $lng['traffic']['sumhttp'] = 'Trafic HTTP total entrant';
 $lng['traffic']['sumftp'] = 'Trafic FTP total entrant';
 $lng['traffic']['summail'] = 'Trafic E-mail total entrant';
 
-// ADDED IN 1.2.19-svn4.5
-
-$lng['serversettings']['no_robots']['title'] = 'Permettre aux robots des moteurs de recherche d\'indexer l\'installation de Froxlor';
-
 // ADDED IN 1.2.19-svn6
 
 $lng['admin']['loggersettings'] = 'Paramètres des logs';
@@ -631,7 +627,7 @@ $lng['panel']['reseller'] = 'revendeur';
 $lng['panel']['admin'] = 'administrateur';
 $lng['panel']['customer'] = 'client(s)';
 $lng['error']['nomessagetosend'] = 'Vous n\'avez pas entré de message.';
-$lng['error']['noreceipientsgiven'] = 'Vous n\'avez pas spécifier de destinataire';
+$lng['error']['norecipientsgiven'] = 'Vous n\'avez pas spécifier de destinataire';
 $lng['admin']['emaildomain'] = 'Domaine e-mail';
 $lng['admin']['email_only'] = 'Seulement des e-mails ?';
 $lng['admin']['wwwserveralias'] = 'Ajouter un "www." à l\'alias du serveur "ServerAlias"';
@@ -639,14 +635,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Est-ce un port SSL ?';
 $lng['admin']['ipsandports']['ssl_cert_file'] = 'Emplacement du certificat SSL';
 $lng['panel']['send'] = 'envoyé';
 $lng['admin']['subject'] = 'Sujet';
-$lng['admin']['receipient'] = 'Destinataire';
+$lng['admin']['recipient'] = 'Destinataire';
 $lng['admin']['message'] = 'Ecrire un message';
 $lng['admin']['text'] = 'Message';
 $lng['menu']['message'] = 'Messages';
 $lng['error']['errorsendingmail'] = 'Echec d\'envoi du message à "%s"';
 $lng['error']['cannotreaddir'] = 'Impossible de lire dossier "%s"';
 $lng['message']['success'] = 'Le message a été envoyé aux destinataires "%s"';
-$lng['message']['noreceipients'] = 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données';
+$lng['message']['norecipients'] = 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données';
 $lng['admin']['sslsettings'] = 'Paramètres SSL';
 $lng['cronjobs']['notyetrun'] = 'Pas encore lancé';
 $lng['serversettings']['default_vhostconf']['title'] = 'Paramètres par défaut pour les vHosts';

lng/german.lng.php

@@ -60,8 +60,8 @@ $lng['customer']['phone'] = 'Telefon';
 $lng['customer']['fax'] = 'Fax';
 $lng['customer']['email'] = 'E-Mail-Adresse';
 $lng['customer']['customernumber'] = 'Kundennummer';
-$lng['customer']['diskspace'] = 'Webspace (MiB)';
-$lng['customer']['traffic'] = 'Traffic (GiB)';
+$lng['customer']['diskspace'] = 'Webspace';
+$lng['customer']['traffic'] = 'Traffic';
 $lng['customer']['mysqls'] = 'MySQL-Datenbanken';
 $lng['customer']['emails'] = 'E-Mail-Adressen';
 $lng['customer']['accounts'] = 'E-Mail-Konten';
@@ -203,6 +203,7 @@ $lng['error']['mydomain'] = '\'Domain\'';
 $lng['error']['mydocumentroot'] = '\'Documentroot\'';
 $lng['error']['loginnameexists'] = 'Der Login-Name "%s" existiert bereits.';
 $lng['error']['emailiswrong'] = 'Die E-Mail-Adresse "%s" enthält ungültige Zeichen oder ist nicht vollständig.';
+$lng['error']['alternativeemailiswrong'] = 'Die angegebene alternative E-Mail Adresse "%s", an welche die Zugangsdaten geschickt werden soll, scheint ungültig zu sein.';
 $lng['error']['loginnameiswrong'] = 'Der Login-Name "%s" enthält ungültige Zeichen.';
 $lng['error']['loginnameiswrong2'] = 'Der Login-Name enthält zu viele Zeichen, es sind maximal %s Zeichen erlaubt.';
 $lng['error']['userpathcombinationdupe'] = 'Die Kombination aus Benutzername und Pfad existiert bereits.';
@@ -315,6 +316,7 @@ $lng['admin']['templates']['COMPANY'] = 'Wird mit dem Firmennamen des Kunden ers
 $lng['admin']['templates']['USERNAME'] = 'Wird mit dem Benutzernamen des neuen Kundenkontos ersetzt.';
 $lng['admin']['templates']['PASSWORD'] = 'Wird mit dem Passwort des neuen Kundenkontos ersetzt.';
 $lng['admin']['templates']['EMAIL'] = 'Wird mit der Adresse des neuen E-Mail-Kontos ersetzt.';
+$lng['admin']['templates']['CUSTOMER_NO'] = 'Wir mit der Kunden-Nummer ersetzt';
 $lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">WARNUNG:</strong> Bei der Verwendung einer Zonendatei müssen alle benötigten Records aller Subdomains ebenfalls manuell verwaltet werden.';
 
 /**
@@ -326,7 +328,7 @@ $lng['serversettings']['session_timeout']['description'] = 'Wie lange muss ein B
 $lng['serversettings']['accountprefix']['title'] = 'Kundenpräfix';
 $lng['serversettings']['accountprefix']['description'] = 'Welchen Präfix sollen die Kundenaccounts haben?';
 $lng['serversettings']['mysqlprefix']['title'] = 'MySQL-Präfix';
-$lng['serversettings']['mysqlprefix']['description'] = 'Welchen Präfix sollen die MySQL-Benutzerkonten haben?</br>Mit "RANDOM" als Wert wird ein 3-stelliger Zufallswert als Präfix verwendet.';
+$lng['serversettings']['mysqlprefix']['description'] = 'Welchen Präfix sollen die MySQL-Benutzerkonten haben?</br>Mit "RANDOM" als Wert wird ein 3-stelliger Zufallswert als Präfix verwendet.</br>Mit "DBNAME" als Wert wird ein Feld Databankname zusammen mit dem Kundennamen als Präfix genutzt.';
 $lng['serversettings']['ftpprefix']['title'] = 'FTP-Präfix';
 $lng['serversettings']['ftpprefix']['description'] = 'Welchen Präfix sollen die FTP-Benutzerkonten haben?<br/><b>Falls FTP-Quoatas verwendet werden, ist es notwendig das Quota-SQL-Query in der FTP-Server-Config ebenfalls zu ändern!</b>';
 $lng['serversettings']['documentroot_prefix']['title'] = 'Heimatverzeichnis';
@@ -408,6 +410,7 @@ $lng['admin']['ipsandports']['add'] = 'IP-Adresse/Port hinzufügen';
 $lng['admin']['ipsandports']['edit'] = 'IP-Adresse/Port bearbeiten';
 $lng['admin']['ipsandports']['ipandport'] = 'IP-Adresse/Port';
 $lng['admin']['ipsandports']['ip'] = 'IP-Adresse';
+$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Hinweis: Obwohl private IP Adressen erlaubt sind, kann es bei manchen Features wie DNS zu ungewolltem Verhalten kommen.<br>Verwende private Adressen nur wenn du sicher bist.</div>';
 $lng['admin']['ipsandports']['port'] = 'Port';
 
 // ADDED IN 1.2.13-rc3
@@ -614,17 +617,13 @@ $lng['traffic']['months'][9] = "September";
 $lng['traffic']['months'][10] = "Oktober";
 $lng['traffic']['months'][11] = "November";
 $lng['traffic']['months'][12] = "Dezember";
-$lng['traffic']['mb'] = "Traffic (MiB)";
+$lng['traffic']['mb'] = "Traffic";
 $lng['traffic']['day'] = "Tag";
 $lng['traffic']['distribution'] = '<span color="#019522">FTP</span> | <span color="#0000FF">HTTP</span> | <span color="#800000">Mail</span>';
 $lng['traffic']['sumhttp'] = 'Gesamt HTTP-Traffic';
 $lng['traffic']['sumftp'] = 'Gesamt FTP-Traffic';
 $lng['traffic']['summail'] = 'Gesamt Mail-Traffic';
 
-// ADDED IN 1.2.19-svn4.5
-
-$lng['serversettings']['no_robots']['title'] = 'Erlaube die Indizierung Ihrer Froxlor-Installation durch Suchmaschinen';
-
 // ADDED IN 1.2.19-svn6
 
 $lng['admin']['loggersettings'] = 'Log-Einstellungen';
@@ -659,7 +658,7 @@ $lng['panel']['reseller'] = 'Reseller';
 $lng['panel']['admin'] = 'Administrator';
 $lng['panel']['customer'] = 'Kunde/n';
 $lng['error']['nomessagetosend'] = 'Keine Nachricht angegeben';
-$lng['error']['noreceipientsgiven'] = 'Keine Empfänger angegeben';
+$lng['error']['norecipientsgiven'] = 'Keine Empfänger angegeben';
 $lng['admin']['emaildomain'] = 'E-Mail-Domain';
 $lng['admin']['email_only'] = 'Nur als E-Mail-Domain verwenden?';
 $lng['admin']['wwwserveralias'] = 'Einen "www." ServerAlias hinzufügen';
@@ -667,18 +666,18 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Ist dies ein SSL-Port?';
 $lng['admin']['ipsandports']['ssl_cert_file'] = 'Pfad zum Zertifikat';
 $lng['panel']['send'] = 'Versenden';
 $lng['admin']['subject'] = 'Betreff';
-$lng['admin']['receipient'] = 'Empfänger';
+$lng['admin']['recipient'] = 'Empfänger';
 $lng['admin']['message'] = 'Rundmail senden';
 $lng['admin']['text'] = 'Nachricht';
 $lng['menu']['message'] = 'Nachrichten';
 $lng['error']['errorsendingmail'] = 'Das Versenden der Nachricht an "%s" schlug fehl.';
 $lng['error']['cannotreaddir'] = 'Der Ordner "%s" kann nicht gelesen werden';
 $lng['message']['success'] = 'Nachricht erfolgreich an "%s" Empfänger gesendet';
-$lng['message']['noreceipients'] = 'Es wurde keine E-Mail versendet, da sich keine Empfänger in der Datenbank befinden';
+$lng['message']['norecipients'] = 'Es wurde keine E-Mail versendet, da sich keine Empfänger in der Datenbank befinden';
 $lng['admin']['sslsettings'] = 'SSL-Einstellungen';
 $lng['cronjobs']['notyetrun'] = 'Bisher nicht gestartet';
 $lng['serversettings']['default_vhostconf']['title'] = 'Standard vHost-Einstellungen';
-$lng['admin']['specialsettings_replacements'] = "Die folgenden Variablen können verwendet werden:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code><br/>";
+$lng['admin']['specialsettings_replacements'] = "Die folgenden Variablen können verwendet werden:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code>, <code>{FPMSOCKET}</code> (wenn zutreffend)<br/>";
 $lng['serversettings']['default_vhostconf']['description'] = 'Der Inhalt dieses Feldes wird direkt in den IP/Port-vHost-Container übernommen. ' . $lng['admin']['specialsettings_replacements'] . '<br /><strong>ACHTUNG:</strong> Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Der Webserver könnte nicht mehr starten!';
 $lng['serversettings']['default_vhostconf_domain']['description'] = 'Der Inhalt dieses Feldes wird direkt in jeden Domain-vHost-Container übernommen. ' . $lng['admin']['specialsettings_replacements'] . '<strong>ACHTUNG:</strong> Der Code wird nicht auf Fehler geprüft. Etwaige Fehler werden also auch übernommen. Der Webserver könnte nicht mehr starten!';
 $lng['serversettings']['apache_globaldiropt']['title'] = 'Kunden-Prefix Ordner-Optionen';
@@ -697,6 +696,8 @@ $lng['dkim']['dkim_dkimkeys']['title'] = 'KeyList Dateiname';
 $lng['dkim']['dkim_dkimkeys']['description'] = 'Dateiname der DKIM-KeyList-Angabe aus der DKIM-Milter-Konfigurationsdatei.';
 $lng['dkim']['dkimrestart_command']['title'] = 'Milter-Restart-Kommando';
 $lng['dkim']['dkimrestart_command']['description'] = 'Wie lautet das Kommando zum Neustarten des DKIM-Milter-Dienstes?';
+$lng['dkim']['privkeysuffix']['title'] = 'Suffix für Private Keys';
+$lng['dkim']['privkeysuffix']['description'] = 'Hier kann eine (optionale) Dateiendung für die generierten Private Keys angegeben werden. Manche Dienste, wie dkim-filter, erwarten, dass die Schlüssel keine Dateiendung haben (leer).';
 
 // ADDED IN 1.2.19-svn9
 
@@ -802,7 +803,7 @@ $lng['serversettings']['mail_quota_enabled']['enforcelink'] = 'Hier klicken, um
 $lng['question']['admin_quotas_reallywipe'] = 'Sind Sie sicher, dass alle E-Mail-Kontingente aus der Tabelle mail_users entfernt werden sollen? Dieser Schritt kann nicht rückgängig gemacht werden!';
 $lng['question']['admin_quotas_reallyenforce'] = 'Sind Sie sicher, dass Sie allen Benutzern das Default-Quota zuweisen wollen? Dies kann nicht rückgängig gemacht werden!';
 $lng['error']['vmailquotawrong'] = 'Die Kontingent-Größe muss positiv sein.';
-$lng['customer']['email_quota'] = 'E-Mail-Kontingent (MiB)';
+$lng['customer']['email_quota'] = 'E-Mail-Kontingent';
 $lng['customer']['email_imap'] = 'IMAP';
 $lng['customer']['email_pop3'] = 'POP3';
 $lng['customer']['mail_quota'] = 'E-Mail-Kontingent';
@@ -847,7 +848,7 @@ $lng['admin']['phpconfig']['pear_dir'] = 'Wird mit dem globalen Wert für das In
 $lng['admin']['phpconfig']['open_basedir_c'] = 'Wird mit einem ; (Semikolon) ersetzt, um open_basedir auszukommentieren/deaktivieren, wenn eingestellt.';
 $lng['admin']['phpconfig']['open_basedir'] = 'Wird mit der open_basedir-Einstellung der Domain ersetzt.';
 $lng['admin']['phpconfig']['tmp_dir'] = 'Wird mit der Einstellung für das temporäre Verzeichnis der Domain ersetzt.';
-$lng['admin']['phpconfig']['open_basedir_global'] = 'Wird mit der globalen Einstellung des Pfades ersetzt, der dem open_basedir hinzugefügt wird.';
+$lng['admin']['phpconfig']['open_basedir_global'] = 'Wird mit der globalen Einstellung des Pfades ersetzt, der dem open_basedir hinzugefügt wird (siehe Webserver Einstellungen).';
 $lng['admin']['phpconfig']['customer_email'] = 'Wird mit der E-Mail-Adresse des Kunden ersetzt, dem die Domain gehört.';
 $lng['admin']['phpconfig']['admin_email'] = 'Wird mit der E-Mail-Adresse des Admins ersetzt, dem die Domain gehört.';
 $lng['admin']['phpconfig']['domain'] = 'Wird mit der Domain ersetzt.';
@@ -932,11 +933,11 @@ $lng['update']['noupdatesavail'] = '<strong>Ihre Froxlor-Version ist aktuell.</s
 $lng['admin']['specialsettingsforsubdomains'] = 'Übernehme Einstellungen für alle Subdomains (*.beispiel.de)';
 $lng['serversettings']['specialsettingsforsubdomains']['description'] = 'Wenn ja, werden die individuellen Einstellungen für alle Subdomains übernommen.<br />Wenn nein, werden Subdomain-Specialsettings entfernt.';
 $lng['tasks']['outstanding_tasks'] = 'Ausstehende Cron-Aufgaben';
-$lng['tasks']['rebuild_webserverconfig'] = 'Neuerstellung der Webserver-Konfiguration';
-$lng['tasks']['adding_customer'] = 'Erstelle neuen Kunden %loginname%';
-$lng['tasks']['rebuild_bindconfig'] = 'Neuerstellung der Bind-Konfiguration';
-$lng['tasks']['creating_ftpdir'] = 'Erstelle Verzeichnis für neuen FTP-Benutzer';
-$lng['tasks']['deleting_customerfiles'] = 'Löschen von Kunden-Dateien %loginname%';
+$lng['tasks']['REBUILD_VHOST'] = 'Neuerstellung der Webserver-Konfiguration';
+$lng['tasks']['CREATE_HOME'] = 'Erstelle neuen Kunden %loginname%';
+$lng['tasks']['REBUILD_DNS'] = 'Neuerstellung der Bind-Konfiguration';
+$lng['tasks']['CREATE_FTP'] = 'Erstelle Verzeichnis für neuen FTP-Benutzer';
+$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Löschen von Kunden-Dateien %loginname%';
 $lng['tasks']['noneoutstanding'] = 'Zur Zeit gibt es keine ausstehenden Aufgaben für Froxlor';
 
 // ADDED IN FROXLOR 0.9.1
@@ -1152,8 +1153,8 @@ $lng['panel']['unlock'] = 'entsperren';
 $lng['question']['customer_reallyunlock'] = 'Wollen Sie den Kunden "%s" wirklich entsperren?';
 
 // ADDED IN FROXLOR 0.9.15
-$lng['serversettings']['perl_server']['title'] = 'Perl-Server-Ort';
-$lng['serversettings']['perl_server']['description'] = 'Der Standardwert ist diesem Guide entnommen: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
+$lng['serversettings']['perl_server']['title'] = 'Perl Server-Socket';
+$lng['serversettings']['perl_server']['description'] = 'Eine einfache Anleitung hier zu findet man unter <a target="blank" href="http://wiki.nginx.org/SimpleCGIhttps://www.nginx.com/resources/wiki/start/topics/examples/fcgiwrap/">nginx.com</a>';
 $lng['serversettings']['nginx_php_backend']['title'] = 'Nginx-PHP-Backend';
 $lng['serversettings']['nginx_php_backend']['description'] = 'Dies ist das Backend, auf dem PHP auf Anfragen von Nginx hört. Kann ein UNIX Socket oder eine IP:Port Kombination sein<br />*NICHT relevant bei php-fpm';
 $lng['serversettings']['phpreload_command']['title'] = 'PHP-Reload-Befehl';
@@ -1256,7 +1257,7 @@ $lng['serversettings']['diskquota_enabled'] = 'Quota aktiviert?';
 $lng['serversettings']['diskquota_repquota_path']['description'] = 'Pfad zu repquota';
 $lng['serversettings']['diskquota_quotatool_path']['description'] = 'Pfad zu quotatool';
 $lng['serversettings']['diskquota_customer_partition']['description'] = 'Partition, auf welcher die Kundendaten liegen';
-$lng['tasks']['diskspace_set_quota'] = 'Quota auf dem Dateisystem setzen';
+$lng['tasks']['CREATE_QUOTA'] = 'Quota auf dem Dateisystem setzen';
 $lng['error']['session_timeout'] = 'Wert zu niedrig';
 $lng['error']['session_timeout_desc'] = 'Der Wert der Session-Timeout sollte nicht unter einer Minute liegen.';
 
@@ -1268,9 +1269,9 @@ $lng['mysql']['size'] = 'Datenbankgröße';
 
 $lng['error']['invalidhostname'] = 'Hostname muss eine gültige Domain sein. Er darf weder leer sein noch nur aus Leerzeichen bestehen';
 
-$lng['traffic']['http'] = 'HTTP (MiB)';
-$lng['traffic']['ftp'] = 'FTP (MiB)';
-$lng['traffic']['mail'] = 'Mail (MiB)';
+$lng['traffic']['http'] = 'HTTP';
+$lng['traffic']['ftp'] = 'FTP';
+$lng['traffic']['mail'] = 'Mail';
 
 // ADDED IN 0.9.27-svn1
 $lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Idle-Timeout';
@@ -1285,7 +1286,7 @@ $lng['admin']['speciallogwarning'] = 'ACHTUNG: Durch diese Einstellungen werden
 // ADDED IN 0.9.28-svn2
 $lng['serversettings']['vmail_maildirname']['title'] = 'Maildir-(Unter-)Ordner';
 $lng['serversettings']['vmail_maildirname']['description'] = 'Der Maildir-Ordner innerhalb des Kontos des Benutzers (normalerweise \'Maildir\', in manchen Fällen auch \'.maildir\'). Sollen die E-Mails direkt in das Verzeichnis, diese Option leer lassen.';
-$lng['tasks']['remove_emailacc_files'] = 'E-Mail-Dateien des Kunden löschen';
+$lng['tasks']['DELETE_EMAIL_DATA'] = 'E-Mail-Dateien des Kunden löschen';
 
 // ADDED IN 0.9.28-svn5
 $lng['error']['operationnotpermitted'] = 'Diese Aktion ist nicht erlaubt!';
@@ -1324,6 +1325,8 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Erlaube Admins das T
 $lng['serversettings']['panel_allow_theme_change_customer'] = 'Erlaube Kunden das Theme zu wechseln';
 $lng['serversettings']['axfrservers']['title'] = 'AXFR Server';
 $lng['serversettings']['axfrservers']['description'] = 'Eine durch Kommas getrennte Liste von IP Adressen, die DNS-Zonen transferieren dürfen (AXFR).';
+$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode';
+$lng['serversettings']['powerdns_mode']['description'] = 'Wählen Sie den PowerDNS-Modus: Native für keine DNS-Replikation (Standard) / Master wenn eine DNS-Replikation benötigt wird.';
 $lng['panel']['ssleditor'] = 'SSL-Einstellungen für diese Domain';
 $lng['admin']['ipsandports']['ssl_paste_description'] = 'Bitte den Inhalt der Zertifikatsdatei in das Textfeld kopieren.';
 $lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Inhalt des SSL-Zertifikats (Certificate)';
@@ -1413,8 +1416,8 @@ $lng['panel']['ftpdesc'] = 'FTP-Beschreibung';
 $lng['admin']['cronsettings'] = 'Cronjob-Einstellungen';
 $lng['serversettings']['system_cronconfig']['title'] = 'Cron-Konfigurationsdatei';
 $lng['serversettings']['system_cronconfig']['description'] = 'Pfad zur Konfigurationsdatei des Cron-Dienstes. Diese Datei wird von Froxlor automatisch aktualisiert.<br />Hinweis: Bitte verwenden Sie <strong>exakt</strong> die gleiche Datei wie für den Froxlor-Haupt-Cronjob (Standard: /etc/cron.d/froxlor)!<br><br>Wird <b>FreeBSD</b> verwendet, sollte hier <i>/etc/crontab</i> angegeben werden!';
-$lng['tasks']['remove_ftpacc_files'] = 'Kunden FTP-Konto Dateien löschen';
-$lng['tasks']['regenerating_crond'] = 'Neuerstellung der cron.d-Datei';
+$lng['tasks']['DELETE_FTP_DATA'] = 'Kunden FTP-Konto Dateien löschen';
+$lng['tasks']['REBUILD_CRON'] = 'Neuerstellung der cron.d-Datei';
 $lng['serversettings']['system_crondreload']['title'] = 'Cron-Daemon reload Befehl';
 $lng['serversettings']['system_crondreload']['description'] = 'Geben Sie hier den Befehl zum Neuladen des Cron-Daemons an';
 $lng['admin']['integritycheck'] = 'Datenbankpr&uuml;fung';
@@ -1424,7 +1427,7 @@ $lng['admin']['integrityresult'] = 'Ergebnis';
 $lng['admin']['integrityfix'] = 'Probleme automatisch beheben';
 $lng['question']['admin_integritycheck_reallyfix'] = 'M&ouml;chten Sie wirklich versuchen s&auml;mtliche Datenbank-Integrit&auml;tsprobleme automatisch zu beheben?';
 $lng['serversettings']['system_croncmdline']['title'] = 'Cron Startbefehl (php Programm)';
-$lng['serversettings']['system_croncmdline']['description'] = 'Befehl zum Ausführen des Cronjobs. Ändern dieser Einstellung nur wenn nötig (Standard: "/usr/bin/nice -n 5 /usr/bin/php5 -q")!';
+$lng['serversettings']['system_croncmdline']['description'] = 'Befehl zum Ausführen des Cronjobs. Ändern dieser Einstellung nur wenn nötig (Standard: "/usr/bin/nice -n 5 /usr/bin/php -q")!';
 $lng['error']['cannotdeletehostnamephpconfig'] = 'Diese PHP-Konfiguration ist dem Froxlor-Vhost zugewiesen und kann daher nicht gelöscht werden.';
 $lng['error']['cannotdeletedefaultphpconfig'] = 'Diese PHP-Konfiguration ist als Standard hinterlegt und kann daher nicht gelöscht werden.';
 $lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Erlaube automatische Datenbank-Aktualisierungen';
@@ -1447,7 +1450,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
 $lng['serversettings']['panel_password_special_char']['title'] = 'Sonderzeichen-Liste';
 $lng['serversettings']['panel_password_special_char']['description'] = 'Mindestens eines dieser Sonderzeichen muss in dem Passwort vorkommen, sofern die Sonderzeichen-Option aktiviert ist.';
 $lng['phpfpm']['use_mod_proxy']['title'] = 'Verwende mod_proxy / mod_proxy_fcgi';
-$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Muss gesetzt sein bei Debian 9.x (Stretch)</strong>. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus';
+$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Muss gesetzt sein bei Debian 9.x (Stretch) oder neuer</strong>. Diese Option kann aktiviert werden, um php-fpm via mod_proxy_fcgi einzubinden. Dies setzt mindestens apache-2.4.9 voraus';
 $lng['error']['no_phpinfo'] = 'Entschuldigung, es ist nicht möglich die phpinfo() auszulesen.';
 
 $lng['admin']['movetoadmin'] = 'Kunde verschieben';
@@ -1490,8 +1493,8 @@ $lng['error']['sslredirectonlypossiblewithsslipport'] = 'Die Nutzung von Let\'s
 $lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt kann mittels ACME Wildcard-Domains nur via DNS validieren, sorry. Bitte den ServerAlias auf WWW setzen oder deaktivieren';
 $lng['panel']['letsencrypt'] = 'Benutzt Let\'s encrypt';
 $lng['crondesc']['cron_letsencrypt'] = 'Aktualisierung der Let\'s Encrypt Zertifikate';
-$lng['serversettings']['letsencryptca']['title'] = "Let's Encrypt Umgebung";
-$lng['serversettings']['letsencryptca']['description'] = "Let's Encrypt - Umgebung, welche genutzt wird um Zertifikate zu bestellen.";
+$lng['serversettings']['letsencryptca']['title'] = "ACME Umgebung";
+$lng['serversettings']['letsencryptca']['description'] = "Umgebung, welche genutzt wird um Zertifikate zu bestellen.";
 $lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt Ländercode";
 $lng['serversettings']['letsencryptcountrycode']['description'] = "2 - stelliger Ländercode, welcher benutzt wird um Let's Encrypt - Zertifikate zu bestellen.";
 $lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt Bundesland";
@@ -1546,7 +1549,7 @@ $lng['serversettings']['backupenabled']['title'] = "Backup für Kunden aktiviere
 $lng['serversettings']['backupenabled']['description'] = "Wenn dies aktiviert ist, kann der Kunde Sicherungen planen (cron-backup) welche ein Archiv in sein Heimatverzeichnis ablegt (Unterordner vom Kunden wählbar)";
 $lng['extras']['path_protection_label'] = '<strong class="red">Wichtig</strong>';
 $lng['extras']['path_protection_info'] = '<strong class="red">Wir raten dringend dazu den angegebenen Pfad zu schützen, siehe "Extras" -> "Verzeichnisschutz"</strong>';
-$lng['tasks']['backup_customerfiles'] = 'Datensicherung für Kunde %loginname%';
+$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Datensicherung für Kunde %loginname%';
 
 $lng['error']['dns_domain_nodns'] = 'DNS ist für diese Domain nicht aktiviert';
 $lng['error']['dns_content_empty'] = 'Keinen Inhalt angegeben';
@@ -1558,6 +1561,7 @@ $lng['error']['dns_mx_needdom'] = 'Der Wert des MX Eintrags muss ein gültiger D
 $lng['error']['dns_mx_noalias'] = 'Der MX Eintrag darf kein CNAME Eintrag sein.';
 $lng['error']['dns_cname_invaliddom'] = 'Ungültiger Domain-Name für CNAME Eintrag';
 $lng['error']['dns_cname_nomorerr'] = 'Es existiert bereits ein Eintrag mit dem gleichen Namen. Dieser Eintrag kann daher nicht für CNAME genutzt werden.';
+$lng['error']['dns_other_nomorerr'] = 'Es existiert bereits ein CNAME Eintrag mit dem gleichen Namen. Dieser Eintrag kann daher nicht für einen anderen genutzt werden.';
 $lng['error']['dns_ns_invaliddom'] = 'Ungültiger Domain-Name für NS Eintrag';
 $lng['error']['dns_srv_prioempty'] = 'Ungültige SRV Priorität angegeben';
 $lng['error']['dns_srv_invalidcontent'] = 'Ungültiger Wert des SRV Eintrags, dieser muss aus den Feldern weight, port und target, bestehen. Bsp.: 5 5060 sipserver.example.com.';
@@ -1635,8 +1639,8 @@ $lng['admin']['domain_http2']['title'] = 'HTTP2 Unterstützung';
 $lng['admin']['domain_http2']['description'] = 'Siehe <a target="_blank" href="https://de.wikipedia.org/wiki/Hypertext_Transfer_Protocol#HTTP.2F2">Wikipedia</a> für eine ausführliche Beschreibung von HTTP2';
 $lng['admin']['testmail'] = 'SMTP Test';
 $lng['success']['testmailsent'] = 'Test E-Mail erfolgreich gesendet';
-$lng['serversettings']['disable_le_selfcheck']['title'] = "Deaktiviere Let's Encrypt lokale Selbstprüfung";
-$lng['serversettings']['disable_le_selfcheck']['description'] = "Wenn aktiviert wird Froxlor <strong>keine</strong> Erreichbarkeitsprüfung des Tokens vornehmen. Nötig bei ge-NAT-eten IP-Adressen oder Ähnlichem";
+$lng['serversettings']['le_domain_dnscheck']['title'] = "Validiere DNS der Domains wenn Let's Encrypt genutzt wird";
+$lng['serversettings']['le_domain_dnscheck']['description'] = "Wenn aktiviert wird froxlor überprüfen ob die DNS Einträge der Domains, welche ein Let's Encrypt Zertifikat beantragt, mindestens auf eine der System IP Adressen auflöst.";
 $lng['menue']['phpsettings']['fpmdaemons'] = 'PHP-FPM Versionen';
 $lng['admin']['phpsettings']['activephpconfigs'] = 'In Verwendung für PHP-Konfiguration(en)';
 $lng['admin']['phpsettingsforsubdomains'] = 'PHP-Config für alle Subdomains übernehmen:';
@@ -1645,7 +1649,7 @@ $lng['serversettings']['leapiversion']['title'] = "Wählen Sie die Let's Encrypt
 $lng['serversettings']['leapiversion']['description'] = "Aktuell unterstützt froxlor lediglich die ACME v2 Implementierung von Let's Encrypt.";
 $lng['admin']['phpsettings']['pass_authorizationheader'] = 'Füge "-pass-header Authorization" / "CGIPassAuth On" in Vhosts ein';
 $lng['serversettings']['ssl']['ssl_protocols']['title'] = 'SSL Protokollversion festlegen';
-$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'Dies ist eine Liste von SSL/TLS Protokollversionen die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn SSL verwendet wird. <b>Hinweis:</b> Ältere Browser sind möglicherweise nicht vollständig zum neusten Protokoll kompatibel.<br /><br /><b>Standard-Wert ist:</b><pre>TLSv1, TLSv1.2</pre>';
+$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'Dies ist eine Liste von SSL/TLS Protokollversionen die genutzt werden sollen (oder auch nicht genutzt werden sollen), wenn SSL verwendet wird. <b>Hinweis:</b> Ältere Browser sind möglicherweise nicht vollständig zum neusten Protokoll kompatibel.<br /><br /><b>Standard-Wert ist:</b><pre>TLSv1.2</pre>';
 $lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Erlaubte Dateiendungen';
 $lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Beschränkt die Dateierweiterungen des Haupt-Skripts, das FPM zu parsen erlaubt. Dies kann Konfigurationsfehler auf der Webserverseite verhindern. Sie sollten FPM nur auf .php Erweiterungen beschränken, um zu verhindern, dass bösartige Nutzter andere Erweiterungen verwenden, um PHP Code auszuführen. Standardwert: .php';
 $lng['phpfpm']['ini_flags'] = 'Mögliche <strong>php_flag</strong>s für die php.ini. Pro Zeile eine Direktive';
@@ -1685,9 +1689,9 @@ $lng['apikeys']['allowed_from_help'] = 'Komma getrennte Liste von IPs. Standard
 $lng['apikeys']['valid_until'] = 'Gültig bis';
 $lng['apikeys']['valid_until_help'] = 'Datum Gültigkeitsende, Format JJJJ-MM-TT';
 $lng['serversettings']['enable_api']['title'] = 'Aktiviere externe API Nutzung';
-$lng['serversettings']['enable_api']['description'] = 'Um die froxlor API nutzen zu können, muss diese Option aktiviert sein. Für detaillierte Informationen siehe <a href="https://api.froxlor.org/" target="_new">https://api.froxlor.org/</a>';
+$lng['serversettings']['enable_api']['description'] = 'Um die froxlor API nutzen zu können, muss diese Option aktiviert sein. Für detaillierte Informationen siehe <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
 $lng['serversettings']['dhparams_file']['title'] = 'DHParams Datei (Diffie–Hellman key exchange)';
-$lng['serversettings']['dhparams_file']['description'] = 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.<br>Beispiel: /etc/apache2/ssl/dhparams.pem<br><br>Existiert die Datei nicht, wird sie wie folgt erstellt: <em>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096<em>. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.';
+$lng['serversettings']['dhparams_file']['description'] = 'Wird eine dhparams.pem Datei hier angegeben, wir sie in die Webserver Konfiguration mit eingefügt.<br>Beispiel: /etc/ssl/webserver/dhparams.pem<br><br>Existiert die Datei nicht, wird sie wie folgt erstellt: <em>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096<em>. Es wird empfohlen die Datei zu erstellen, bevor sie hier angegeben wird, da die Erstellung längere Zeit in Anspruch nimmt und den Cronjob blockiert.';
 $lng['2fa']['2fa'] = '2FA Optionen';
 $lng['2fa']['2fa_enabled'] = 'Aktiviere Zwei-Faktor Authentifizierung (2FA)';
 $lng['login']['2fa'] = 'Zwei-Faktor Authentifizierung (2FA)';
@@ -1710,8 +1714,8 @@ $lng['panel']['ihave_configured'] = 'Ich habe die Dienste konfiguriert';
 $lng['panel']['system_is_configured'] = 'Das System ist bereits konfiguriert';
 $lng['panel']['settings_before_configuration'] = 'Stelle sicher, dass die Einstellungen angepasst wurden bevor die Dienste konfiguriert werden.';
 $lng['panel']['alternative_cmdline_config'] = 'Alternativ, führe den folgenden Befehl als root-Benutzer auf der Shell aus, um die Dienste automatisch zu konfigurieren.';
-$lng['tasks']['remove_pdns_domain'] = 'Lösche Domain %s von PowerDNS Datenbank';
-$lng['tasks']['remove_ssl_domain'] = 'Lösche SSL Dateien von Domain %s';
+$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Lösche Domain %domain% von PowerDNS Datenbank';
+$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Lösche SSL Dateien von Domain %domain%';
 $lng['admin']['novhostcontainer'] = '<br><br><small class="red">Keine der IPs und Ports hat die Option "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" aktiviert, einige Einstellungen sind daher nicht verfügbar.</small>';
 $lng['serversettings']['errorlog_level']['title'] = 'Ausführlichkeit des Fehlerprotokolls';
 $lng['serversettings']['errorlog_level']['description'] = 'Steuert die Ausführlichkeit des Fehlerprotokolls. Voreinstellung ist "warn" bei Apache und "error" bei Nginx.';
@@ -1729,7 +1733,7 @@ $lng['serversettings']['default_sslvhostconf']['title'] = 'Standard SSL vHost-Ei
 $lng['serversettings']['includedefault_sslvhostconf'] = 'Nicht-SSL vHost-Einstellungen in SSL-vHost inkludieren';
 $lng['admin']['ownsslvhostsettings'] = 'Eigene SSL vHost-Einstellungen';
 $lng['admin']['ipsandports']['ssl_default_vhostconf_domain'] = 'Standard SSL vHost-Einstellungen für jeden Domain-Container';
-$lng['customer']['total_diskspace'] = 'Gesamtspeicherplatz (MiB)';
+$lng['customer']['total_diskspace'] = 'Gesamtspeicherplatz';
 $lng['admin']['domain_override_tls'] = 'Überschreibe System TLS Einstellungen';
 $lng['domains']['isaliasdomainof'] = 'Ist Aliasdomain für %s';
 $lng['serversettings']['apply_specialsettings_default']['title'] = 'Standardwert für "' . $lng['admin']['specialsettingsforsubdomains'] . "' Einstellung beim Bearbeiten einer Domain";
@@ -1747,3 +1751,41 @@ $lng['serversettings']['phpfpm_settings']['custom_config']['description'] = 'Fü
 
 $lng['serversettings']['awstats']['logformat']['title'] = 'LogFormat Einstellung';
 $lng['serversettings']['awstats']['logformat']['description'] = 'Wenn ein benutzerdefiniertes LogFormat beim Webserver verwendet wird, muss LogFormat von awstats ebenso angepasst werden.<br/>Standard ist 1. Für weitere Informationen siehe Dokumentation unter <a target="_blank" href="https://awstats.sourceforge.io/docs/awstats_config.html#LogFormat">hier</a>.';
+$lng['error']['cannotdeletesuperadmin'] = 'Der erste Administrator kann nicht gelöscht werden.';
+$lng['error']['no_wwwcnamae_ifwwwalias'] = 'Es kann kein CNAME Eintrag für "www" angelegt werden, da die Domain einen www-Alias aktiviert hat. Ändere diese Einstellung auf "Kein Alias" oder "Wildcard Alias"';
+$lng['serversettings']['hide_incompatible_settings'] = 'Inkompatible Einstellungen ausblenden';
+
+$lng['serversettings']['soaemail'] = 'Mail-Adresse für SOA-Einträge (verwendet Panel-Absender-Name der Panel-Einstellungen falls leer)';
+$lng['imprint'] = 'Impressum';
+$lng['serversettings']['imprint_url']['title'] = 'URL zum Impressum';
+$lng['serversettings']['imprint_url']['description'] = 'Die URL zur Impressums-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.';
+$lng['terms'] = 'AGB';
+$lng['serversettings']['terms_url']['title'] = 'URL zu den AGB';
+$lng['serversettings']['terms_url']['description'] = 'Die URL zur AGB-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.';
+$lng['privacy'] = 'Datenschutzerklärung';
+$lng['serversettings']['privacy_url']['title'] = 'URL zur Datenschutzerklärung';
+$lng['serversettings']['privacy_url']['description'] = 'Die URL zur Datenschutzerklärungs-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.';
+$lng['admin']['domaindefaultalias'] = 'Standard ServerAlias-Angabe für neue Domains';
+
+$lng['serversettings']['logo_image_header']['title'] = 'Logo Bild (Header)';
+$lng['serversettings']['logo_image_header']['description'] = 'Das hochgeladene Bild wird als Logo oben links nach dem Login angezeigt (empfohlene Höhe sind 30px)';
+$lng['serversettings']['logo_image_login']['title'] = 'Logo Bild (Login)';
+$lng['serversettings']['logo_image_login']['description'] = 'Das hochgeladene Bild wird als Logo während des Logins angezeigt';
+$lng['panel']['image_field_delete'] = 'Das momentan vorhandene Bild löschen';
+$lng['serversettings']['logo_overridetheme']['title'] = 'Überschreibe Theme-Logo mit "Logo Bild" (Header und Login, siehe unten)';
+$lng['serversettings']['logo_overridetheme']['description'] = 'Ist die Nutzung eines hochgeladenen Logos gewünscht, muss diese Einstellung auf "Ja" gesetzt werden. Alternativ kann weiterhin das Theme-basierte Überschreiben via "logo_custom.png" und "logo_custom_login.png" genutzt werden.';
+$lng['serversettings']['logo_overridecustom']['title'] = 'Überschreibe benutzerdefinierte Theme-Logos (logo_custom.png und logo_custom_login.png) mit "Logo Bold" (Header und Login, siehe unten)';
+$lng['serversettings']['logo_overridecustom']['description'] = 'Ist diese Einstellung aktiv, werden benutzerdefinierte Logos im Theme-Ordner mit dem "Logo Bild" ersetzt';
+$lng['serversettings']['createstdsubdom_default']['title'] = 'Standardwert für "'.$lng['admin']['stdsubdomain_add'].'" bei Erstellung eines Kunden';
+$lng['serversettings']['froxlorusergroup']['title'] = 'Benutzerdefinierte Gruppe für alle Kunden-Benutzer';
+$lng['serversettings']['froxlorusergroup']['description'] = 'Voraussetzung hierfür ist die Nutzung von libnss-extrausers (System-Einstellungen). Ein leerer Wert bedeutet, es wird keine Gruppe erstellt, bzw. vorhandene Gruppe wird entfernt.';
+$lng['error']['local_group_exists'] = 'Die angegebene Gruppe existiert bereits auf dem System';
+$lng['error']['local_group_invalid'] = 'Der angegebene Gruppen-Name ist nicht gültig';
+$lng['error']['invaliddnsforletsencrypt'] = 'Die DNS-Einträge der Domain enhalten keine der gewählten IP Adressen. Let\'s Encrypt Zertifikats-Erstellung ist nicht möglich.';
+$lng['error']['notallowedphpconfigused'] = 'Nutzung einer PHP-Konfiguration welche nicht dem Kunden zugeordnet ist';
+
+$lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'] = 'Für aktuelle Kunden automatisch hinzufügen';
+$lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'] = 'Ist diese Einstellung aktiv, wird die Konfiguration automatisch allen aktuell existierenden Kunden-Accounts zugewiesen. Diese Einstellung ist nicht permanent, kann aber mehrfach / nach Bedarf ausgeführt werden.';
+$lng['error']['pathmustberelative'] = 'Der Benutzer hat nicht die benötigten Berechtigungen, um Pfade außerhalb des Kunden-Heimatverzeichnisses anzugeben. Bitte einen relativen Pfad angeben (kein führendes /).';
+$lng['serversettings']['acmeshpath']['title'] = 'Pfad zu acme.sh';
+$lng['serversettings']['acmeshpath']['description'] = 'Installationspfad zu acme.sh, inklusive acme.sh Script<br>Standard ist <b>/root/.acme.sh/acme.sh</b>';

lng/italian.lng.php

@@ -584,10 +584,6 @@ $lng['traffic']['sumhttp'] = 'Sommatoria Traffico in ingresso HTTP';
 $lng['traffic']['sumftp'] = 'Sommatoria Traffico in ingresso FTP';
 $lng['traffic']['summail'] = 'Sommatoria Traffico in ingresso Mail';
 
-// ADDED IN 1.2.19-svn4.5
-
-$lng['serversettings']['no_robots']['title'] = 'Permetti ai robot dei motori di ricerca di indicizzare l\'installazione di Froxlor';
-
 // ADDED IN 1.2.19-svn6
 
 $lng['admin']['loggersettings'] = 'Impostazioni Log';
@@ -614,7 +610,7 @@ $lng['panel']['reseller'] = 'rivenditore';
 $lng['panel']['admin'] = 'amministratore';
 $lng['panel']['customer'] = 'cliente/i';
 $lng['error']['nomessagetosend'] = 'Non hai inserito un messaggio.';
-$lng['error']['noreceipientsgiven'] = 'Non hai specificato alcun destinatario';
+$lng['error']['norecipientsgiven'] = 'Non hai specificato alcun destinatario';
 $lng['admin']['emaildomain'] = 'Email dominio';
 $lng['admin']['email_only'] = 'Solo email?';
 $lng['admin']['wwwserveralias'] = 'Aggiungi a "www." ServerAlias';
@@ -622,14 +618,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Questa è una porta SSL?';
 $lng['admin']['ipsandports']['ssl_cert_file'] = 'Percorso del certificato SSL (SSL certificate)';
 $lng['panel']['send'] = 'invia';
 $lng['admin']['subject'] = 'Oggetto';
-$lng['admin']['receipient'] = 'Destinatario';
+$lng['admin']['recipient'] = 'Destinatario';
 $lng['admin']['message'] = 'Scrivi un messaggio';
 $lng['admin']['text'] = 'Messaggio';
 $lng['menu']['message'] = 'Messaggi';
 $lng['error']['errorsendingmail'] = 'Il messaggio a "%s" fallito';
 $lng['error']['cannotreaddir'] = 'Impossibile leggere la cartella "%s"';
 $lng['message']['success'] = 'Inviato correttamente il messaggio a %s recipients';
-$lng['message']['noreceipients'] = 'Nessuna e-mail è stata inviata perch¸ non ci sono i destinatari nel database';
+$lng['message']['norecipients'] = 'Nessuna e-mail è stata inviata perch¸ non ci sono i destinatari nel database';
 $lng['admin']['sslsettings'] = 'Impostazioni SSL';
 $lng['cronjobs']['notyetrun'] = 'Non ancora avviato';
 $lng['serversettings']['default_vhostconf']['title'] = 'Impostazioni default vhost';
@@ -888,11 +884,11 @@ $lng['update']['noupdatesavail'] = '<strong>È già presente l\'ultima versione
 $lng['admin']['specialsettingsforsubdomains'] = 'Applica le impostazioni speciali a tutti i sottodomini (*.esempio.com)';
 $lng['serversettings']['specialsettingsforsubdomains']['description'] = 'Se si queste impostazioni personalizzate dei vhost saranno aggiunte a tutti sottodomini; se no le impostazioni speciali dei sottodomini verranno rimosse.';
 $lng['tasks']['outstanding_tasks'] = 'Processi Cron in sospeso';
-$lng['tasks']['rebuild_webserverconfig'] = 'Ricostruzione della configurazione del webserver';
-$lng['tasks']['adding_customer'] = 'Aggiunto il nuovo cliente %loginname%';
-$lng['tasks']['rebuild_bindconfig'] = 'Ricostruzione della configurazione di bind';
-$lng['tasks']['creating_ftpdir'] = 'Creazione delle cartelle per i nuovi utenti ftp';
-$lng['tasks']['deleting_customerfiles'] = 'Eliminazione dei file del cliente %loginname%';
+$lng['tasks']['REBUILD_VHOST'] = 'Ricostruzione della configurazione del webserver';
+$lng['tasks']['CREATE_HOME'] = 'Aggiunto il nuovo cliente %loginname%';
+$lng['tasks']['REBUILD_DNS'] = 'Ricostruzione della configurazione di bind';
+$lng['tasks']['CREATE_FTP'] = 'Creazione delle cartelle per i nuovi utenti ftp';
+$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Eliminazione dei file del cliente %loginname%';
 $lng['tasks']['noneoutstanding'] = 'Attualmente non ci sono processi in sospeso per Froxlor';
 
 // ADDED IN FROXLOR 0.9.1
@@ -1107,9 +1103,6 @@ $lng['panel']['unlock'] = 'unlock';
 $lng['question']['customer_reallyunlock'] = 'Sei sicuro di voler sbloccare il cliente %s?';
 
 // ADDED IN FROXLOR 0.9.15-svn1
-$lng['serversettings']['perl_server']['title'] = 'Localizzazione del server Perl';
-$lng['serversettings']['perl_server']['description'] = 'Di default è impostato per utilizzare la guida disponibile sul sito: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
-
 $lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
 $lng['serversettings']['nginx_php_backend']['description'] = 'questo è dove in ascolto il processo PHP per le richieste da nginx, può essere un socket unix combinazione IP:Porta';
 $lng['serversettings']['phpreload_command']['title'] = 'Comando riavvio PHP';
@@ -1493,7 +1486,7 @@ $lng['serversettings']['diskquota_enabled'] = 'Quota attivita?';
 $lng['serversettings']['diskquota_repquota_path']['description'] = 'Percorso a repquota';
 $lng['serversettings']['diskquota_quotatool_path']['description'] = 'Percorso al quotatool';
 $lng['serversettings']['diskquota_customer_partition']['description'] = 'Partizione, sulla quale sono salvati i dati dei clienti';
-$lng['tasks']['diskspace_set_quota'] = 'Setta quota al filesystem';
+$lng['tasks']['CREATE_QUOTA'] = 'Setta quota al filesystem';
 $lng['error']['session_timeout'] = 'Valore troppo basso';
 $lng['error']['session_timeout_desc'] = 'Non dovresti settare il timeout della sessione ad un valore minore di 1 minuto.';
 $lng['admin']['assignedmax'] = 'Assegnato / Max';
@@ -1513,7 +1506,7 @@ $lng['admin']['delete_statistics'] = 'Elimina Statistiche';
 $lng['admin']['speciallogwarning'] = 'AVVISO: Cambiando questa impostazione perderai tutte le vecchie statistiche per questo dominio. Se sei sicuro che vuoi cambiare questo digita "%s" nel campo sottostante e clicca il bottone "elimina".<br /><br />';
 $lng['serversettings']['vmail_maildirname']['title'] = 'nome Maildir';
 $lng['serversettings']['vmail_maildirname']['description'] = 'cartella Maildir nell account utente. Normalmente \'Maildir\', in alcune implementazioni \'.maildir\', e direttamente nella cartella utente se lasciato vuoto.';
-$lng['tasks']['remove_emailacc_files'] = 'Elimina i dati di posta elettronica del cliente.';
+$lng['tasks']['DELETE_EMAIL_DATA'] = 'Elimina i dati di posta elettronica del cliente.';
 $lng['error']['operationnotpermitted'] = 'Operazione non permessa!';
 $lng['error']['featureisdisabled'] = 'Funzionalità %s è disabilitata. Perfavore contatta il tuo fornitore di servizi.';
 $lng['serversettings']['catchall_enabled']['title'] = 'Usa Catchall';
@@ -1623,8 +1616,8 @@ $lng['admin']['cronsettings'] = 'Impostazioni Cronjob';
 $lng['serversettings']['system_cronconfig']['title'] = 'File di configurazione Cron';
 $lng['serversettings']['system_cronconfig']['description'] = 'Percorso al file di configurazione del servizio cron. Questo file verrà aggiornato regolarmente ed automaticamente da froxlor.<br />
 Nota: Perfavore <b>sii sicuro</b> di usare lo stesso nome di file come per il cronjob principale di froxlor (predefinito: /etc/cron.d/froxlor)!<br><br>Se usi <b>FreeBSD</b>, qui specifica: <i>/etc/crontab</i>!';
-$lng['tasks']['remove_ftpacc_files'] = 'Elimina i dati account-ftp del cliente.';
-$lng['tasks']['regenerating_crond'] = 'Ricostruisci il file cron.d';
+$lng['tasks']['DELETE_FTP_DATA'] = 'Elimina i dati account-ftp del cliente.';
+$lng['tasks']['REBUILD_CRON'] = 'Ricostruisci il file cron.d';
 $lng['serversettings']['system_crondreload']['title'] = 'Commando per riavviare il servizio Cron';
 $lng['serversettings']['system_crondreload']['description'] = 'Specifica il commando da eseguire per riavviare il servizio cron del tuo sistema';
 $lng['admin']['integritycheck'] = 'Validazione Database';
@@ -1635,7 +1628,7 @@ $lng['admin']['integrityresult'] = 'Risultato';
 $lng['admin']['integrityfix'] = 'Risolvi problemi automaticamente';
 $lng['question']['admin_integritycheck_reallyfix'] = 'Vuoi veramente provare a risolvere i problemi di integrità del database automaticamente?';
 $lng['serversettings']['system_croncmdline']['title'] = 'Commando di esecuzione Cron (binario php)';
-$lng['serversettings']['system_croncmdline']['description'] = 'Commando per eseguire i nostri cronjob. Modificalo soltanto se sai cosa stai facendo (predefinito: "/usr/bin/nice -n 5 /usr/bin/php5 -q")!';
+$lng['serversettings']['system_croncmdline']['description'] = 'Commando per eseguire i nostri cronjob. Modificalo soltanto se sai cosa stai facendo (predefinito: "/usr/bin/nice -n 5 /usr/bin/php -q")!';
 $lng['error']['cannotdeletehostnamephpconfig'] = 'Questa configurazione PHP è utilizzata dal vhost Froxlor e non può essere eliminata.';
 $lng['error']['cannotdeletedefaultphpconfig'] = 'Questa configurazione PHP è impostata come predefinita e non può essere eliminata.';
 $lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Permetti aggiornamenti automatici del database';

lng/portugues.lng.php

@@ -529,7 +529,6 @@ $lng['traffic']['distribution'] = '<font color="#019522">FTP</font> | <font colo
 $lng['traffic']['sumhttp'] = 'Resumo Tráfego de HTTP em';
 $lng['traffic']['sumftp'] = 'Resumo Tráfego de FTP em';
 $lng['traffic']['summail'] = 'Resumo Tráfego de HTTP em';
-$lng['serversettings']['no_robots']['title'] = 'Aceitar robôs de procura na index de seuFroxlor';
 $lng['admin']['loggersettings'] = 'Configurações de Logs';
 $lng['serversettings']['logger']['enable'] = 'Habilitar/Desabilitar Logs';
 $lng['serversettings']['logger']['severity'] = 'Nível de Logs';
@@ -555,7 +554,7 @@ $lng['panel']['reseller'] = 'Revenda';
 $lng['panel']['admin'] = 'Administrador';
 $lng['panel']['customer'] = 'Cliente(s)';
 $lng['error']['nomessagetosend'] = 'Você não entrou com uma mensagem';
-$lng['error']['noreceipientsgiven'] = 'Você não especificou um destinatário';
+$lng['error']['norecipientsgiven'] = 'Você não especificou um destinatário';
 $lng['admin']['emaildomain'] = 'Domínio de Email';
 $lng['admin']['email_only'] = 'Somente Email?';
 $lng['admin']['wwwserveralias'] = 'Adicionar um "www." ServerAlias';
@@ -563,14 +562,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Esta é uma porta SSL?';
 $lng['admin']['ipsandports']['ssl_cert_file'] = 'Caminho para o certificado SSL';
 $lng['panel']['send'] = 'Enviar';
 $lng['admin']['subject'] = 'Assunto';
-$lng['admin']['receipient'] = 'Destinatário';
+$lng['admin']['recipient'] = 'Destinatário';
 $lng['admin']['message'] = 'Escrever uma mensagem';
 $lng['admin']['text'] = 'Mensagem';
 $lng['menu']['message'] = 'Mensagens';
 $lng['error']['errorsendingmail'] = 'A mensagem para "%s" falhou';
 $lng['error']['cannotreaddir'] = 'Não é possível ler o diretório "%s"';
 $lng['message']['success'] = 'Mensagens enviadas para %s destinatários com sucesso';
-$lng['message']['noreceipients'] = 'Email não enviado porque não tem destinatário no banco de dados';
+$lng['message']['norecipients'] = 'Email não enviado porque não tem destinatário no banco de dados';
 $lng['admin']['sslsettings'] = 'Configuração de SSL';
 $lng['cronjobs']['notyetrun'] = 'Ainda não está rodando';
 $lng['serversettings']['default_vhostconf']['title'] = 'Configuração de Vhost padrão';