maketank/Froxlor
2
0
Fork 0
Code Pull Requests Releases Activity

merged with v0.10.33

Browse Source
This commit is contained in:
Udo Waechter
2022-03-01 12:29:50 +01:00
parent 2e81445a4e 1d7d32130a
commit b118883013
221 changed files with 16958 additions and 5289 deletions
Download Patch File Download Diff File Expand all files Collapse all files

137
lng/english.lng.php
View File

@@ -60,8 +60,8 @@ $lng['customer']['phone'] = 'Phone';
$lng['customer']['fax'] = 'Fax';
$lng['customer']['email'] = 'Email';
$lng['customer']['customernumber'] = 'Customer ID';
$lng['customer']['diskspace'] = 'Webspace (MiB)';
$lng['customer']['traffic'] = 'Traffic (GiB)';
$lng['customer']['diskspace'] = 'Webspace';
$lng['customer']['traffic'] = 'Traffic';
$lng['customer']['mysqls'] = 'MySQL-databases';
$lng['customer']['emails'] = 'Email-addresses';
$lng['customer']['accounts'] = 'Email-accounts';
@@ -71,6 +71,7 @@ $lng['customer']['subdomains'] = 'Subdomains';
$lng['customer']['domains'] = 'Domains';
$lng['customer']['unlimited'] = '∞';
$lng['customer']['mib'] = 'MiB';
$lng['customer']['gib'] = 'GiB';
/**
* Customermenue
@@ -205,6 +206,7 @@ $lng['error']['mydomain'] = '\'Domain\'';
$lng['error']['mydocumentroot'] = '\'Documentroot\'';
$lng['error']['loginnameexists'] = 'Loginname %s already exists';
$lng['error']['emailiswrong'] = 'Email-address %s contains invalid characters or is incomplete';
$lng['error']['alternativeemailiswrong'] = 'The given alternative email address %s to send the credentials to seems to be invalid';
$lng['error']['loginnameiswrong'] = 'Loginname "%s" contains illegal characters.';
$lng['error']['loginnameiswrong2'] = 'Loginname contains too many characters. Only %s characters are allowed.';
$lng['error']['userpathcombinationdupe'] = 'Combination of username and path already exists';
@@ -318,6 +320,7 @@ $lng['admin']['templates']['COMPANY'] = 'Replaces with the customer\'s company n
$lng['admin']['templates']['USERNAME'] = 'Replaced with the customer\'s account username.';
$lng['admin']['templates']['PASSWORD'] = 'Replaced with the customer\'s account password.';
$lng['admin']['templates']['EMAIL'] = 'Replaced with the address of the POP3/IMAP account.';
$lng['admin']['templates']['CUSTOMER_NO'] = 'Replaces with the customer number';
$lng['admin']['webserver'] = 'Webserver';
$lng['admin']['bindzonewarning'] = $lng['panel']['emptyfordefault'] . '<br /><strong class="red">ATTENTION:</strong> If you use a zonefile you will have to manage all required records for all sub-zones manually as well.';
@@ -330,7 +333,7 @@ $lng['serversettings']['session_timeout']['description'] = 'How long does a user
$lng['serversettings']['accountprefix']['title'] = 'Customer prefix';
$lng['serversettings']['accountprefix']['description'] = 'Which prefix should customer accounts have?';
$lng['serversettings']['mysqlprefix']['title'] = 'SQL Prefix';
$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix';
$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix</br>Use "DBNAME" as the value, a database name field is used together with the customer name as a prefix.';
$lng['serversettings']['ftpprefix']['title'] = 'FTP Prefix';
$lng['serversettings']['ftpprefix']['description'] = 'Which prefix should ftp accounts have?<br/><b>If you change this you also have to change the Quota SQL Query in your FTP Server config file in case you use it!</b> ';
$lng['serversettings']['documentroot_prefix']['title'] = 'Home directory';
@@ -412,6 +415,7 @@ $lng['admin']['ipsandports']['add'] = 'Add IP/Port';
$lng['admin']['ipsandports']['edit'] = 'Edit IP/Port';
$lng['admin']['ipsandports']['ipandport'] = 'IP/Port';
$lng['admin']['ipsandports']['ip'] = 'IP';
$lng['admin']['ipsandports']['ipnote'] = '<div id="ipnote" class="red">Note: Although private ip addresses are allowed, some features like DNS might not behave correctly.<br>Only use private ip addresses if you are sure.</div>';
$lng['admin']['ipsandports']['port'] = 'Port';
// ADDED IN 1.2.13-rc3
@@ -620,16 +624,12 @@ $lng['traffic']['months'][9] = "September";
$lng['traffic']['months'][10] = "October";
$lng['traffic']['months'][11] = "November";
$lng['traffic']['months'][12] = "December";
$lng['traffic']['mb'] = "Traffic (MiB)";
$lng['traffic']['mb'] = "Traffic";
$lng['traffic']['distribution'] = '<font color="#019522">FTP</font> | <font color="#0000FF">HTTP</font> | <font color="#800000">Mail</font>';
$lng['traffic']['sumhttp'] = 'Total HTTP-Traffic';
$lng['traffic']['sumftp'] = 'Total FTP-Traffic';
$lng['traffic']['summail'] = 'Total Mail-Traffic';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Allow searchengine-robots to index your Froxlor installation';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Log settings';
@@ -664,7 +664,7 @@ $lng['panel']['reseller'] = 'reseller';
$lng['panel']['admin'] = 'admin';
$lng['panel']['customer'] = 'customer/s';
$lng['error']['nomessagetosend'] = 'You did not enter a message.';
$lng['error']['noreceipientsgiven'] = 'You did not specify any recipient';
$lng['error']['norecipientsgiven'] = 'You did not specify any recipient';
$lng['admin']['emaildomain'] = 'Emaildomain';
$lng['admin']['email_only'] = 'Only email?';
$lng['admin']['wwwserveralias'] = 'Add a "www." ServerAlias';
@@ -672,18 +672,18 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Is this an SSL Port?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Path to the SSL Certificate';
$lng['panel']['send'] = 'send';
$lng['admin']['subject'] = 'Subject';
$lng['admin']['receipient'] = 'Recipient';
$lng['admin']['recipient'] = 'Recipient';
$lng['admin']['message'] = 'Write a Message';
$lng['admin']['text'] = 'Message';
$lng['menu']['message'] = 'Messages';
$lng['error']['errorsendingmail'] = 'The message to "%s" failed';
$lng['error']['cannotreaddir'] = 'Unable to read directory "%s"';
$lng['message']['success'] = 'Successfully sent message to %s recipients';
$lng['message']['noreceipients'] = 'No e-mail has been sent because there are no recipients in the database';
$lng['message']['norecipients'] = 'No e-mail has been sent because there are no recipients in the database';
$lng['admin']['sslsettings'] = 'SSL settings';
$lng['cronjobs']['notyetrun'] = 'Not yet run';
$lng['serversettings']['default_vhostconf']['title'] = 'Default vHost-settings';
$lng['admin']['specialsettings_replacements'] = "You can use the following variables:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code><br/>";
$lng['admin']['specialsettings_replacements'] = "You can use the following variables:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code>, <code>{FPMSOCKET}</code> (if applicable)<br/>";
$lng['serversettings']['default_vhostconf']['description'] = 'The content of this field will be included into this ip/port vHost container directly. ' . $lng['admin']['specialsettings_replacements'] . ' Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!';
$lng['serversettings']['apache_globaldiropt']['title'] = 'Directory options for customer-prefix';
$lng['serversettings']['apache_globaldiropt']['description'] = 'The content of this field will be included into the 05_froxlor_dirfix_nofcgid.conf apache config. If empty, the default value is used:<br><br>apache >=2.4<br><code>Require all granted<br>AllowOverride All</code><br><br>apache <=2.2<br><code>Order allow,deny<br>allow from all</code>';
@@ -702,6 +702,8 @@ $lng['dkim']['dkim_dkimkeys']['title'] = 'KeyList filename';
$lng['dkim']['dkim_dkimkeys']['description'] = '<em>Filename</em> of the DKIM KeyList parameter specified in the dkim-milter configuration';
$lng['dkim']['dkimrestart_command']['title'] = 'Milter restart command';
$lng['dkim']['dkimrestart_command']['description'] = 'Please specify the restart command for the DKIM milter service';
$lng['dkim']['privkeysuffix']['title'] = 'Private keys suffix';
$lng['dkim']['privkeysuffix']['description'] = 'You can specify an (optional) filename extension/suffix for the generate dkim private keys. Some services like dkim-filter requires this to be empty';
// ADDED IN 1.2.19-svn9
@@ -806,7 +808,7 @@ $lng['serversettings']['mail_quota_enabled']['enforcelink'] = 'Click here to enf
$lng['question']['admin_quotas_reallywipe'] = 'Do you really want to wipe all quotas on table mail_users? This cannot be reverted!';
$lng['question']['admin_quotas_reallyenforce'] = 'Do you really want to enforce the default quota to all Users? This cannot be reverted!';
$lng['error']['vmailquotawrong'] = 'The quotasize must be positive number.';
$lng['customer']['email_quota'] = 'E-mail quota (MiB)';
$lng['customer']['email_quota'] = 'E-mail quota';
$lng['customer']['email_imap'] = 'E-mail IMAP';
$lng['customer']['email_pop3'] = 'E-mail POP3';
$lng['customer']['mail_quota'] = 'Mailquota';
@@ -853,7 +855,7 @@ $lng['admin']['phpconfig']['pear_dir'] = 'Will be replaced with the global setti
$lng['admin']['phpconfig']['open_basedir_c'] = 'Will insert a ; (semicolon) to comment-out/disable open_basedir when set';
$lng['admin']['phpconfig']['open_basedir'] = 'Will be replaced with the open_basedir setting of the domain.';
$lng['admin']['phpconfig']['tmp_dir'] = 'Will be replaced with the temporary directory of the domain.';
$lng['admin']['phpconfig']['open_basedir_global'] = 'Will be replaced with the global value of the path which will be attached to the open_basedir.';
$lng['admin']['phpconfig']['open_basedir_global'] = 'Will be replaced with the global value of the path which will be attached to the open_basedir (see webserver settings).';
$lng['admin']['phpconfig']['customer_email'] = 'Will be replaced with the e-mail address of the customer who owns this domain.';
$lng['admin']['phpconfig']['admin_email'] = 'Will be replaced with e-mail address of the admin who owns this domain.';
$lng['admin']['phpconfig']['domain'] = 'Will be replaced with the domain.';
@@ -928,7 +930,7 @@ $lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Default vHost-settin
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentification, set this only if you know what it is.';
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentication, set this only if you know what it is.';
$lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
@@ -959,11 +961,11 @@ $lng['update']['noupdatesavail'] = '<strong>You already have the latest Froxlor
$lng['admin']['specialsettingsforsubdomains'] = 'Apply specialsettings to all subdomains (*.example.com)';
$lng['serversettings']['specialsettingsforsubdomains']['description'] = 'If yes these custom vHost-settings will be added to all subdomains; if no subdomain-specialsettings are being removed.';
$lng['tasks']['outstanding_tasks'] = 'Outstanding cron-tasks';
$lng['tasks']['rebuild_webserverconfig'] = 'Rebuilding webserver-configuration';
$lng['tasks']['adding_customer'] = 'Adding new customer %loginname%';
$lng['tasks']['rebuild_bindconfig'] = 'Rebuilding bind-configuration';
$lng['tasks']['creating_ftpdir'] = 'Creating directory for new ftp-user';
$lng['tasks']['deleting_customerfiles'] = 'Deleting customer-files %loginname%';
$lng['tasks']['REBUILD_VHOST'] = 'Rebuilding webserver-configuration';
$lng['tasks']['CREATE_HOME'] = 'Adding new customer %loginname%';
$lng['tasks']['REBUILD_DNS'] = 'Rebuilding bind-configuration';
$lng['tasks']['CREATE_FTP'] = 'Creating directory for new ftp-user';
$lng['tasks']['DELETE_CUSTOMER_FILES'] = 'Deleting customer-files %loginname%';
$lng['tasks']['noneoutstanding'] = 'There are currently no outstanding tasks for Froxlor';
// ADDED IN FROXLOR 0.9.1
@@ -1174,8 +1176,8 @@ $lng['panel']['unlock'] = 'Unlock';
$lng['question']['customer_reallyunlock'] = 'Do you really want to unlock customer %s?';
// ADDED IN FROXLOR 0.9.15
$lng['serversettings']['perl_server']['title'] = 'Perl server location';
$lng['serversettings']['perl_server']['description'] = 'Default is set for using the guide found at: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
$lng['serversettings']['perl_server']['title'] = 'Perl server socket location';
$lng['serversettings']['perl_server']['description'] = 'A simple guide can be found at: <a target="blank" href="https://www.nginx.com/resources/wiki/start/topics/examples/fcgiwrap/">nginx.com</a>';
$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
$lng['serversettings']['nginx_php_backend']['description'] = 'this is where the PHP process is listening for requests from nginx, can be a unix socket of ip:port combination<br />*NOT used with php-fpm';
$lng['serversettings']['phpreload_command']['title'] = 'PHP reload command';
@@ -1529,7 +1531,7 @@ $lng['serversettings']['diskquota_enabled'] = 'Quota activated?';
$lng['serversettings']['diskquota_repquota_path']['description'] = 'Path to repquota';
$lng['serversettings']['diskquota_quotatool_path']['description'] = 'Path to quotatool';
$lng['serversettings']['diskquota_customer_partition']['description'] = 'Partition, on which the customer files are stored';
$lng['tasks']['diskspace_set_quota'] = 'Set quota on filesystem';
$lng['tasks']['CREATE_QUOTA'] = 'Set quota on filesystem';
$lng['error']['session_timeout'] = 'Value too low';
$lng['error']['session_timeout_desc'] = 'You should not set the session timeout lower than 1 minute.';
@@ -1541,9 +1543,9 @@ $lng['mysql']['size'] = 'Size';
$lng['error']['invalidhostname'] = 'Hostname needs to be a valid domain. It can\'t be empty nor can it consist only of whitespaces';
$lng['traffic']['http'] = 'HTTP (MiB)';
$lng['traffic']['ftp'] = 'FTP (MiB)';
$lng['traffic']['mail'] = 'Mail (MiB)';
$lng['traffic']['http'] = 'HTTP';
$lng['traffic']['ftp'] = 'FTP';
$lng['traffic']['mail'] = 'Mail';
// ADDED IN 0.9.27-svn1
$lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Idle Timeout';
@@ -1559,7 +1561,7 @@ $lng['admin']['speciallogwarning'] = 'WARNING: By changing this setting you will
// ADDED IN 0.9.28-svn2
$lng['serversettings']['vmail_maildirname']['title'] = 'Maildir name';
$lng['serversettings']['vmail_maildirname']['description'] = 'Maildir directory into user\'s account. Normally \'Maildir\', in some implementations \'.maildir\', and directly into user\'s directory if left blank.';
$lng['tasks']['remove_emailacc_files'] = 'Delete customer e-mail data.';
$lng['tasks']['DELETE_EMAIL_DATA'] = 'Delete customer e-mail data.';
// ADDED IN 0.9.28-svn5
$lng['error']['operationnotpermitted'] = 'Operation not permitted!';
@@ -1598,12 +1600,14 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Allow admins to chan
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Allow customers to change the theme';
$lng['serversettings']['axfrservers']['title'] = 'AXFR servers';
$lng['serversettings']['axfrservers']['description'] = 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.';
$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode';
$lng['serversettings']['powerdns_mode']['description'] = 'Select the PoweDNS mode: Native for no replication (Default) / Master if DNS replication is needed.';
$lng['panel']['ssleditor'] = 'SSL settings for this domain';
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete certificate content in the textbox';
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentification, set this only if you know what it is.';
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentication, set this only if you know what it is.';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
@@ -1613,7 +1617,7 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regulary so avoid storing data in there manually.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
// Added in Froxlor 0.9.30
@@ -1688,8 +1692,8 @@ $lng['panel']['ftpdesc'] = 'FTP description';
$lng['admin']['cronsettings'] = 'Cronjob settings';
$lng['serversettings']['system_cronconfig']['title'] = 'Cron configuration file';
$lng['serversettings']['system_cronconfig']['description'] = 'Path to the cron-service configuration-file. This file will be updated regularly and automatically by froxlor.<br />Note: Please <b>be sure</b> to use the same filename as for the main froxlor cronjob (default: /etc/cron.d/froxlor)!<br><br>If you are using <b>FreeBSD</b>, please specify <i>/etc/crontab</i> here!';
$lng['tasks']['remove_ftpacc_files'] = 'Delete customer ftp-account data.';
$lng['tasks']['regenerating_crond'] = 'Rebuilding the cron.d-file';
$lng['tasks']['DELETE_FTP_DATA'] = 'Delete customer ftp-account data.';
$lng['tasks']['REBUILD_CRON'] = 'Rebuilding the cron.d-file';
$lng['serversettings']['system_crondreload']['title'] = 'Cron-daemon reload command';
$lng['serversettings']['system_crondreload']['description'] = 'Specify the command to execute in order to reload your systems cron-daemon';
$lng['admin']['integritycheck'] = 'Database validation';
@@ -1699,7 +1703,7 @@ $lng['admin']['integrityresult'] = 'Result';
$lng['admin']['integrityfix'] = 'Fix problems automatically';
$lng['question']['admin_integritycheck_reallyfix'] = 'Do you really want to try fixing all database integrity problems automatically?';
$lng['serversettings']['system_croncmdline']['title'] = 'Cron execution command (php-binary)';
$lng['serversettings']['system_croncmdline']['description'] = 'Command to execute our cronjobs. Change this only if you know what you are doing (default: "/usr/bin/nice -n 5 /usr/bin/php5 -q")!';
$lng['serversettings']['system_croncmdline']['description'] = 'Command to execute our cronjobs. Change this only if you know what you are doing (default: "/usr/bin/nice -n 5 /usr/bin/php -q")!';
$lng['error']['cannotdeletehostnamephpconfig'] = 'This PHP-configuration is used by the Froxlor-vhost and cannot be deleted.';
$lng['error']['cannotdeletedefaultphpconfig'] = 'This PHP-configuration is set as default and cannot be deleted.';
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Allow automatic database updates';
@@ -1722,7 +1726,7 @@ $lng['serversettings']['panel_password_special_char_required']['description'] =
$lng['serversettings']['panel_password_special_char']['title'] = 'Special characters list';
$lng['serversettings']['panel_password_special_char']['description'] = 'One of these characters is required if the above option is set.';
$lng['phpfpm']['use_mod_proxy']['title'] = 'Use mod_proxy / mod_proxy_fcgi';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch)</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['phpfpm']['use_mod_proxy']['description'] = '<strong class="red">Must be enabled when using Debian 9.x (Stretch) or newer</strong>. Activate to use php-fpm via mod_proxy_fcgi. Requires at least apache-2.4.9';
$lng['error']['no_phpinfo'] = 'Sorry, unable to read phpinfo()';
$lng['admin']['movetoadmin'] = 'Move customer';
@@ -1830,15 +1834,15 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
// Added for let's encrypt
$lng['admin']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> This feature is still in beta.';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely';
$lng['panel']['letsencrypt'] = 'Using Let\'s encrypt';
$lng['crondesc']['cron_letsencrypt'] = 'updating Let\'s Encrypt certificates';
$lng['serversettings']['letsencryptca']['title'] = "Let's Encrypt environment";
$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt certificates.";
$lng['serversettings']['letsencryptca']['title'] = "ACME environment";
$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt / ZeroSSL certificates.";
$lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt country code";
$lng['serversettings']['letsencryptcountrycode']['description'] = "2 letter country code used to generate Let's Encrypt certificates.";
$lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt state";
@@ -1894,7 +1898,7 @@ $lng['serversettings']['backupenabled']['title'] = "Enable backup for customers"
$lng['serversettings']['backupenabled']['description'] = "If activated, the customer will be able to schedule backup jobs (cron-backup) which generates an archive within his docroot (subdirectory chosable by customer)";
$lng['extras']['path_protection_label'] = '<strong class="red">Important</strong>';
$lng['extras']['path_protection_info'] = '<strong class="red">We strongly recommend protecting the given path, see "Extras" -> "Directory protection"</strong>';
$lng['tasks']['backup_customerfiles'] = 'Backup job for customer %loginname%';
$lng['tasks']['CREATE_CUSTOMER_BACKUP'] = 'Backup job for customer %loginname%';
$lng['error']['dns_domain_nodns'] = 'DNS is not enabled for this domain';
$lng['error']['dns_content_empty'] = 'No content given';
@@ -1906,6 +1910,7 @@ $lng['error']['dns_mx_needdom'] = 'The MX content value must be a valid domain-n
$lng['error']['dns_mx_noalias'] = 'The MX-content value cannot be an CNAME entry.';
$lng['error']['dns_cname_invaliddom'] = 'Invalid domain-name for CNAME record';
$lng['error']['dns_cname_nomorerr'] = 'There already exists a resource-record with the same record-name. It can not be used as CNAME.';
$lng['error']['dns_other_nomorerr'] = 'There already exists a CNAME record with the same record-name. It can not be used for another type.';
$lng['error']['dns_ns_invaliddom'] = 'Invalid domain-name for NS record';
$lng['error']['dns_srv_prioempty'] = 'Invalid SRV priority given';
$lng['error']['dns_srv_invalidcontent'] = 'Invalid SRV content, must contain of fields weight, port and target, e.g.: 5 5060 sipserver.example.com.';
@@ -1919,7 +1924,7 @@ $lng['dnseditor']['records'] = 'records';
$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are prefered, only missing entries will be automatically generated.';
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.';
$lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
@@ -1984,8 +1989,8 @@ $lng['admin']['domain_http2']['title'] = 'HTTP2 support';
$lng['admin']['domain_http2']['description'] = 'See <a target="_blank" href="https://en.wikipedia.org/wiki/HTTP/2">Wikipedia</a> for a detailed explanation of HTTP2';
$lng['admin']['testmail'] = 'SMTP test';
$lng['success']['testmailsent'] = 'Test mail sent successfully';
$lng['serversettings']['disable_le_selfcheck']['title'] = "Disable Let's Encrypt local self-check";
$lng['serversettings']['disable_le_selfcheck']['description'] = "If activated, froxlor will <strong>not</strong> perform its self-check for token accessibility. Needed for NATed IP's or similar.";
$lng['serversettings']['le_domain_dnscheck']['title'] = "Validate DNS of domains when using Let's Encrypt";
$lng['serversettings']['le_domain_dnscheck']['description'] = "If activated, froxlor will validate whether the domain which requests a Let's Encrypt certificate resolves to at least one of the system ip addresses.";
$lng['menue']['phpsettings']['fpmdaemons'] = 'PHP-FPM versions';
$lng['admin']['phpsettings']['activephpconfigs'] = 'In use for php-config(s)';
$lng['admin']['phpsettingsforsubdomains'] = 'Apply php-config to all subdomains:';
@@ -1994,7 +1999,7 @@ $lng['serversettings']['leapiversion']['title'] = "Choose Let's Encrypt ACME imp
$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protcol versions.<br /><br /><b>Default value is:</b><pre>TLSv1, TLSv1.2</pre>';
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protocol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
$lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
@@ -2037,9 +2042,9 @@ $lng['apikeys']['allowed_from_help'] = 'Comma separated list of ip addresses. De
$lng['apikeys']['valid_until'] = 'Valid until';
$lng['apikeys']['valid_until_help'] = 'Date until valid, format YYYY-MM-DD';
$lng['serversettings']['enable_api']['title'] = 'Enable external API usage';
$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://api.froxlor.org/" target="_new">https://api.froxlor.org/</a>';
$lng['serversettings']['enable_api']['description'] = 'In order to use the froxlor API you need to activate this option. For more detailed information see <a href="https://docs.froxlor.org/apiguide/index.html" target="_new">https://docs.froxlor.org/</a>';
$lng['serversettings']['dhparams_file']['title'] = 'DHParams file (Diffie–Hellman key exchange)';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/apache2/ssl/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/apache2/ssl/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['serversettings']['dhparams_file']['description'] = 'If a dhparams.pem file is specified here it will be included in the webserver configuration. Leave empty to disable.<br>Example: /etc/ssl/webserver/dhparams.pem<br><br>If the file does not exist, it will be created automatically with the following command: <em>openssl dhparam -out /etc/ssl/webserver/dhparams.pem 4096<em>. It is recommended to create the file prior to specifying it here as the creation takes quite a while and blocks the cronjob.';
$lng['2fa']['2fa'] = '2FA options';
$lng['2fa']['2fa_enabled'] = 'Activate Two-factor authentication (2FA)';
$lng['login']['2fa'] = 'Two-factor authentication (2FA)';
@@ -2062,8 +2067,8 @@ $lng['panel']['ihave_configured'] = 'I have configured the services';
$lng['panel']['system_is_configured'] = 'System is already set as configured';
$lng['panel']['settings_before_configuration'] = 'Please be sure you adjusted the settings prior to configuring the services here';
$lng['panel']['alternative_cmdline_config'] = 'Alternatively, just run the following command as root-user in your shell to configure the services automatically';
$lng['tasks']['remove_pdns_domain'] = 'Delete domain %s from PowerDNS database';
$lng['tasks']['remove_ssl_domain'] = 'Delete ssl files of domain %s';
$lng['tasks']['DELETE_DOMAIN_PDNS'] = 'Delete domain %domain% from PowerDNS database';
$lng['tasks']['DELETE_DOMAIN_SSL'] = 'Delete ssl files of domain %domain%';
$lng['admin']['novhostcontainer'] = '<br><br><small class="red">None of the IPs and ports has the "' . $lng['admin']['ipsandports']['create_vhostcontainer'] . '" option enabled, many settings here will not be available</small>';
$lng['serversettings']['errorlog_level']['title'] = 'Error log-level';
$lng['serversettings']['errorlog_level']['description'] = 'Specify the error log level. Default is "warn" for apache-users and "error" for nginx-users.';
@@ -2081,7 +2086,7 @@ $lng['serversettings']['default_sslvhostconf']['title'] = 'Default SSL vHost-set
$lng['serversettings']['includedefault_sslvhostconf'] = 'Include non-SSL vHost-settings in SSL-vHost';
$lng['admin']['ownsslvhostsettings'] = 'Own SSL vHost-settings';
$lng['admin']['ipsandports']['ssl_default_vhostconf_domain'] = 'Default SSL vHost-settings for every domain container';
$lng['customer']['total_diskspace'] = 'Total diskspace (MiB)';
$lng['customer']['total_diskspace'] = 'Total diskspace';
$lng['admin']['domain_override_tls'] = 'Override system TLS settings';
$lng['domains']['isaliasdomainof'] = 'Is aliasdomain for %s';
$lng['serversettings']['apply_specialsettings_default']['title'] = 'Default value for "' . $lng['admin']['specialsettingsforsubdomains'] . "' setting when editing a domain";
@@ -2099,3 +2104,41 @@ $lng['serversettings']['phpfpm_settings']['custom_config']['description'] = 'Add
$lng['serversettings']['awstats']['logformat']['title'] = 'LogFormat setting';
$lng['serversettings']['awstats']['logformat']['description'] = 'If you use customized logformat for your webserver, you need change the awstats LogFormat too.<br/>Default is 1. For more information check documentation <a target="_blank" href="https://awstats.sourceforge.io/docs/awstats_config.html#LogFormat">here</a>.';
$lng['error']['cannotdeletesuperadmin'] = 'The first admin cannot be deleted.';
$lng['error']['no_wwwcnamae_ifwwwalias'] = 'Cannot set CNAME record for "www" as domain is set to generate a www-alias. Please change settings to either "No alias" or "Wildcard alias"';
$lng['serversettings']['hide_incompatible_settings'] = 'Hide incompatible settings';
$lng['serversettings']['soaemail'] = 'Mail address to use in SOA records (defaults to sender address from panel settings if empty)';
$lng['imprint'] = 'Legal notes';
$lng['serversettings']['imprint_url']['title'] = 'URL to legal notes / imprint';
$lng['serversettings']['imprint_url']['description'] = 'Specify an URL to your legal notes / imprint site. The link will be visible on the login screen and on the footer when logged in.';
$lng['terms'] = 'Terms of use';
$lng['serversettings']['terms_url']['title'] = 'URL to terms of use';
$lng['serversettings']['terms_url']['description'] = 'Specify an URL to your terms of use site. The link will be visible on the login screen and on the footer when logged in.';
$lng['privacy'] = 'Privacy policy';
$lng['serversettings']['privacy_url']['title'] = 'URL to privacy policy';
$lng['serversettings']['privacy_url']['description'] = 'Specify an URL to your privacy policy site / imprint site. The link will be visible on the login screen and on the footer when logged in.';
$lng['admin']['domaindefaultalias'] = 'Default ServerAlias value for new domains';
$lng['serversettings']['logo_image_header']['title'] = 'Logo Image (Header)';
$lng['serversettings']['logo_image_header']['description'] = 'Upload your own logo image to be shown in the header after login (recommended height 30px)';
$lng['serversettings']['logo_image_login']['title'] = 'Logo Image (Login)';
$lng['serversettings']['logo_image_login']['description'] = 'Upload your own logo image to be shown during login';
$lng['panel']['image_field_delete'] = 'Delete the existing current image';
$lng['serversettings']['logo_overridetheme']['title'] = 'Overwrites logo defined in theme by "Logo Image" (Header and Login, see below)';
$lng['serversettings']['logo_overridetheme']['description'] = 'This needs to be set to "true" if you intend to use your uploaded logo; alternatively you can still use the theme-based "logo_custom.png" and "logo_custom_login.png" possibility.';
$lng['serversettings']['logo_overridecustom']['title'] = 'Overwrite custom logo (logo_custom.png and logo_custom_login.png) defined in theme by "Logo Image" (Header and Login, see below)';
$lng['serversettings']['logo_overridecustom']['description'] = 'Set this to "true" if you want to ignore theme-specific custom logos for header and login and use "Logo Image"';
$lng['serversettings']['createstdsubdom_default']['title'] = 'Preselected value for "'.$lng['admin']['stdsubdomain_add'].'" when creating a customer';
$lng['serversettings']['froxlorusergroup']['title'] = 'Custom system group for all customer users';
$lng['serversettings']['froxlorusergroup']['description'] = 'Usage of libnss-extrausers (system-settings) is required for this to take effect. An empty value skips creation or removes existing group.';
$lng['error']['local_group_exists'] = 'The given group already exists on the system.';
$lng['error']['local_group_invalid'] = 'The given group name is invalid';
$lng['error']['invaliddnsforletsencrypt'] = 'The domains DNS does not include any of the chosen IP addresses. Let\'s Encrypt certificate generation not possible.';
$lng['error']['notallowedphpconfigused'] = 'Trying to use php-config which is not assigned to customer';
$lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'] = 'Assign this configuration to all currently existing customers';
$lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'] = 'Set this to "true" if you want to assign this configuration to all currently existing customers so it can be used by them. This setting is not permanent but can be run multiple times.';
$lng['error']['pathmustberelative'] = 'The user does not have the permission to specify directories outside the customers home-directory. Please specify a relative path (no leading /).';
$lng['serversettings']['acmeshpath']['title'] = 'Path to acme.sh';
$lng['serversettings']['acmeshpath']['description'] = 'Set this to where acme.sh is installed to, including the acme.sh script<br>Default is <b>/root/.acme.sh/acme.sh</b>';