Tagging release 0.9.15

.gitignore

@@ -1,10 +0,0 @@
-packages/*
-lib/classes/htmlpurifier/library/HTMLPurifier/DefinitionCache/Serializer/*/
-temp/*
-templates/*
-install/update.log
-.buildpath
-.project
-.settings/
-*.diff
-*~

COPYING

@@ -2,7 +2,7 @@
 		       Version 2, June 1991
 
  Copyright (C) 1989, 1991 Free Software Foundation, Inc.
-                       51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
+                          675 Mass Ave, Cambridge, MA 02139, USA
  Everyone is permitted to copy and distribute verbatim copies
  of this license document, but changing it is not allowed.
 
@@ -55,7 +55,7 @@ patent must be licensed for everyone's free use or not licensed at all.
 
   The precise terms and conditions for copying, distribution and
 modification follow.
-
+
 		    GNU GENERAL PUBLIC LICENSE
    TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
 
@@ -110,7 +110,7 @@ above, provided that you also meet all of these conditions:
     License.  (Exception: if the Program itself is interactive but
     does not normally print such an announcement, your work based on
     the Program is not required to print an announcement.)
-
+
 These requirements apply to the modified work as a whole.  If
 identifiable sections of that work are not derived from the Program,
 and can be reasonably considered independent and separate works in
@@ -168,7 +168,7 @@ access to copy from a designated place, then offering equivalent
 access to copy the source code from the same place counts as
 distribution of the source code, even though third parties are not
 compelled to copy the source along with the object code.
-
+
   4. You may not copy, modify, sublicense, or distribute the Program
 except as expressly provided under this License.  Any attempt
 otherwise to copy, modify, sublicense or distribute the Program is
@@ -225,7 +225,7 @@ impose that choice.
 
 This section is intended to make thoroughly clear what is believed to
 be a consequence of the rest of this License.
-
+
   8. If the distribution and/or use of the Program is restricted in
 certain countries either by patents or by copyrighted interfaces, the
 original copyright holder who places the Program under this License
@@ -278,3 +278,4 @@ PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
 POSSIBILITY OF SUCH DAMAGES.
 
 		     END OF TERMS AND CONDITIONS
+

actions/admin/settings/000.version.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(

actions/admin/settings/100.panel.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Language
- *
+ * @version    $Id$
  */
 
 return array(
@@ -32,32 +32,6 @@ return array(
 					'option_options_method' => 'getLanguages',
 					'save_method' => 'storeSettingField',
 					),
-				'panel_default_theme' => array(
-					'label' => array('title' => $lng['panel']['theme'], 'description' => $lng['serversettings']['default_theme']),
-					'settinggroup' => 'panel',
-					'varname' => 'default_theme',
-					'type' => 'option',
-					'default' => 'Froxlor',
-					'option_mode' => 'one',
-					'option_options_method' => 'getThemes',
-					'save_method' => 'storeSettingField',
-					),
-				'panel_allow_theme_change_customer' => array(
-					'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
-					'settinggroup' => 'panel',
-					'varname' => 'allow_theme_change_customer',
-					'type' => 'bool',
-					'default' => true,
-					'save_method' => 'storeSettingField',
-					),
-				'panel_allow_theme_change_admin' => array(
-					'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
-					'settinggroup' => 'panel',
-					'varname' => 'allow_theme_change_admin',
-					'type' => 'bool',
-					'default' => true,
-					'save_method' => 'storeSettingField'
-					),
 				'panel_natsorting' => array(
 					'label' => $lng['serversettings']['natsorting'],
 					'settinggroup' => 'panel',
@@ -90,24 +64,7 @@ return array(
 					'type' => 'option',
 					'default' => 'Manual',
 					'option_mode' => 'one',
-					'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']),
+					'option_options' => array('Manual' => 'Manual', 'Dropdown' => 'Dropdown'),
-					'save_method' => 'storeSettingField',
-					),
-				'use_webfonts' => array(
-					'label' => $lng['serversettings']['enablewebfonts'],
-					'settinggroup' => 'panel',
-					'varname' => 'use_webfonts',
-					'type' => 'bool',
-					'default' => true,
-					'save_method' => 'storeSettingField',
-					),
-				'webfont' => array(
-					'label' => $lng['serversettings']['definewebfont']['title'],
-					'settinggroup' => 'panel',
-					'varname' => 'webfont',
-					'type' => 'string',
-					'default' => 'Numans',
-					'string_emptyallowed' => false,
 					'save_method' => 'storeSettingField',
 					),
 				'panel_adminmail' => array(
@@ -194,6 +151,14 @@ return array(
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
+				'admin_froxlor_graphic' => array(
+					'label' => $lng['admin']['froxlor_graphic'],
+					'settinggroup' => 'admin',
+					'varname' => 'froxlor_graphic',
+					'type' => 'string',
+					'default' => '',
+					'save_method' => 'storeSettingField',
+					),
 				'panel_allow_domain_change_admin' => array(
 					'label' => $lng['serversettings']['panel_allow_domain_change_admin'],
 					'settinggroup' => 'panel',
@@ -210,14 +175,6 @@ return array(
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
-				'panel_phpconfigs_hidestdsubdomain' => array(
-					'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
-					'settinggroup' => 'panel',
-					'varname' => 'phpconfigs_hidestdsubdomain',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					),
 				),
 			),
 		),

actions/admin/settings/110.accounts.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(

actions/admin/settings/120.system.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -27,18 +27,8 @@ return array(
 					'settinggroup' => 'system',
 					'varname' => 'documentroot_prefix',
 					'type' => 'string',
-					'string_type' => 'dir',
 					'default' => '/var/customers/webs/',
 					'save_method' => 'storeSettingField',
-					'plausibility_check_method' => 'checkPathConflicts'
-					),
-				'system_documentroot_use_default_value' => array(
-					'label' => $lng['serversettings']['documentroot_use_default_value'],
-					'settinggroup' => 'system',
-					'varname' => 'documentroot_use_default_value',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
 					),
 				'system_ipaddress' => array(
 					'label' => $lng['serversettings']['ipaddress'],
@@ -67,31 +57,6 @@ return array(
 					'type' => 'string',
 					'default' => '',
 					'save_method' => 'storeSettingHostname',
-					'plausibility_check_method' => 'checkHostname',
-					),
-				'system_froxlordirectlyviahostname' => array(
-					'label' => $lng['serversettings']['froxlordirectlyviahostname'],
-					'settinggroup' => 'system',
-					'varname' => 'froxlordirectlyviahostname',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					),
-				'system_validatedomain' => array(
-					'label' => $lng['serversettings']['validate_domain'],
-					'settinggroup' => 'system',
-					'varname' => 'validate_domain',
-					'type' => 'bool',
-					'default' => true,
-					'save_method' => 'storeSettingField',
-					),
-				'system_stdsubdomain' => array(
-					'label' => $lng['serversettings']['stdsubdomainhost'],
-					'settinggroup' => 'system',
-					'varname' => 'stdsubdomain',
-					'type' => 'string',
-					'default' => '',
-					'save_method' => 'storeSettingHostname',
 					),
 				'system_mysql_access_host' => array(
 					'label' => $lng['serversettings']['mysql_access_host'],
@@ -131,35 +96,6 @@ return array(
 					'type' => 'hidden',
 					'default' => 'www-data',
 					),
-				'system_report_enable' => array(
-					'label' => $lng['serversettings']['report']['report'],
-					'settinggroup' => 'system',
-					'varname' => 'report_enable',
-					'type' => 'bool',
-					'default' => true,
-					'cronmodule' => 'froxlor/reports',
-					'save_method' => 'storeSettingField',
-					),
-				'system_report_webmax' => array(
-					'label' => $lng['serversettings']['report']['webmax'],
-					'settinggroup' => 'system',
-					'varname' => 'report_webmax',
-					'type' => 'int',
-					'int_min' => 1,
-					'int_max' => 150,
-					'default' => 90,
-					'save_method' => 'storeSettingField',
-					),
-				'system_report_trafficmax' => array(
-					'label' => $lng['serversettings']['report']['trafficmax'],
-					'settinggroup' => 'system',
-					'varname' => 'report_trafficmax',
-					'type' => 'int',
-					'int_min' => 1,
-					'int_max' => 150,
-					'default' => 90,
-					'save_method' => 'storeSettingField',
-					),
 				'system_debug_cron' => array(
 					'label' => $lng['serversettings']['cron']['debug'],
 					'settinggroup' => 'system',

actions/admin/settings/130.webserver.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -33,15 +33,6 @@ return array(
 					'save_method' => 'storeSettingField',
 					'overview_option' => true
 					),
-				'system_apache_24' => array(
-					'label' => $lng['serversettings']['apache_24'],
-					'settinggroup' => 'system',
-					'varname' => 'apache24',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
-					),
 				'system_httpuser' => array(
 					'label' => $lng['admin']['webserver_user'],
 					'settinggroup' => 'system',
@@ -85,6 +76,38 @@ return array(
 					'default' => '/etc/apache2/htpasswd/',
 					'save_method' => 'storeSettingField',
 					),
+				'system_apachereload_command' => array(
+					'label' => $lng['serversettings']['apachereload_command'],
+					'settinggroup' => 'system',
+					'varname' => 'apachereload_command',
+					'type' => 'string',
+					'default' => '/etc/init.d/apache2 reload',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpreload_command' => array(
+					'label' => $lng['serversettings']['phpreload_command'],
+					'settinggroup' => 'system',
+					'varname' => 'phpreload_command',
+					'type' => 'string',
+					'default' => '',
+					'save_method' => 'storeSettingField',
+					),
+				'system_nginx_php_backend' => array(
+					'label' => $lng['serversettings']['nginx_php_backend'],
+					'settinggroup' => 'system',
+					'varname' => 'nginx_php_backend',
+					'type' => 'string',
+					'default' => '127.0.0.1:8888',
+					'save_method' => 'storeSettingField',
+					),
+				'system_mod_log_sql' => array(
+					'label' => $lng['serversettings']['mod_log_sql'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_log_sql',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					),
 				'system_logfiles_directory' => array(
 					'label' => $lng['serversettings']['logfiles_directory'],
 					'settinggroup' => 'system',
@@ -94,15 +117,6 @@ return array(
 					'default' => '/var/customers/logs/',
 					'save_method' => 'storeSettingField',
 					),
-				'system_customersslpath' => array(
-					'label' => $lng['serversettings']['customerssl_directory'],
-					'settinggroup' => 'system',
-					'varname' => 'customer_ssl_path',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/etc/apache2/ssl/',
-					'save_method' => 'storeSettingField',
-					),
 				'system_phpappendopenbasedir' => array(
 					'label' => $lng['serversettings']['phpappendopenbasedir'],
 					'settinggroup' => 'system',
@@ -130,42 +144,6 @@ return array(
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					),
-				'system_apachereload_command' => array(
-					'label' => $lng['serversettings']['apachereload_command'],
-					'settinggroup' => 'system',
-					'varname' => 'apachereload_command',
-					'type' => 'string',
-					'default' => '/etc/init.d/apache2 reload',
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpreload_command' => array(
-					'label' => $lng['serversettings']['phpreload_command'],
-					'settinggroup' => 'system',
-					'varname' => 'phpreload_command',
-					'type' => 'string',
-					'default' => '',
-					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('nginx')
-					),
-				'system_nginx_php_backend' => array(
-					'label' => $lng['serversettings']['nginx_php_backend'],
-					'settinggroup' => 'system',
-					'varname' => 'nginx_php_backend',
-					'type' => 'string',
-					'default' => '127.0.0.1:8888',
-					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('nginx')
-					),
-				'nginx_fastcgiparams' => array(
-					'label' => $lng['serversettings']['nginx_fastcgiparams'],
-					'settinggroup' => 'nginx',
-					'varname' => 'fastcgiparams',
-					'type' => 'string',
-					'string_type' => 'file',
-					'default' => '/etc/nginx/fastcgi_params',
-					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('nginx')
-					),
 				'defaultwebsrverrhandler_enabled' => array(
 					'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
 					'settinggroup' => 'defaultwebsrverrhandler',
@@ -181,7 +159,6 @@ return array(
 					'type' => 'string',
 					'default' => '',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2', 'nginx')
 					),
 				'defaultwebsrverrhandler_err403' => array(
 					'label' => $lng['serversettings']['defaultwebsrverrhandler_err403'],
@@ -190,7 +167,6 @@ return array(
 					'type' => 'string',
 					'default' => '',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2', 'nginx')
 					),
 				'defaultwebsrverrhandler_err404' => array(
 					'label' => $lng['serversettings']['defaultwebsrverrhandler_err404'],
@@ -207,7 +183,6 @@ return array(
 					'type' => 'string',
 					'default' => '',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2', 'nginx')
 					),
 				'customredirect_enabled' => array(
 					'label' => $lng['serversettings']['customredirect_enabled'],
@@ -216,7 +191,6 @@ return array(
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2', 'lighttpd')
 					),
 				'customredirect_default' => array(
 					'label' => $lng['serversettings']['customredirect_default'],
@@ -227,9 +201,72 @@ return array(
 					'option_mode' => 'one',
 					'option_options_method' => 'getRedirectCodes',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2', 'lighttpd')
+					),
-					)
+				),
-				)
+			),
-			)
+		'ssl' => array(
-		)
+			'title' => $lng['admin']['sslsettings'],
+			'fields' => array(
+				'system_ssl_enabled' => array(
+					'label' => $lng['serversettings']['ssl']['use_ssl'],
+					'settinggroup' => 'system',
+					'varname' => 'use_ssl',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'overview_option' => true
+					),
+				'system_ssl_cert_file' => array(
+					'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
+					'settinggroup' => 'system',
+					'varname' => 'ssl_cert_file',
+					'type' => 'string',
+					'string_type' => 'file',
+					'string_emptyallowed' => true,
+					'default' => '/etc/apache2/apache2.pem',
+					'save_method' => 'storeSettingField',
+					),
+				'system_ssl_key_file' => array(
+					'label' => $lng['serversettings']['ssl']['ssl_key_file'],
+					'settinggroup' => 'system',
+					'varname' => 'ssl_key_file',
+					'type' => 'string',
+					'string_type' => 'file',
+					'string_emptyallowed' => true,
+					'default' => '/etc/apache2/apache2.key',
+					'save_method' => 'storeSettingField',
+					),
+				'system_ssl_ca_file' => array(
+					'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
+					'settinggroup' => 'system',
+					'varname' => 'ssl_ca_file',
+					'type' => 'string',
+					'string_type' => 'file',
+					'string_emptyallowed' => true,
+					'default' => '',
+					'save_method' => 'storeSettingField',
+					),
+				'system_ssl_cert_chainfile' => array(
+					'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
+					'settinggroup' => 'system',
+					'varname' => 'ssl_cert_chainfile',
+					'type' => 'string',
+					'string_type' => 'file',
+					'string_emptyallowed' => true,
+					'default' => '',
+					'save_method' => 'storeSettingField',
+					),
+				'system_ssl_openssl_cnf' => array(
+					'label' => $lng['serversettings']['ssl']['openssl_cnf'],
+					'settinggroup' => 'system',
+					'varname' => 'openssl_cnf',
+					'type' => 'text',
+					'default' => '',
+					'save_method' => 'storeSettingField',
+					),
+				),
+			),
+		),
 	);
+
+?>

actions/admin/settings/131.ssl.php

@@ -1,77 +0,0 @@
-<?php
-
-/**
- * This file is part of the Froxlor project.
- * Copyright (c) 2003-2009 the SysCP Team (see authors).
- * Copyright (c) 2010 the Froxlor Team (see authors).
- *
- * For the full copyright and license information, please view the COPYING
- * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
- *
- * @copyright  (c) the authors
- * @author     Florian Lippert <flo@syscp.org> (2003-2009)
- * @author     Froxlor team <team@froxlor.org> (2010-)
- * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
- * @package    Settings
- *
- */
-
-return array(
-	'groups' => array(
-			'ssl' => array(
-					'title' => $lng['admin']['sslsettings'],
-					'fields' => array(
-							'system_ssl_enabled' => array(
-									'label' => $lng['serversettings']['ssl']['use_ssl'],
-									'settinggroup' => 'system',
-									'varname' => 'use_ssl',
-									'type' => 'bool',
-									'default' => false,
-									'save_method' => 'storeSettingField',
-									'overview_option' => true
-							),
-							'system_ssl_cert_file' => array(
-									'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
-									'settinggroup' => 'system',
-									'varname' => 'ssl_cert_file',
-									'type' => 'string',
-									'string_type' => 'file',
-									'string_emptyallowed' => true,
-									'default' => '/etc/apache2/apache2.pem',
-									'save_method' => 'storeSettingField',
-							),
-							'system_ssl_key_file' => array(
-									'label' => $lng['serversettings']['ssl']['ssl_key_file'],
-									'settinggroup' => 'system',
-									'varname' => 'ssl_key_file',
-									'type' => 'string',
-									'string_type' => 'file',
-									'string_emptyallowed' => true,
-									'default' => '/etc/apache2/apache2.key',
-									'save_method' => 'storeSettingField',
-							),
-							'system_ssl_ca_file' => array(
-									'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
-									'settinggroup' => 'system',
-									'varname' => 'ssl_ca_file',
-									'type' => 'string',
-									'string_type' => 'file',
-									'string_emptyallowed' => true,
-									'default' => '',
-									'save_method' => 'storeSettingField',
-							),
-							'system_ssl_cert_chainfile' => array(
-									'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
-									'settinggroup' => 'system',
-									'varname' => 'ssl_cert_chainfile',
-									'type' => 'string',
-									'string_type' => 'file',
-									'string_emptyallowed' => true,
-									'default' => '',
-									'save_method' => 'storeSettingField',
-							)
-					)
-			)
-		)
-	);

actions/admin/settings/135.fcgid.php

@@ -12,14 +12,13 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
 	'groups' => array(
 		'fcgid' => array(
 			'title' => $lng['admin']['fcgid_settings'],
-			'websrv_avail' => array('apache2', 'lighttpd'),
 			'fields' => array(
 				'system_mod_fcgid_enabled' => array(
 					'label' => $lng['serversettings']['mod_fcgid'],
@@ -28,7 +27,6 @@ return array(
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
-					'plausibility_check_method' => 'checkFcgidPhpFpm',
 					'overview_option' => true
 					),					
 				'system_mod_fcgid_configdir' => array(
@@ -66,10 +64,9 @@ return array(
 					'settinggroup' => 'system',
 					'varname' => 'mod_fcgid_wrapper',
 					'type' => 'option',
-					'option_options' => array(0 => 'ScriptAlias', 1=> 'FcgidWrapper'),
+					'option_options' => array(0 => 'ScriptAlias', 1=> 'FCGIWrapper'),
 					'default' => 1,
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
 					),
 				'system_mod_fcgid_starter' => array(
 					'label' => $lng['serversettings']['mod_fcgid']['starter'],
@@ -104,7 +101,6 @@ return array(
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
 					),
 				'system_mod_fcgid_httpuser' => array(
 					'label' => $lng['admin']['mod_fcgid_user'],
@@ -113,7 +109,6 @@ return array(
 					'type' => 'string',
 					'default' => 'froxlorlocal',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
 					),
 				'system_mod_fcgid_httpgroup' => array(
 					'label' => $lng['admin']['mod_fcgid_group'],
@@ -122,7 +117,6 @@ return array(
 					'type' => 'string',
 					'default' => 'froxlorlocal',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
 					),
 				'system_mod_fcgid_defaultini_ownvhost' => array(
 					'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
@@ -133,15 +127,6 @@ return array(
 					'option_mode' => 'one',
 					'option_options_method' => 'getPhpConfigs',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
-					),
-				'system_mod_fcgid_idle_timeout' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid_idle_timeout',
-					'type' => 'int',
-					'default' => 30,
-					'save_method' => 'storeSettingField'
 					),
 				)
 			)

actions/admin/settings/136.phpfpm.php

@@ -1,184 +0,0 @@
-<?php
-
-/**
- * This file is part of the Froxlor project.
- * Copyright (c) 2010 the Froxlor Team (see authors).
- *
- * For the full copyright and license information, please view the COPYING
- * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
- *
- * @copyright  (c) the authors
- * @author     Froxlor team <team@froxlor.org> (2010-)
- * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
- * @package    Settings
- *
- */
-
-return array(
-	'groups' => array(
-		'phpfpm' => array(
-			'title' => $lng['admin']['phpfpm_settings'],
-			'fields' => array(
-				'system_phpfpm_enabled' => array(
-					'label' => $lng['serversettings']['phpfpm'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'enabled',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					'plausibility_check_method' => 'checkFcgidPhpFpm',
-					'overview_option' => true
-					),
-				'system_phpfpm_enabled_ownvhost' => array(
-					'label' => $lng['phpfpm']['ownvhost'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'enabled_ownvhost',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField'
-					),
-				'system_phpfpm_httpuser' => array(
-					'label' => $lng['phpfpm']['vhost_httpuser'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'vhost_httpuser',
-					'type' => 'string',
-					'default' => 'froxlorlocal',
-					'save_method' => 'storeSettingField'
-					),
-				'system_phpfpm_httpgroup' => array(
-					'label' => $lng['phpfpm']['vhost_httpgroup'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'vhost_httpgroup',
-					'type' => 'string',
-					'default' => 'froxlorlocal',
-					'save_method' => 'storeSettingField'
-					),
-				'system_phpfpm_defaultini' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'defaultini',
-					'type' => 'option',
-					'default' => '1',
-					'option_mode' => 'one',
-					'option_options_method' => 'getPhpConfigs',
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_defaultini_ownvhost' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'vhost_defaultini',
-					'type' => 'option',
-					'default' => '1',
-					'option_mode' => 'one',
-					'option_options_method' => 'getPhpConfigs',
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_configdir' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['configdir'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'configdir',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/etc/php-fpm.d/',
-					'save_method' => 'storeSettingField',
-					),
-        'system_phpfpm_aliasconfigdir' => array(
-          'label' => $lng['serversettings']['phpfpm_settings']['aliasconfigdir'],
-          'settinggroup' => 'phpfpm',
-          'varname' => 'aliasconfigdir',
-          'type' => 'string',
-          'string_type' => 'dir',
-          'default' => '/var/www/php-fpm/',
-          'save_method' => 'storeSettingField',
-        ),
-				'system_phpfpm_tmpdir' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'tmpdir',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/var/customers/tmp/',
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_peardir' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['peardir'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'peardir',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/usr/share/php/:/usr/share/php5/',
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_reload' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['reload'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'reload',
-					'type' => 'string',
-					'default' => '/etc/init.d/php-fpm restart',
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_pm' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['pm'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'pm',
-					'type' => 'option',
-					'default' => 'static',
-					'option_mode' => 'one',
-					'option_options' => array('static' => 'static', 'dynamic' => 'dynamic', 'ondemand' => 'ondemand'),
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_max_children' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['max_children'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'max_children',
-					'type' => 'int',
-					'default' => 1,
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_start_servers' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['start_servers'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'start_servers',
-					'type' => 'int',
-					'default' => 20,
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_min_spare_servers' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['min_spare_servers'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'min_spare_servers',
-					'type' => 'int',
-					'default' => 5,
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_max_spare_servers' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['max_spare_servers'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'max_spare_servers',
-					'type' => 'int',
-					'default' => 35,
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_max_requests' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['max_requests'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'max_requests',
-					'type' => 'int',
-					'default' => 0,
-					'save_method' => 'storeSettingField',
-					),
-				'system_phpfpm_idle_timeout' => array(
-					'label' => $lng['serversettings']['phpfpm_settings']['idle_timeout'],
-					'settinggroup' => 'phpfpm',
-					'varname' => 'idle_timeout',
-					'type' => 'int',
-					'default' => 30,
-					'save_method' => 'storeSettingField'
-					),
-				),
-			),
-		),
-	);
-
-?>

actions/admin/settings/137.perl.php

@@ -12,7 +12,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -27,7 +27,6 @@ return array(
 					'type' => 'string',
 					'default' => '/usr/bin/perl',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('lighttpd')
 					),	
 				'system_perl_suexecworkaround' => array(
 					'label' => $lng['serversettings']['perl']['suexecworkaround'],
@@ -36,17 +35,14 @@ return array(
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
 					),
 				'system_perl_suexeccgipath' => array(
 					'label' => $lng['serversettings']['perl']['suexeccgipath'],
 					'settinggroup' => 'perl',
 					'varname' => 'suexecpath',
 					'type' => 'string',
-					'string_type' => 'dir',
 					'default' => '/var/www/cgi-bin/',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
 					),
 				'perl_server' => array(
 					'label' => $lng['serversettings']['perl_server'],
@@ -55,7 +51,6 @@ return array(
 					'type' => 'string',
 					'default' => 'unix:/var/run/nginx/cgiwrap-dispatch.sock',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('nginx')
 					),
 				),
 			),

actions/admin/settings/140.statistics.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(

actions/admin/settings/150.mail.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -51,16 +51,6 @@ return array(
 					'default' => '/var/customers/mail/',
 					'save_method' => 'storeSettingField',
 					),
-				'system_vmail_maildirname' => array(
-					'label' => $lng['serversettings']['vmail_maildirname'],
-					'settinggroup' => 'system',
-					'varname' => 'vmail_maildirname',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => 'Maildir',
-					'string_emptyallowed' => true,
-					'save_method' => 'storeSettingField',
-					),
 				'panel_sendalternativemail' => array(
 					'label' => $lng['serversettings']['sendalternativemail'],
 					'settinggroup' => 'panel',
@@ -100,14 +90,6 @@ return array(
 					'type' => 'hidden',
 					'default' => 0,
 					),
-				'system_catchall_enabled' => array(
-					'label' => $lng['serversettings']['catchall_enabled'],
-					'settinggroup' => 'catchall',
-					'varname' => 'catchall_enabled',
-					'type' => 'bool',
-					'default' => true,
-					'save_method' => 'storeSettingResetCatchall',
-					),
 				),
 			),
 		),

actions/admin/settings/155.ftpserver.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id: 220.ftpserver.php 1 2010-04-07 10:00:00Z monotek $
  */
 
 return array(

actions/admin/settings/160.nameserver.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -22,15 +22,6 @@ return array(
 		'nameserver' => array(
 			'title' => $lng['admin']['nameserversettings'],
 			'fields' => array(
-				'nameserver_enable' => array(
-					'label' => $lng['serversettings']['bindenable'],
-					'settinggroup' => 'system',
-					'varname' => 'bind_enable',
-					'type' => 'bool',
-					'default' => true,
-					'save_method' => 'storeSettingField',
-					'overview_option' => true
-					),
 				'system_bindconf_directory' => array(
 					'label' => $lng['serversettings']['bindconf_directory'],
 					'settinggroup' => 'system',
@@ -68,16 +59,6 @@ return array(
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					),
-				'system_axfrservers' => array(
-					'label' => $lng['serversettings']['axfrservers'],
-					'settinggroup' => 'system',
-					'varname' => 'axfrservers',
-					'type' => 'string',
-					'string_type' => 'validate_ip',
-					'string_emptyallowed' => true,
-					'default' => '',
-					'save_method' => 'storeSettingField',
-				),
 				'system_dns_createmailentry' => array(
 					'label' => $lng['serversettings']['mail_also_with_mxservers'],
 					'settinggroup' => 'system',

actions/admin/settings/170.logger.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(

actions/admin/settings/180.dkim.php

@@ -14,11 +14,9 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
-global $settings;
-
 return array(
 	'groups' => array(
 		'dkim' => array(
@@ -38,7 +36,6 @@ return array(
 					'settinggroup' => 'dkim',
 					'varname' => 'dkim_prefix',
 					'type' => 'string',
-					'string_type' => 'dir',
 					'default' => '/etc/postfix/dkim/',
 					'save_method' => 'storeSettingField',
 					),
@@ -81,10 +78,7 @@ return array(
 					'save_method' => 'storeSettingFieldInsertBindTask',
 					),
 				'dkim_keylength' => array(
-					'label' => array(
+					'label' => $lng['dkim']['dkim_keylength'],
-						'title' => $lng['dkim']['dkim_keylength']['title'], 
-						'description' => sprintf($lng['dkim']['dkim_keylength']['description'],$settings['dkim']['dkim_prefix'])
-					),
 					'settinggroup' => 'dkim',
 					'varname' => 'dkim_keylength',
 					'type' => 'option',

actions/admin/settings/185.spf.php

@@ -12,7 +12,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(

actions/admin/settings/190.ticket.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -133,7 +133,7 @@ return array(
 					'type' => 'option',
 					'default' => 2,
 					'option_mode' => 'one',
-					'option_options' => array(1 => $lng['ticket']['high'], 2 => $lng['ticket']['normal'], 3 => $lng['ticket']['low']),
+					'option_options' => array(1 => $lng['ticket']['unf_high'], 2 => $lng['ticket']['unf_normal'], 3 => $lng['ticket']['unf_low']),
 					'save_method' => 'storeSettingField', 
 					),
 				),

actions/admin/settings/200.aps.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -59,7 +59,7 @@ return array(
 					'type' => 'option',
 					'default' => '',
 					'option_mode' => 'multiple',
-					'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring', 'Zend Optimizer' => 'Zend Guard'),
+					'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring'),
 					'save_method' => 'storeSettingApsPhpExtensions',
 					),
 				'aps_php-function' => array(

actions/admin/settings/210.security.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Settings
- *
+ * @version    $Id$
  */
 
 return array(
@@ -38,17 +38,9 @@ return array(
 					'default' => true,
 					'save_method' => 'storeSettingField',
 					),
-				'system_passwordcryptfunc' => array(
+				),
-					'label' => $lng['serversettings']['passwordcryptfunc'],
+			),
-					'settinggroup' => 'system',
+		),
-					'varname' => 'passwordcryptfunc',
-					'type' => 'option',
-					'default' => 0,
-					'option_mode' => 'one',
-					'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
-					'save_method' => 'storeSettingField',
-					)
-				)
-			)
-		)
 	);
+
+?>

actions/admin/settings/215.backup.php

@@ -1,118 +0,0 @@
-<?php
-
-/**
- * This file is part of the Froxlor project.
- * Copyright (c) 2003-2009 the SysCP Team (see authors).
- * Copyright (c) 2010 the Froxlor Team (see authors).
- *
- * For the full copyright and license information, please view the COPYING
- * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
- *
- * @copyright  (c) the authors
- * @author     Florian Lippert <flo@syscp.org> (2003-2009)
- * @author     Froxlor team <team@froxlor.org> (2010-)
- * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
- * @package    Settings
- *
- */
-
-return array(
-	'groups' => array(
-		'backup' => array(
-			'title' => $lng['backup'],
-			'fields' => array(
-				'backup_enabled' => array(
-					'label' => $lng['serversettings']['backup_enabled'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_enabled',
-					'type' => 'bool',
-					'default' => false,
-					'cronmodule' => 'froxlor/backup',
-					'save_method' => 'storeSettingField',
-					'overview_option' => true
-				),
-				'backup_dir' => array(
-					'label' => $lng['serversettings']['backupdir']['description'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_dir',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/var/customers/backups/',
-					'string_regexp' => '#^/.*/$#',
-					'save_method' => 'storeSettingField',
-				),
-				'backup_mysqldump_path' => array(
-					'label' => $lng['serversettings']['mysqldump_path']['description'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_mysqldump_path',
-					'type' => 'string',
-					'default' => '/usr/bin/mysqldump',
-					'save_method' => 'storeSettingField',
-				),
-				'backup_count' => array(
-					'label' => $lng['serversettings']['backup_count'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_count',
-					'type' => 'bool',
-					'default' => 'true',
-					'save_method' => 'storeSettingField',
-					'overview_option' => false
-				),				
-				'backup_bigfile' => array(
-					'label' => $lng['serversettings']['backup_bigfile'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_bigfile',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					'overview_option' => false
-				),
-				'backup_ftp_enabled_' => array(
-					'label' => $lng['serversettings']['backup_ftp_enabled'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_ftp_enabled',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					'overview_option' => false
-				),
-				'backup_server' => array(
-					'label' => $lng['serversettings']['backup_ftp_server'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_ftp_server',
-					'type' => 'string',
-					'default' => '',
-					'save_method' => 'storeSettingField',
-				),
-				'backup_user' => array(
-					'label' => $lng['serversettings']['backup_ftp_user'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_ftp_user',
-					'type' => 'string',
-					'default' => '',
-					'save_method' => 'storeSettingField',
-				),
-				'backup_pass' => array(
-					'label' => $lng['serversettings']['backup_ftp_pass'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_ftp_pass',
-					'type' => 'hiddenstring',
-					'default' => '',
-					'save_method' => 'storeSettingField',
-				),
-				'backup_passive_mode' => array(
-					'label' => $lng['serversettings']['backup_ftp_passive_mode'],
-					'settinggroup' => 'system',
-					'varname' => 'backup_ftp_passive',
-					'type' => 'bool',
-					'default' => true,
-					'save_method' => 'storeSettingField',
-					'overview_option' => false,
-				),
-				),
-			),
-		),
-	);
-
-?>

actions/admin/settings/220.quota.php

@@ -1,60 +0,0 @@
-<?php
-/**
- * This file is part of the Froxlor project.
- * Copyright (c) 2011- the Froxlor Team (see authors).
- *
- * For the full copyright and license information, please view the COPYING
- * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
- *
- * @copyright  (c) the authors
- * @author     Froxlor team <team@froxlor.org> (2011-)
- * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
- * @package    Settings
- *
- */
-
-return array(
-	'groups' => array(
-		'diskquota' => array(
-			'title' => $lng['diskquota'],
-			'fields' => array(
-				'diskquota_enabled' => array(
-					'label' => $lng['serversettings']['diskquota_enabled'],
-					'settinggroup' => 'system',
-					'varname' => 'diskquota_enabled',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					'overview_option' => true
-				),
-				'diskquota_repquota_path' => array(
-					'label' => $lng['serversettings']['diskquota_repquota_path']['description'],
-					'settinggroup' => 'system',
-					'varname' => 'diskquota_repquota_path',
-					'type' => 'string',
-					'default' => '/usr/sbin/repquota',
-					'save_method' => 'storeSettingField',
-				),
-				'diskquota_quotatool_path' => array(
-					'label' => $lng['serversettings']['diskquota_quotatool_path']['description'],
-					'settinggroup' => 'system',
-					'varname' => 'diskquota_quotatool_path',
-					'type' => 'string',
-					'default' => '/usr/bin/quotatool',
-					'save_method' => 'storeSettingField',
-				),
-				'diskquota_customer_partition' => array(
-					'label' => $lng['serversettings']['diskquota_customer_partition']['description'],
-					'settinggroup' => 'system',
-					'varname' => 'diskquota_customer_partition',
-					'type' => 'string',
-					'default' => '/dev/root',
-					'save_method' => 'storeSettingField',
-				),
-				),
-			),
-		),
-	);
-
-?>

actions/admin/settings/225.logrotate.php

@@ -1,67 +0,0 @@
-<?php
-/**
- * This file is part of the Froxlor project.
- * Copyright (c) 2003-2009 the SysCP Team (see authors).
- * Copyright (c) 2010 the Froxlor Team (see authors).
- *
- * For the full copyright and license information, please view the COPYING
- * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
- *
- * @copyright  (c) the authors
- * @author     Florian Lippert <flo@syscp.org> (2003-2009)
- * @author     Froxlor team <team@froxlor.org> (2010-)
- * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
- * @package    Settings
- *
- */
-
-return array(
-'groups' => array(
-		'logrotate' => array(
-			'title' => $lng['logrotate'],
-			'fields' => array(
-				'logrotate_enabled' => array(
-					'label' => $lng['logrotate_enabled'],
-					'settinggroup' => 'system',
-					'varname' => 'logrotate_enabled',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					'overview_option' => true
-				),
-				'logrotate_binary' => array(
-					'label' => $lng['logrotate_binary'],
-					'settinggroup' => 'system',
-					'varname' => 'logrotate_binary',
-					'type' => 'string',
-					'default' => '/usr/sbin/logrotate',
-					'save_method' => 'storeSettingField',
-					'overview_option' => false
-				),
-				'logrotate_interval' => array(
-					'label' => $lng['logrotate_interval'],
-					'settinggroup' => 'system',
-					'varname' => 'logrotate_interval',
-					'type' => 'option',
-					'default' => 'weekly',
-					'option_mode' => 'one',
-				        'option_options' => array('daily' => 'Daily', 'weekly' => 'Weekly', 'monthly' => 'Monthly'),
-					'save_method' => 'storeSettingField',
-					'overview_option' => false
-				),
-				'logrotate_keep' => array(
-					'label' => $lng['logrotate_keep'],
-					'settinggroup' => 'system',
-					'varname' => 'logrotate_keep',
-					'type' => 'string',
-					'default' => '4',
-					'save_method' => 'storeSettingField',
-					'overview_option' => false
-				),				
-				),
-			),
-		),
-	);
-
-?>

admin_admins.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -47,6 +47,24 @@ if($page == 'admins'
 			'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
 			'traffic' => $lng['customer']['traffic'],
 			'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
+			'mysqls' => $lng['customer']['mysqls'],
+			'mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
+			'ftps' => $lng['customer']['ftps'],
+			'ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
+			'tickets' => $lng['customer']['tickets'],
+			'tickets_used' => $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')',
+			'subdomains' => $lng['customer']['subdomains'],
+			'subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
+			'emails' => $lng['customer']['emails'],
+			'emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
+			'email_accounts' => $lng['customer']['accounts'],
+			'email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
+			'email_forwarders' => $lng['customer']['forwarders'],
+			'email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
+			'email_quota' => $lng['customer']['email_quota'],
+			'email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
+			'email_autoresponder' => $lng['customer']['autoresponder'],
+			'email_autoresponder_used' => $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')',
 			'deactivated' => $lng['admin']['deactivated']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
@@ -68,29 +86,6 @@ if($page == 'admins'
 				$row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
 				$row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
 				$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
-
-				/**
-				 * percent-values for progressbar
-				 */
-                                //For Disk usage
-                                if ($row['diskspace'] > 0) {
-                                        $disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
-                                        $disk_doublepercent = round($disk_percent*2, 2);
-                                } else {
-                                        $disk_percent = 0;
-                                        $disk_doublepercent = 0;
-                                }
-
-				//For Traffic usage
-                                if ($row['traffic'] > 0) {
-                                        $traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
-                                        $traffic_doublepercent = round($traffic_percent*2, 2);
-                                } else {
-                                        $traffic_percent = 0;
-                                        $traffic_doublepercent = 0;
-                                }
-				/* */
-
 				$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets');
 				$row = htmlentities_array($row);
 				eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";");
@@ -271,7 +266,7 @@ if($page == 'admins'
 					$number_of_aps_packages = - 1;
 				}
 
-				$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
+				$can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
 			}
 			else
 			{
@@ -279,21 +274,10 @@ if($page == 'admins'
 				$can_manage_aps_packages = 0;
 			}
 
-			$customers_see_all = 0;
+			$customers_see_all = intval($_POST['customers_see_all']);
-			if(isset($_POST['customers_see_all']))
+			$domains_see_all = intval($_POST['domains_see_all']);
-				$customers_see_all = intval($_POST['customers_see_all']);
+			$caneditphpsettings = intval($_POST['caneditphpsettings']);
-			
+			$change_serversettings = intval($_POST['change_serversettings']);
-			$domains_see_all = 0;
-			if(isset($_POST['domains_see_all']))
-				$domains_see_all = intval($_POST['domains_see_all']);
-			
-			$caneditphpsettings = 0;
-			if(isset($_POST['caneditphpsettings']))
-				$caneditphpsettings = intval($_POST['caneditphpsettings']);
-			
-			$change_serversettings = 0;
-			if(isset($_POST['change_serversettings']))
-				$change_serversettings = intval($_POST['change_serversettings']);
 
 			$diskspace = intval_ressource($_POST['diskspace']);
 
@@ -309,10 +293,6 @@ if($page == 'admins'
 				$traffic = - 1;
 			}
 
-			$tickets_see_all = 0;
-			if(isset($_POST['tickets_see_all']))
-				$tickets_see_all = intval($_POST['tickets_see_all']);
-
 			$diskspace = $diskspace * 1024;
 			$traffic = $traffic * 1024 * 1024;
 			$ipaddress = intval_ressource($_POST['ipaddress']);
@@ -380,43 +360,8 @@ if($page == 'admins'
 					$change_serversettings = '0';
 				}
 
-				if ($tickets_see_all != '1') {
+				$result = $db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` (`loginname`, `password`, `name`, `email`, `def_language`, `change_serversettings`, `customers`, `customers_see_all`, `domains`, `domains_see_all`, `caneditphpsettings`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `ip`, `can_manage_aps_packages`, `aps_packages`, `email_autoresponder`)
-					$tickets_see_all  = '0';
+					                   VALUES ('" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($email) . "','" . $db->escape($def_language) . "', '" . $db->escape($change_serversettings) . "', '" . $db->escape($customers) . "', '" . $db->escape($customers_see_all) . "', '" . $db->escape($domains) . "', '" . $db->escape($domains_see_all) . "', '" . (int)$caneditphpsettings . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '" . (int)$ipaddress . "', " . (int)$can_manage_aps_packages . ", " . (int)$number_of_aps_packages . ", " . $db->escape($email_autoresponder) . ")");
-				}
-
-				$_theme = $settings['panel']['default_theme'];
-
-				$result = $db->query("INSERT INTO 
-					`" . TABLE_PANEL_ADMINS . "`
-				SET 
-					`loginname` = '" . $db->escape($loginname) . "', 
-					`password` = '" . md5($password) . "', 
-					`name` = '" . $db->escape($name) . "', 
-					`email` = '" . $db->escape($email) . "', 
-					`def_language` = '" . $db->escape($def_language) . "', 
-					`change_serversettings` = '" . $db->escape($change_serversettings) . "', 
-					`customers` = '" . $db->escape($customers) . "', 
-					`customers_see_all` = '" . $db->escape($customers_see_all) . "', 
-					`domains` = '" . $db->escape($domains) . "', 
-					`domains_see_all` = '" . $db->escape($domains_see_all) . "', 
-					`caneditphpsettings` = '" . (int)$caneditphpsettings . "', 
-					`diskspace` = '" . $db->escape($diskspace) . "', 
-					`traffic` = '" . $db->escape($traffic) . "', 
-					`subdomains` = '" . $db->escape($subdomains) . "', 
-					`emails` = '" . $db->escape($emails) . "', 
-					`email_accounts` = '" . $db->escape($email_accounts) . "', 
-					`email_forwarders` = '" . $db->escape($email_forwarders) . "', 
-					`email_quota` = '" . $db->escape($email_quota) . "', 
-					`ftps` = '" . $db->escape($ftps) . "', 
-					`tickets` = '" . $db->escape($tickets) . "', 
-					`tickets_see_all` = '" . $db->escape($tickets_see_all) . "',
-					`mysqls` = '" . $db->escape($mysqls) . "', 
-					`ip` = '" . (int)$ipaddress . "', 
-					`can_manage_aps_packages` = '" . (int)$can_manage_aps_packages . "', 
-					`aps_packages` = '" . (int)$number_of_aps_packages . "', 
-					`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
-					`theme` = '".$db->escape($_theme)."';
-				");
 				$adminid = $db->insert_id();
 				$log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -462,21 +407,13 @@ if($page == 'admins'
 			$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
-			/*
 			$change_serversettings = makeyesno('change_serversettings', '1', '0', '0');
 			$customers_see_all = makeyesno('customers_see_all', '1', '0', '0');
 			$domains_see_all = makeyesno('domains_see_all', '1', '0', '0');
 			$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0');
 			$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0');
-			*/
 			$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 
-			$admin_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_add.php';
-			$admin_add_form = htmlform::genHTMLForm($admin_add_data);
-
-			$title = $admin_add_data['admin_add']['title'];
-			$image = $admin_add_data['admin_add']['image'];
-
 			eval("echo \"" . getTemplate("admins/admins_add") . "\";");
 		}
 	}
@@ -509,7 +446,6 @@ if($page == 'admins'
 					$ftps = $result['ftps'];
 					$tickets = $result['tickets'];
 					$mysqls = $result['mysqls'];
-					$tickets_see_all = $result['tickets_see_all'];
 					$customers_see_all = $result['customers_see_all'];
 					$domains_see_all = $result['domains_see_all'];
 					$caneditphpsettings = $result['caneditphpsettings'];
@@ -524,113 +460,130 @@ if($page == 'admins'
 				{
 					$password = validate($_POST['admin_password'], 'new password');
 					$def_language = validate($_POST['def_language'], 'default language');
-					$deactivated = isset($_POST['deactivated']) ? 1 : 0;
+					$deactivated = intval($_POST['deactivated']);
-
 					$customers = intval_ressource($_POST['customers']);
-					if (isset($_POST['customers_ul'])) {
+
-						$customers = -1;
+					if(isset($_POST['customers_ul']))
+					{
+						$customers = - 1;
 					}
 
 					$domains = intval_ressource($_POST['domains']);
-					if (isset($_POST['domains_ul'])) {
+
-						$domains = -1;
+					if(isset($_POST['domains_ul']))
+					{
+						$domains = - 1;
 					}
 
 					$subdomains = intval_ressource($_POST['subdomains']);
-					if (isset($_POST['subdomains_ul'])) {
+
-						$subdomains = -1;
+					if(isset($_POST['subdomains_ul']))
+					{
+						$subdomains = - 1;
 					}
 
 					$emails = intval_ressource($_POST['emails']);
-					if (isset($_POST['emails_ul'])) {
+
-						$emails = -1;
+					if(isset($_POST['emails_ul']))
+					{
+						$emails = - 1;
 					}
 
 					$email_accounts = intval_ressource($_POST['email_accounts']);
-					if (isset($_POST['email_accounts_ul'])) {
+
-						$email_accounts = -1;
+					if(isset($_POST['email_accounts_ul']))
+					{
+						$email_accounts = - 1;
 					}
 
 					$email_forwarders = intval_ressource($_POST['email_forwarders']);
-					if (isset($_POST['email_forwarders_ul'])) {
+
-						$email_forwarders = -1;
+					if(isset($_POST['email_forwarders_ul']))
+					{
+						$email_forwarders = - 1;
 					}
 
-					if ($settings['system']['mail_quota_enabled'] == '1') {
+					if($settings['system']['mail_quota_enabled'] == '1')
+					{
 						$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
-						if (isset($_POST['email_quota_ul'])) {
+
-							$email_quota = -1;
+						if(isset($_POST['email_quota_ul']))
+						{
+							$email_quota = - 1;
 						}
-					} else {
+					}
-						$email_quota = -1;
+					else
+					{
+						$email_quota = - 1;
 					}
 
-					if ($settings['autoresponder']['autoresponder_active'] == '1') {
+					if($settings['autoresponder']['autoresponder_active'] == '1')
+					{
 						$email_autoresponder = intval_ressource($_POST['email_autoresponder']);
-						if (isset($_POST['email_autoresponder_ul'])) {
+
-							$email_autoresponder = -1;
+						if(isset($_POST['email_autoresponder_ul']))
+						{
+							$email_autoresponder = - 1;
 						}
-					} else {
+					}
+					else
+					{
 						$email_autoresponder = 0;
 					}
 
 					$ftps = intval_ressource($_POST['ftps']);
-					if (isset($_POST['ftps_ul'])) {
+
-						$ftps = -1;
+					if(isset($_POST['ftps_ul']))
+					{
+						$ftps = - 1;
 					}
 					
-					if ($settings['ticket']['enabled'] == 1) {
+					if($settings['ticket']['enabled'] == 1)
+					{
 						$tickets = intval_ressource($_POST['tickets']);
-						if (isset($_POST['tickets_ul'])) {
+
-							$tickets = -1;
+						if(isset($_POST['tickets_ul']))
+						{
+							$tickets = - 1;
 						}
-					} else {
+					}
+					else
+					{
 						$tickets = 0;
 					}
 
 					$mysqls = intval_ressource($_POST['mysqls']);
-					if (isset($_POST['mysqls_ul'])) {
+
+					if(isset($_POST['mysqls_ul']))
+					{
 						$mysqls = - 1;
 					}
 
-					if ($settings['aps']['aps_active'] == '1') {
+					$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
-						$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
+
-						if (isset($_POST['number_of_aps_packages_ul'])) {
+					if(isset($_POST['number_of_aps_packages_ul']))
-							$number_of_aps_packages = -1;
+					{
-						}
+						$number_of_aps_packages = - 1;
-						$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
-					} else {
-						$number_of_aps_packages = 0;
 					}
 
-					$customers_see_all = 0;
+					$customers_see_all = intval($_POST['customers_see_all']);
-					if(isset($_POST['customers_see_all']))
+					$domains_see_all = intval($_POST['domains_see_all']);
-						$customers_see_all = intval($_POST['customers_see_all']);
+					$caneditphpsettings = intval($_POST['caneditphpsettings']);
-					
+					$change_serversettings = intval($_POST['change_serversettings']);
-					$domains_see_all = 0;
+					$can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
-					if(isset($_POST['domains_see_all']))
-						$domains_see_all = intval($_POST['domains_see_all']);
-					
-					$caneditphpsettings = 0;
-					if(isset($_POST['caneditphpsettings']))
-						$caneditphpsettings = intval($_POST['caneditphpsettings']);
-
-					$change_serversettings = 0;
-					if(isset($_POST['change_serversettings']))
-						$change_serversettings = isset($_POST['change_serversettings']) ? 1 : 0;
-
-					$tickets_see_all = 0;
-					if (isset($_POST['tickets_see_all']))
-						$tickets_see_all = intval($_POST['tickets_see_all']);
 
 					$diskspace = intval($_POST['diskspace']);
-					if (isset($_POST['diskspace_ul'])) {
+
-						$diskspace = -1;
+					if(isset($_POST['diskspace_ul']))
+					{
+						$diskspace = - 1;
 					}
 
 					$traffic = doubleval_ressource($_POST['traffic']);
-					if (isset($_POST['traffic_ul'])) {
+
-						$traffic = -1;
+					if(isset($_POST['traffic_ul']))
+					{
+						$traffic = - 1;
 					}
 
 					$diskspace = $diskspace * 1024;
@@ -687,88 +640,7 @@ if($page == 'admins'
 						$change_serversettings = '0';
 					}
 
-					if ($tickets_see_all != '1') {
+					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `name`='" . $db->escape($name) . "', `email`='" . $db->escape($email) . "', `def_language`='" . $db->escape($def_language) . "', `change_serversettings` = '" . $db->escape($change_serversettings) . "', `customers` = '" . $db->escape($customers) . "', `customers_see_all` = '" . $db->escape($customers_see_all) . "', `domains` = '" . $db->escape($domains) . "', `domains_see_all` = '" . $db->escape($domains_see_all) . "', `caneditphpsettings` = '" . (int)$caneditphpsettings . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `email_quota`='" . $db->escape($email_quota) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `ip`='" . (int)$ipaddress . "', `deactivated`='" . $db->escape($deactivated) . "', `can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ", `aps_packages`=" . (int)$number_of_aps_packages . " WHERE `adminid`='" . $db->escape($id) . "'");
-						$tickets_see_all = '0';
-					}
-
-					// check if a resource was set to something lower
-					// than actually used by the admin/reseller
-					$res_warning = "";
-					if ($customers != $result['customers'] && $customers < $result['customers_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'customers');
-					}
-					if ($domains != $result['domains'] && $domains < $result['domains_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'domains');
-					}
-					if ($diskspace != $result['diskspace'] && ($diskspace / 1024) != -1 && $diskspace < $result['diskspace_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'diskspace');
-					}
-					if ($traffic != $result['traffic'] && ($traffic / 1024 / 1024) != -1 && $traffic < $result['traffic_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'traffic');
-					}
-					if ($emails != $result['emails'] && $emails < $result['emails_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'emails');
-					}
-					if ($email_accounts != $result['email_accounts'] && $email_accounts < $result['email_accounts_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email accounts');
-					}
-					if ($email_forwarders != $result['email_forwarders'] && $email_forwarders < $result['email_forwarders_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email forwarders');
-					}
-					if ($email_quota != $result['email_quota'] && $email_quota < $result['email_quota_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email quota');
-					}
-					if ($email_autoresponder != $result['email_autoresponder'] && $email_autoresponder < $result['email_autoresponder_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email autoresponder');
-					}
-					if ($ftps != $result['ftps'] && $ftps < $result['ftps_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'ftps');
-					}
-					if ($tickets != $result['tickets'] && $tickets < $result['tickets_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'tickets');
-					}
-					if ($mysqls != $result['mysqls'] && $mysqls < $result['mysqls_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'mysqls');
-					}
-					if ($number_of_aps_packages != $result['aps_packages'] && $number_of_aps_packages < $result['aps_packages_used']) {
-						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'aps packages');
-					}
-
-					if ($res_warning != "") {
-						$link = '';
-						$error = $res_warning;
-						eval("echo \"" . getTemplate('misc/error', '1') . "\";");
-						exit;
-					}
-
-					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET
-						`name`='" . $db->escape($name) . "',
-						`email`='" . $db->escape($email) . "',
-						`def_language`='" . $db->escape($def_language) . "',
-						`change_serversettings` = '" . $db->escape($change_serversettings) . "',
-						`customers` = '" . $db->escape($customers) . "',
-						`customers_see_all` = '" . $db->escape($customers_see_all) . "',
-						`domains` = '" . $db->escape($domains) . "',
-						`domains_see_all` = '" . $db->escape($domains_see_all) . "',
-						`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
-						`password` = '" . $password . "',
-						`diskspace`='" . $db->escape($diskspace) . "',
-						`traffic`='" . $db->escape($traffic) . "',
-						`subdomains`='" . $db->escape($subdomains) . "',
-						`emails`='" . $db->escape($emails) . "',
-						`email_accounts` = '" . $db->escape($email_accounts) . "',
-						`email_forwarders`='" . $db->escape($email_forwarders) . "',
-						`email_quota`='" . $db->escape($email_quota) . "',
-						`email_autoresponder`='" . $db->escape($email_autoresponder) . "',
-						`ftps`='" . $db->escape($ftps) . "',
-						`tickets`='" . $db->escape($tickets) . "',
-						`tickets_see_all`='".$db->escape($tickets_see_all) . "',
-						`mysqls`='" . $db->escape($mysqls) . "',
-						`ip`='" . (int)$ipaddress . "',
-						`deactivated`='" . $db->escape($deactivated) . "',
-						`can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ",
-						`aps_packages`=" . (int)$number_of_aps_packages . "
-						 WHERE `adminid`='" . $db->escape($id) . "'");
 					$log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'");
 					$redirect_props = Array(
 						'page' => $page,
@@ -906,22 +778,14 @@ if($page == 'admins'
 					}
 				}
 
-				/*
 				$change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']);
 				$customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']);
 				$domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']);
 				$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']);
 				$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
 				$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']);
-				*/
+
 				$result = htmlentities_array($result);
-
-				$admin_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_edit.php';
-				$admin_edit_form = htmlform::genHTMLForm($admin_edit_data);
-
-				$title = $admin_edit_data['admin_edit']['title'];
-				$image = $admin_edit_data['admin_edit']['image'];
-
 				eval("echo \"" . getTemplate("admins/admins_edit") . "\";");
 			}
 		}

admin_aps.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 // Required code

admin_configfiles.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -97,8 +97,7 @@ if($userinfo['change_serversettings'] == '1')
 			'<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'],
 			'<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '',
 			'<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? makeCorrectDir($settings['system']['mod_fcgid_tmpdir']) : '/tmp/',
-			'<BASE_PATH>' => makeCorrectDir(dirname(__FILE__)),
+			'<BASE_PATH>' => makeCorrectDir(dirname(__FILE__))
-			'<BIND_CONFIG_PATH>' => makeCorrectDir($settings['system']['bindconf_directory'])
 		);
 		$files = '';
 		$configpage = '';

admin_cronjobs.php

@@ -12,21 +12,28 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
-require_once('./lib/init.php');
 
-if (isset($_POST['id'])) {
+require_once("./lib/init.php");
+
+if(isset($_POST['id']))
+{
 	$id = intval($_POST['id']);
-} elseif(isset($_GET['id'])) {
+}
+elseif(isset($_GET['id']))
+{
 	$id = intval($_GET['id']);
 }
 
-if ($page == 'cronjobs' || $page == 'overview') {
+if($page == 'cronjobs'
-	if ($action == '') {
+  || $page == 'overview')
-		$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs');
+{
+	if($action == '')
+	{
+		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_cronjobs");
 
 		$fields = array(
 			'c.lastrun' => $lng['cron']['lastrun'],
@@ -49,41 +56,61 @@ if ($page == 'cronjobs' || $page == 'overview') {
 		$i = 0;
 		$count = 0;
 
-		while ($row = $db->fetch_array($result)) {
+		while($row = $db->fetch_array($result))
-			if ($paging->checkDisplay($i)) {
+		{
+			if($paging->checkDisplay($i))
+			{
 				$row = htmlentities_array($row);
 				
 				$row['lastrun'] = date('d.m.Y H:i', $row['lastrun']);
-				$row['isactive'] = ((int)$row['isactive'] == 1) ? $lng['panel']['yes'] : $lng['panel']['no'];
+				
+				if((int)$row['isactive'] == 1)
+				{
+					$row['isactive'] = $lng['panel']['yes'];
+				}
+				else
+				{
+					$row['isactive'] = $lng['panel']['no'];
+				}
 				
 				$description = $lng['crondesc'][$row['desc_lng_key']];
 				
-				eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjob') . "\";");
+				eval("\$crons.=\"" . getTemplate("cronjobs/cronjobs_cronjob") . "\";");
 				$count++;
 			}
 
 			$i++;
 		}
 
-		eval("echo \"" . getTemplate('cronjobs/cronjobs') . "\";");
+		eval("echo \"" . getTemplate("cronjobs/cronjobs") . "\";");
 
-	} elseif ($action == 'new') {
+	}
+	elseif($action == 'new')
+	{
 		/*
 		 * @TODO later
 		 */
-	} elseif ($action == 'edit' && $id != 0) {
+	}
+	elseif($action == 'edit'
+	&& $id != 0)
+	{
 		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'");
-		if ($result['cronfile'] != '') {
+		
-			if (isset($_POST['send']) && $_POST['send'] == 'send') {
+		if ($result['cronfile'] != '')
-				$isactive = isset($_POST['isactive']) ? 1 : 0;
+		{
+			if(isset($_POST['send'])
+			   && $_POST['send'] == 'send')
+			{
+				$isactive = intval($_POST['isactive']);
 				$interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty');
 				$interval_interval = validate($_POST['interval_interval'], 'interval_interval');
 				
-				if ($isactive != 1) {
+				if($isactive != 1)
+				{
 					$isactive = 0;
 				}
 				
-				$interval = $interval_value . ' ' . strtoupper($interval_interval);
+				$interval = $interval_value.' '.strtoupper($interval_interval);
 				
 				$db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "` 
 							SET `isactive` = '".(int)$isactive."',
@@ -91,39 +118,40 @@ if ($page == 'cronjobs' || $page == 'overview') {
 							WHERE `id` = '" . (int)$id . "'");
 
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			} else {
+			}
-				//$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
+			else
+			{
+				$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
 				// interval
 				$interval_nfo = explode(' ', $result['interval']);
 				$interval_value = $interval_nfo[0];
 
 				$interval_interval = '';
-				$interval_interval .= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
+				$interval_interval.= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
-				$interval_interval .= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
+				$interval_interval.= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
-				$interval_interval .= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
+				$interval_interval.= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
-				$interval_interval .= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
+				$interval_interval.= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
-				$interval_interval .= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
+				$interval_interval.= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
-				$interval_interval .= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
+				$interval_interval.= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
 				// end of interval
 				
 				$change_cronfile = false;
-				if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor') {
+				if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor')
+				{
 					$change_cronfile = true;
 				}
 				
-				$cronjobs_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/cronjobs/formfield.cronjobs_edit.php';
+				eval("echo \"" . getTemplate("cronjobs/cronjob_edit") . "\";");
-				$cronjobs_edit_form = htmlform::genHTMLForm($cronjobs_edit_data);
-
-				$title = $cronjobs_edit_data['cronjobs_edit']['title'];
-				$image = $cronjobs_edit_data['cronjobs_edit']['image'];
-
-				eval("echo \"" . getTemplate('cronjobs/cronjob_edit') . "\";");
 			}
 		}
 	}
-	elseif ($action == 'delete' && $id != 0) {
+	elseif($action == 'delete'
+	&& $id != 0)
+	{
 		/*
 		 * @TODO later
 		 */
 	}
 }
+
+?>

admin_customers.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -40,30 +40,52 @@ if($page == 'customers'
 {
 	if($action == '')
 	{
-		// clear request data
-		unset($_SESSION['requestData']);
-
 		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers");
 		$fields = array(
 			'c.loginname' => $lng['login']['username'],
 			'a.loginname' => $lng['admin']['admin'],
 			'c.name' => $lng['customer']['name'],
-			'c.email' => $lng['customer']['email'],
 			'c.firstname' => $lng['customer']['firstname'],
 			'c.company' => $lng['customer']['company'],
 			'c.diskspace' => $lng['customer']['diskspace'],
 			'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
 			'c.traffic' => $lng['customer']['traffic'],
-			'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')'
+			'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
+			'c.mysqls' => $lng['customer']['mysqls'],
+			'c.mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
+			'c.ftps' => $lng['customer']['ftps'],
+			'c.ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
+			'c.subdomains' => $lng['customer']['subdomains'],
+			'c.subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
+			'c.emails' => $lng['customer']['emails'],
+			'c.emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
+			'c.email_accounts' => $lng['customer']['accounts'],
+			'c.email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
+			'c.email_forwarders' => $lng['customer']['forwarders'],
+			'c.email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
+			'c.email_quota' => $lng['customer']['email_quota'],
+			'c.email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
+			'c.deactivated' => $lng['admin']['deactivated'],
+			'c.lastlogin_succ' => $lng['admin']['lastlogin_succ'],
+			'c.phpenabled' => $lng['admin']['phpenabled'],
+			'c.perlenabled' => $lng['admin']['perlenabled']
 		);
 
-		if ($settings['system']['backup_enabled'] == '1') {
+		if($settings['ticket']['enabled'] == 1)
-			$field['c.backup_allowed'] = $lng['backup_allowed'];
+		{
+			$fields['c.tickets'] = $lng['customer']['tickets'];
+			$fields['c.tickets_used'] = $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')';
+		}
+		
+		if($settings['autoresponder']['autoresponder_active'] == 1)
+		{
+			$fields['c.email_autoresponder'] = $lng['customer']['autoresponder'];
+			$fields['c.email_autoresponder_used'] = $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')';			
 		}
 
 		$paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$customers = '';
-		$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy($settings['panel']['natsorting']) . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng, true);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -84,26 +106,6 @@ if($page == 'customers'
 				$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
 				$last_login = ((int)$row['lastlogin_succ'] == 0) ? $lng['panel']['neverloggedin'] : date('d.m.Y', $row['lastlogin_succ']);
 
-				/**
-				 * percent-values for progressbar
-				 */
-				//For Disk usage
-				if ($row['diskspace'] > 0) {
-					$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
-					$disk_doublepercent = round($disk_percent*2, 2);
-				} else {
-					$disk_percent = 0;
-					$disk_doublepercent = 0;
-				}
-
-				if ($row['traffic'] > 0) {
-					$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
-					$traffic_doublepercent = round($traffic_percent*2, 2);
-				} else {
-					$traffic_percent = 0;
-					$traffic_doublepercent = 0;
-				}
-
 				$column_style = '';
 				$unlock_link = '';
 				if($row['loginfail_count'] >= $settings['login']['maxloginattempts']
@@ -133,14 +135,11 @@ if($page == 'customers'
 
 		if($destination_user != '')
 		{
-			if ($result['deactivated'] == '1') {
-				standard_error("usercurrentlydeactivated", $destination_user);
-			}
 			$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'");
 			$s = md5(uniqid(microtime(), 1));
 			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
 			$log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'");
-			redirectTo('customer_index.php', Array('s' => $s), true);
+			redirectTo('customer_index.php', Array('s' => $s));
 		}
 		else
 		{
@@ -184,6 +183,7 @@ if($page == 'customers'
 			{
 				$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
 				$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
+				unset($db_root->password);
 				$last_dbserver = 0;
 
 				while($row_database = $db->fetch_array($databases))
@@ -193,20 +193,16 @@ if($page == 'customers'
 						$db_root->query('FLUSH PRIVILEGES;');
 						$db_root->close();
 						$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
+						unset($db_root->password);
 						$last_dbserver = $row_database['dbserver'];
 					}
 
-					if(mysql_get_server_info() < '5.0.2') {
+					foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
-						// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
-						$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
-					}
-
-					$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($row_database['databasename']) . "'");
-					while($host = $db_root->fetch_array($host_res))
 					{
-						// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+)
+						$mysql_access_host = trim($mysql_access_host);
-						$db_root->query('DROP USER \'' . $db_root->escape($row_database['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true);
+						$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-						
+						$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
+						$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($row_database['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
 					}
 
 					$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`');
@@ -282,7 +278,7 @@ if($page == 'customers'
 
 				if($result['email_autoresponder'] != '-1')
 				{
-					$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` - 0" . (int)$result['email_autoresponder'];
+					$admin_update_query.= ", `email_autoresponder` = `email_autoresponder` - 0" . (int)$result['email_autoresponder'];
 				}
 
 				if($result['subdomains'] != '-1')
@@ -302,7 +298,7 @@ if($page == 'customers'
 
 				if($result['aps_packages'] != '-1')
 				{
-					$admin_update_query.= ", `aps_packages_used` = `aps_packages_used` - 0" . (int)$result['aps_packages'];
+					$admin_update_query.= ", `aps_packages` = `aps_packages` - 0" . (int)$result['aps_packages'];
 				}
 
 				if(($result['diskspace'] / 1024) != '-1')
@@ -314,19 +310,14 @@ if($page == 'customers'
 				$db->query($admin_update_query);
 				$log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'");
 				inserttask('1');
-
-				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
 				
-				if (isset($_POST['delete_userfiles'])
+				if(isset($_POST['delete_userfiles'])
-						&& (int)$_POST['delete_userfiles'] == 1
+				  && (int)$_POST['delete_userfiles'] == 1)
-				) {
+				{
 					inserttask('6', $result['loginname']);
 				}
 				
-				// Using filesystem - quota, insert a task which cleans the filesystem - quota
-				inserttask('10');
-
 				/*
 				 * move old tickets to archive
 				 */
@@ -374,7 +365,6 @@ if($page == 'customers'
 				$customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di');
 				$def_language = validate($_POST['def_language'], 'default language');
 				$diskspace = intval_ressource($_POST['diskspace']);
-				$gender = intval_ressource($_POST['gender']);
 
 				if(isset($_POST['diskspace_ul']))
 				{
@@ -444,17 +434,9 @@ if($page == 'customers'
 					$email_autoresponder = 0;
 				}
 
-				$email_imap = 0;
+				$email_imap = intval_ressource($_POST['email_imap']);
-				if(isset($_POST['email_imap']))
+				$email_pop3 = intval_ressource($_POST['email_pop3']);
-					$email_imap = intval_ressource($_POST['email_imap']);
+				$ftps = intval_ressource($_POST['ftps']);
-
-				$email_pop3 = 0;
-				if(isset($_POST['email_pop3']))
-					$email_pop3 = intval_ressource($_POST['email_pop3']);
-
-				$ftps = 0;
-				if(isset($_POST['ftps']))
-					$ftps = intval_ressource($_POST['ftps']);
 
 				if(isset($_POST['ftps_ul']))
 				{
@@ -490,47 +472,13 @@ if($page == 'customers'
 					$number_of_aps_packages = 0;
 				}
 
-				$createstdsubdomain = 0;
+				$createstdsubdomain = intval($_POST['createstdsubdomain']);
-				if(isset($_POST['createstdsubdomain']))
-					$createstdsubdomain = intval($_POST['createstdsubdomain']);
 				$password = validate($_POST['new_customer_password'], 'password');
-				// only check if not empty,
+				$password = validatePassword($password);
-				// cause empty == generate password automatically
+				$sendpassword = intval($_POST['sendpassword']);
-				if($password != '')
+				$phpenabled = intval($_POST['phpenabled']);
-				{
+				$perlenabled = intval($_POST['perlenabled']);
-					$password = validatePassword($password);
+				$store_defaultindex = intval($_POST['store_defaultindex']);
-				}
-
-				$backup_allowed = 0;
-				if(isset($_POST['backup_allowed']))
-					$backup_allowed = intval($_POST['backup_allowed']);
-
-				if ($backup_allowed != 0)
-				{
-					$backup_allowed = 1;
-				}
-
-				// gender out of range? [0,2]
-				if ($gender < 0 || $gender > 2) {
-					$gender = 0;
-				}
-
-				$sendpassword = 0;
-				if(isset($_POST['sendpassword']))
-					$sendpassword = intval($_POST['sendpassword']);
-
-				$phpenabled = 0;
-				if(isset($_POST['phpenabled']))
-					$phpenabled = intval($_POST['phpenabled']);
-
-				$perlenabled = 0;
-				if(isset($_POST['perlenabled']))
-					$perlenabled = intval($_POST['perlenabled']);
-
-				$store_defaultindex = 0;
-				if(isset($_POST['store_defaultindex']))
-					$store_defaultindex = intval($_POST['store_defaultindex']);
-
 				$diskspace = $diskspace * 1024;
 				$traffic = $traffic * 1024 * 1024;
 
@@ -595,11 +543,6 @@ if($page == 'customers'
 						{
 							standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
 						}
-						
-						//Additional filtering for Bug #962
-						if(function_exists('posix_getpwnam') && !in_array("posix_getpwnam",explode(",",ini_get('disable_functions'))) && posix_getpwnam($loginname)) {
-							standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
-						}
 					}
 					else
 					{
@@ -650,47 +593,7 @@ if($page == 'customers'
 						$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
 					}
 
-					$_theme = $settings['panel']['default_theme'];
+					$result = $db->query("INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` (`adminid`, `loginname`, `password`, `name`, `firstname`, `company`, `street`, `zipcode`, `city`, `phone`, `fax`, `email`, `customernumber`, `def_language`, `documentroot`, `guid`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `standardsubdomain`, `phpenabled`, `imap`, `pop3`, `aps_packages`, `perlenabled`, `email_autoresponder`)  VALUES ('" . (int)$userinfo['adminid'] . "', '" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($firstname) . "', '" . $db->escape($company) . "', '" . $db->escape($street) . "', '" . $db->escape($zipcode) . "', '" . $db->escape($city) . "', '" . $db->escape($phone) . "', '" . $db->escape($fax) . "', '" . $db->escape($email) . "', '" . $db->escape($customernumber) . "','" . $db->escape($def_language) . "', '" . $db->escape($documentroot) . "', '" . $db->escape($guid) . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '0', '" . $db->escape($phpenabled) . "', '" . $db->escape($email_imap) . "', '" . $db->escape($email_pop3) . "', '" . (int)$number_of_aps_packages . "', '" . $db->escape($perlenabled) . "', '" . $db->escape($email_autoresponder) . "')");
-
-					$result = $db->query(
-						"INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` SET
-						`adminid` = '" . (int)$userinfo['adminid'] . "',
-						`loginname` = '" . $db->escape($loginname) . "',
-						`password` = '" . md5($password) . "',
-						`name` = '" . $db->escape($name) . "',
-						`firstname` = '" . $db->escape($firstname) . "',
-						`gender` = '" . (int)$gender . "',
-						`company` = '" . $db->escape($company) . "',
-						`street` = '" . $db->escape($street) . "',
-						`zipcode` = '" . $db->escape($zipcode) . "',
-						`city` = '" . $db->escape($city) . "',
-						`phone` = '" . $db->escape($phone) . "',
-						`fax` = '" . $db->escape($fax) . "',
-						`email` = '" . $db->escape($email) . "',
-						`customernumber` = '" . $db->escape($customernumber) . "',
-						`def_language` = '" . $db->escape($def_language) . "',
-						`documentroot` = '" . $db->escape($documentroot) . "',
-						`guid` = '" . $db->escape($guid) . "',
-						`diskspace` = '" . $db->escape($diskspace) . "',
-						`traffic` = '" . $db->escape($traffic) . "',
-						`subdomains` = '" . $db->escape($subdomains) . "',
-						`emails` = '" . $db->escape($emails) . "',
-						`email_accounts` = '" . $db->escape($email_accounts) . "',
-						`email_forwarders` = '" . $db->escape($email_forwarders) . "',
-						`email_quota` = '" . $db->escape($email_quota) . "',
-						`ftps` = '" . $db->escape($ftps) . "',
-						`tickets` = '" . $db->escape($tickets) . "',
-						`mysqls` = '" . $db->escape($mysqls) . "',
-						`standardsubdomain` = '0',
-						`phpenabled` = '" . $db->escape($phpenabled) . "',
-						`imap` = '" . $db->escape($email_imap) . "',
-						`pop3` = '" . $db->escape($email_pop3) . "',
-						`aps_packages` = '" . (int)$number_of_aps_packages . "',
-						`perlenabled` = '" . $db->escape($perlenabled) . "',
-						`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
-						`backup_allowed` = '" . $db->escape($backup_allowed) . "',
-						`theme` = '" . $db->escape($_theme) . "'"
-					);
 					$customerid = $db->insert_id();
 					$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1";
 
@@ -763,10 +666,8 @@ if($page == 'customers'
 					$log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'");
 					inserttask('2', $loginname, $guid, $guid, $store_defaultindex);
 
-					// Using filesystem - quota, insert a task which cleans the filesystem - quota
-					inserttask('10');
-
 					// Add htpasswd for the webalizer stats
+
 					if(CRYPT_STD_DES == 1)
 					{
 						$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
@@ -789,8 +690,7 @@ if($page == 'customers'
 					}
 
 					inserttask('1');
-					$cryptPassword = makeCryptPassword($password);
+					$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
-					$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
 					$result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')");
 					$result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')");
 					$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'");
@@ -818,6 +718,7 @@ if($page == 'customers'
 							"`isemaildomain` = '0', " .
 							"`caneditdomain` = '0', " . 
 							"`openbasedir` = '1', " .
+							"`safemode` = '1', " .
 							"`speciallogfile` = '0', " .
 							"`specialsettings` = '', " .
 							"`add_date` = '".date('Y-m-d')."'");
@@ -893,17 +794,13 @@ if($page == 'customers'
 				$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
-
+				$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', '1');
-				$gender_options = makeoption($lng['gender']['undef'], 0, true, true, true);
+				$email_imap = makeyesno('email_imap', '1', '0', '1');
-				$gender_options .= makeoption($lng['gender']['male'], 1, null, true, true);
+				$email_pop3 = makeyesno('email_pop3', '1', '0', '1');
-				$gender_options .= makeoption($lng['gender']['female'], 2, null, true, true);
+				$sendpassword = makeyesno('sendpassword', '1', '0', '1');
-
+				$phpenabled = makeyesno('phpenabled', '1', '0', '1');
-				$customer_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_add.php';
+				$perlenabled = makeyesno('perlenabled', '1', '0', '0');
-				$customer_add_form = htmlform::genHTMLForm($customer_add_data);
+				$store_defaultindex = makeyesno('store_defaultindex', '1', '0', '1');
-
-				$title = $customer_add_data['customer_add']['title'];
-				$image = $customer_add_data['customer_add']['image'];
-
 				eval("echo \"" . getTemplate("customers/customers_add") . "\";");
 			}
 		}
@@ -931,7 +828,6 @@ if($page == 'customers'
 				$def_language = validate($_POST['def_language'], 'default language');
 				$password = validate($_POST['new_customer_password'], 'new password');
 				$diskspace = intval_ressource($_POST['diskspace']);
-				$gender = intval_ressource($_POST['gender']);
 
 				if(isset($_POST['diskspace_ul']))
 				{
@@ -1001,17 +897,9 @@ if($page == 'customers'
 					$email_autoresponder = 0;
 				}				
 
-				$email_imap = 0;
+				$email_imap = intval_ressource($_POST['email_imap']);
-				if(isset($_POST['email_imap']))
+				$email_pop3 = intval_ressource($_POST['email_pop3']);
-					$email_imap = intval_ressource($_POST['email_imap']);
+				$ftps = intval_ressource($_POST['ftps']);
-
-				$email_pop3 = 0;
-				if(isset($_POST['email_pop3']))
-					$email_pop3 = intval_ressource($_POST['email_pop3']);
-
-				$ftps = 0;
-				if(isset($_POST['ftps']))
-					$ftps = intval_ressource($_POST['ftps']);
 
 				if(isset($_POST['ftps_ul']))
 				{
@@ -1026,22 +914,7 @@ if($page == 'customers'
 					$tickets = - 1;
 				}
 
-				$backup_allowed = 0;
+				$mysqls = intval_ressource($_POST['mysqls']);
-				if (isset($_POST['backup_allowed']))
-					$backup_allowed = intval($_POST['backup_allowed']);
-
-				if($backup_allowed != '0'){
-					$backup_allowed = 1;
-				}
-
-				// gender out of range? [0,2]
-				if ($gender < 0 || $gender > 2) {
-					$gender = 0;
-				}
-
-				$mysqls = 0;
-				if(isset($_POST['mysqls']))
-					$mysqls = intval_ressource($_POST['mysqls']);
 
 				if(isset($_POST['mysqls_ul']))
 				{
@@ -1062,21 +935,10 @@ if($page == 'customers'
 					$number_of_aps_packages = 0;
 				}
 
-				$createstdsubdomain = 0;
+				$createstdsubdomain = intval($_POST['createstdsubdomain']);
-				if(isset($_POST['createstdsubdomain']))
+				$deactivated = intval($_POST['deactivated']);
-					$createstdsubdomain = intval($_POST['createstdsubdomain']);
+				$phpenabled = intval($_POST['phpenabled']);
-
+				$perlenabled = intval($_POST['perlenabled']);
-				$deactivated = 0;
-				if(isset($_POST['deactivated']))
-					$deactivated = intval($_POST['deactivated']);
-
-				$phpenabled = 0;
-				if(isset($_POST['phpenabled']))
-					$phpenabled = intval($_POST['phpenabled']);
-
-				$perlenabled = 0;
-				if(isset($_POST['perlenabled']))
-					$perlenabled = intval($_POST['perlenabled']);
 				$diskspace = $diskspace * 1024;
 				$traffic = $traffic * 1024 * 1024;
 
@@ -1157,7 +1019,7 @@ if($page == 'customers'
 							$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname'];
 						}
 
-						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `speciallogfile`, `specialsettings`, `add_date`) " . "VALUES ('" . $db->escape($_stdsubdomain) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '0', '', '".date('Y-m-d')."')");
+						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `safemode`, `speciallogfile`, `specialsettings`, `add_date`) " . "VALUES ('" . $db->escape($_stdsubdomain) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '1', '0', '', '".date('Y-m-d')."')");
 						$domainid = $db->insert_id();
 						$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
 						$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'");
@@ -1196,48 +1058,9 @@ if($page == 'customers'
 
 					if($deactivated != $result['deactivated'])
 					{
-						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : (int)$result['pop3']) . "', `imap`='" . (($deactivated) ? '0' : (int)$result['imap']) . "' WHERE `customerid`='" . (int)$id . "'");
+						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : '1') . "', `imap`='" . (($deactivated) ? '0' : '1') . "' WHERE `customerid`='" . (int)$id . "'");
 						$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'");
 						$db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'");
-
-						/* Retrieve customer's databases */
-						$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
-						$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
-						$last_dbserver = 0;
-
-						/* For each of them */
-						while($row_database = $db->fetch_array($databases))
-						{
-							if($last_dbserver != $row_database['dbserver'])
-							{
-								$db_root->query('FLUSH PRIVILEGES;');
-								$db_root->close();
-								$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
-								$last_dbserver = $row_database['dbserver'];
-							}
-
-							foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
-							{
-								$mysql_access_host = trim($mysql_access_host);
-
-								/* Prevent access, if deactivated */
-								if($deactivated)
-								{
-									// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
-									$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
-								}
-								else /* Otherwise grant access */
-								{
-									$db_root->query('GRANT ALL PRIVILEGES ON `' . $db_root->escape($row_database['databasename']) .'`.* TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-									$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-								}
-							}
-						}
-
-						/* At last flush the new privileges */
-						$db_root->query('FLUSH PRIVILEGES;');
-						$db_root->close();
-
 						$log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'");
 						inserttask('1');
 					}
@@ -1256,13 +1079,9 @@ if($page == 'customers'
 						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'");
 					}
 
-					// $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'");
+					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'");
-					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `gender`='" . $db->escape($gender) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `backup_allowed`='" . $db->escape($backup_allowed) . "' WHERE `customerid`='" . (int)$id . "'");
 					$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` ";
 
-					// Using filesystem - quota, insert a task which cleans the filesystem - quota
-					inserttask('10');
-
 					if($mysqls != '-1'
 					   || $result['mysqls'] != '-1')
 					{
@@ -1546,18 +1365,14 @@ if($page == 'customers'
 					$result['aps_packages'] = '';
 				}
 
+				$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', (($result['standardsubdomain'] != '0') ? '1' : '0'));
+				$phpenabled = makeyesno('phpenabled', '1', '0', $result['phpenabled']);
+				$perlenabled = makeyesno('perlenabled', '1', '0', $result['perlenabled']);
+				$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
+				$email_imap = makeyesno('email_imap', '1', '0', $result['imap']);
+				$email_pop3 = makeyesno('email_pop3', '1', '0', $result['pop3']);
+
 				$result = htmlentities_array($result);
-
-				$gender_options = makeoption($lng['gender']['undef'], 0, ($result['gender'] == '0' ? true : false), true, true);
-				$gender_options .= makeoption($lng['gender']['male'], 1, ($result['gender'] == '1' ? true : false), true, true);
-				$gender_options .= makeoption($lng['gender']['female'], 2, ($result['gender'] == '2' ? true : false), true, true);
-
-				$customer_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_edit.php';
-				$customer_edit_form = htmlform::genHTMLForm($customer_edit_data);
-
-				$title = $customer_edit_data['customer_edit']['title'];
-				$image = $customer_edit_data['customer_edit']['image'];
-
 				eval("echo \"" . getTemplate("customers/customers_edit") . "\";");
 			}
 		}

admin_domains.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -144,8 +144,8 @@ if($page == 'domains'
 		$alias_check = $db->query_first('SELECT COUNT(`id`) AS `count` FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$id . '\'');
 
 		if($result['domain'] != ''
-			&& $alias_check['count'] == 0
+		   && $alias_check['count'] == 0)
-		) {
+		{
 			if(isset($_POST['send'])
 			   && $_POST['send'] == 'send')
 			{
@@ -194,15 +194,9 @@ if($page == 'domains'
 				$log->logAction(ADM_ACTION, LOG_INFO, "deleted domain/subdomains (#" . $result['id'] . ")");
 				updateCounters();
 				inserttask('1');
-
-				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
-
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
-			elseif ($alias_check['count'] > 0) {
-				standard_error('domains_cantdeletedomainwithaliases');
-			}
 			else
 			{
 				$showcheck = false;
@@ -230,23 +224,10 @@ if($page == 'domains'
 
 				$domain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['domain'], 'domain')));
 				$subcanemaildomain = intval($_POST['subcanemaildomain']);
-
-				$isemaildomain = 0;
-				if(isset($_POST['isemaildomain']))
 				$isemaildomain = intval($_POST['isemaildomain']);
-
+				$email_only = intval($_POST['email_only']);
-				$email_only = 0;
+				$wwwserveralias = intval($_POST['wwwserveralias']);
-				if(isset($_POST['email_only']))
+				$speciallogfile = intval($_POST['speciallogfile']);
-					$email_only = intval($_POST['email_only']);
-
-				$wwwserveralias = 0;
-				if(isset($_POST['wwwserveralias']))
-					$wwwserveralias = intval($_POST['wwwserveralias']);
-
-				$speciallogfile = 0;
-				if(isset($_POST['speciallogfile']))
-					$speciallogfile = intval($_POST['speciallogfile']);
-
 				$aliasdomain = intval($_POST['alias']);
 				$issubof = intval($_POST['issubof']);
 				$customerid = intval($_POST['customerid']);
@@ -276,21 +257,13 @@ if($page == 'domains'
 				}
 
 				$documentroot = $customer['documentroot'];
-				$registration_date = trim($_POST['registration_date']);
+				$registration_date = validate($_POST['registration_date'], 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
-				$registration_date = validate($registration_date, 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
 
 				if($userinfo['change_serversettings'] == '1')
 				{
-					$caneditdomain = isset($_POST['caneditdomain']) ? intval($_POST['caneditdomain']) : 0;
+					$isbinddomain = intval($_POST['isbinddomain']);
-
+					$caneditdomain = intval($_POST['caneditdomain']);
-					$isbinddomain = '0';
+					$zonefile = validate($_POST['zonefile'], 'zonefile');
-					$zonefile = '';
-					if ($settings['system']['bind_enable'] == '1') {
-						if (isset($_POST['isbinddomain'])) {
-							$isbinddomain = intval($_POST['isbinddomain']);
-						}
-						$zonefile = validate($_POST['zonefile'], 'zonefile');
-					}
 
 					if(isset($_POST['dkim']))
 					{
@@ -304,13 +277,11 @@ if($page == 'domains'
 					$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
 					validate($_POST['documentroot'], 'documentroot');
 
-					// If path is empty and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
-					// set default path to subdomain or domain name
 					if(isset($_POST['documentroot'])
-						&& ($_POST['documentroot'] != ''))
+					   && $_POST['documentroot'] != '')
 					{
 						if(substr($_POST['documentroot'], 0, 1) != '/'
-							&& !preg_match('/^https?\:\/\//', $_POST['documentroot']))
+						   && !preg_match('/^https?\:\/\//', $_POST['documentroot']))
 						{
 							$documentroot.= '/' . $_POST['documentroot'];
 						}
@@ -319,19 +290,10 @@ if($page == 'domains'
 							$documentroot = $_POST['documentroot'];
 						}
 					}
-					elseif (isset($_POST['documentroot'])
-						&& ($_POST['documentroot'] == '') 
-						&& ($settings['system']['documentroot_use_default_value'] == 1))
-					{
-						$documentroot = makeCorrectDir($customer['documentroot'] . '/' . $domain);
-					}
 				}
 				else
 				{
-					$isbinddomain = '0';
+					$isbinddomain = '1';
-					if ($settings['system']['bind_enable'] == '1') {
-						$isbinddomain = '1';
-					}
 					$caneditdomain = '1';
 					$zonefile = '';
 					$dkim = '1';
@@ -341,9 +303,10 @@ if($page == 'domains'
 				if($userinfo['caneditphpsettings'] == '1'
 				   || $userinfo['change_serversettings'] == '1')
 				{
-					$openbasedir = isset($_POST['openbasedir']) ? intval($_POST['openbasedir']) : 0;
+					$openbasedir = intval($_POST['openbasedir']);
+					$safemode = intval($_POST['safemode']);
 
-					if((int)$settings['system']['mod_fcgid'] == 1 || (int)$settings['phpfpm']['enabled'] == 1)
+					if((int)$settings['system']['mod_fcgid'] == 1)
 					{
 						$phpsettingid = (int)$_POST['phpsettingid'];
 						$phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid);
@@ -355,21 +318,12 @@ if($page == 'domains'
 							standard_error('phpsettingidwrong');
 						}
 
-						if( (int)$settings['system']['mod_fcgid'] == 1) {
+						$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
-							$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
+						$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
-							$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
-						} else {
-							$mod_fcgid_starter = '-1';
-							$mod_fcgid_maxrequests = '-1';
-						}
 					}
 					else
 					{
-						if ((int)$settings['phpfpm']['enabled'] == 1) {
+						$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
-							$phpsettingid = $settings['phpfpm']['defaultini'];
-						} else {
-							$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
-						}
 						$mod_fcgid_starter = '-1';
 						$mod_fcgid_maxrequests = '-1';
 					}
@@ -377,11 +331,8 @@ if($page == 'domains'
 				else
 				{
 					$openbasedir = '1';
-					if ((int)$settings['phpfpm']['enabled'] == 1) {
+					$safemode = '1';
-						$phpsettingid = $settings['phpfpm']['defaultini'];
+					$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
-					} else {
-						$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
-					}
 					$mod_fcgid_starter = '-1';
 					$mod_fcgid_maxrequests = '-1';
 				}
@@ -408,15 +359,12 @@ if($page == 'domains'
 
 				if($settings['system']['use_ssl'] == "1"
 				   && isset($_POST['ssl'])
-				   /*&& isset($_POST['ssl_redirect'])*/
+				   && isset($_POST['ssl_redirect'])
 				   && isset($_POST['ssl_ipandport'])
 				   && $_POST['ssl'] != '0')
 				{
-					$ssl = 1; // if ssl is set and != 0 it can only be 1
+					$ssl = (int)$_POST['ssl'];
-					$ssl_redirect = 0;
+					$ssl_redirect = (int)$_POST['ssl_redirect'];
-					if (isset($_POST['ssl_redirect'])) {
-						$ssl_redirect = (int)$_POST['ssl_redirect'];
-					}
 					$ssl_ipandport = (int)$_POST['ssl_ipandport'];
 					$ssl_ipandport_check = $db->query_first("SELECT `id`, `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = '" . $db->escape($ssl_ipandport) . "' AND `ssl` = '1'" . $additional_ip_condition);
 
@@ -462,6 +410,11 @@ if($page == 'domains'
 					$openbasedir = '0';
 				}
 
+				if($safemode != '1')
+				{
+					$safemode = '0';
+				}
+
 				if($speciallogfile != '1')
 				{
 					$speciallogfile = '0';
@@ -517,8 +470,7 @@ if($page == 'domains'
 				{
 					standard_error(array('stringisempty', 'mydomain'));
 				}
-				/* Check whether domain validation is enabled and if, validate the domain */
+				elseif(!validateDomain($domain))
-				elseif($settings['system']['validate_domain'] && !validateDomain($domain))
 				{
 					standard_error(array('stringiswrong', 'mydomain'));
 				}
@@ -562,6 +514,7 @@ if($page == 'domains'
 						'ssl_redirect' => $ssl_redirect,
 						'ssl_ipandport' => $ssl_ipandport,
 						'openbasedir' => $openbasedir,
+						'safemode' => $safemode,
 						'phpsettingid' => $phpsettingid,
 						'mod_fcgid_starter' => $mod_fcgid_starter,
 						'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests,
@@ -571,7 +524,7 @@ if($page == 'domains'
 					);
 
 					$security_questions = array(
-						'reallydisablesecuritysetting' => ($openbasedir == '0' && $userinfo['change_serversettings'] == '1'),
+						'reallydisablesecuritysetting' => (($openbasedir == '0' || $safemode == '0') && $userinfo['change_serversettings'] == '1'),
 						'reallydocrootoutofcustomerroot' => (substr($documentroot, 0, strlen($customer['documentroot'])) != $customer['documentroot'] && !preg_match('/^https?\:\/\//', $documentroot))
 					);
 					$question_nr = 1;
@@ -591,15 +544,12 @@ if($page == 'domains'
 						$question_nr++;
 					}
 
-					$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`domain`, `customerid`, `adminid`, `documentroot`, `ipandport`,`aliasdomain`, `zonefile`, `dkim`, `wwwserveralias`, `isbinddomain`, `isemaildomain`, `email_only`, `subcanemaildomain`, `caneditdomain`, `openbasedir`, `speciallogfile`, `specialsettings`, `ssl`, `ssl_redirect`, `ssl_ipandport`, `add_date`, `registration_date`, `phpsettingid`, `mod_fcgid_starter`, `mod_fcgid_maxrequests`, `ismainbutsubto`) VALUES ('" . $db->escape($domain) . "', '" . (int)$customerid . "', '" . (int)$adminid . "', '" . $db->escape($documentroot) . "', '" . $db->escape($ipandport) . "', " . (($aliasdomain != 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", '" . $db->escape($zonefile) . "', '" . $db->escape($dkim) . "', '" . $db->escape($wwwserveralias) . "', '" . $db->escape($isbinddomain) . "', '" . $db->escape($isemaildomain) . "', '" . $db->escape($email_only) . "', '" . $db->escape($subcanemaildomain) . "', '" . $db->escape($caneditdomain) . "', '" . $db->escape($openbasedir) . "', '" . $db->escape($speciallogfile) . "', '" . $db->escape($specialsettings) . "', '" . $ssl . "', '" . $ssl_redirect . "' , '" . $ssl_ipandport . "', '" . $db->escape(time()) . "', '" . $db->escape($registration_date) . "', '" . (int)$phpsettingid . "', '" . (int)$mod_fcgid_starter . "', '" . (int)$mod_fcgid_maxrequests . "', '".(int)$issubof."')");
+					$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`domain`, `customerid`, `adminid`, `documentroot`, `ipandport`,`aliasdomain`, `zonefile`, `dkim`, `wwwserveralias`, `isbinddomain`, `isemaildomain`, `email_only`, `subcanemaildomain`, `caneditdomain`, `openbasedir`, `safemode`,`speciallogfile`, `specialsettings`, `ssl`, `ssl_redirect`, `ssl_ipandport`, `add_date`, `registration_date`, `phpsettingid`, `mod_fcgid_starter`, `mod_fcgid_maxrequests`, `ismainbutsubto`) VALUES ('" . $db->escape($domain) . "', '" . (int)$customerid . "', '" . (int)$adminid . "', '" . $db->escape($documentroot) . "', '" . $db->escape($ipandport) . "', " . (($aliasdomain != 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", '" . $db->escape($zonefile) . "', '" . $db->escape($dkim) . "', '" . $db->escape($wwwserveralias) . "', '" . $db->escape($isbinddomain) . "', '" . $db->escape($isemaildomain) . "', '" . $db->escape($email_only) . "', '" . $db->escape($subcanemaildomain) . "', '" . $db->escape($caneditdomain) . "', '" . $db->escape($openbasedir) . "', '" . $db->escape($safemode) . "', '" . $db->escape($speciallogfile) . "', '" . $db->escape($specialsettings) . "', '" . $ssl . "', '" . $ssl_redirect . "' , '" . $ssl_ipandport . "', '" . $db->escape(time()) . "', '" . $db->escape($registration_date) . "', '" . (int)$phpsettingid . "', '" . (int)$mod_fcgid_starter . "', '" . (int)$mod_fcgid_maxrequests . "', '".(int)$issubof."')");
 					$domainid = $db->insert_id();
 					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` + 1 WHERE `adminid` = '" . (int)$adminid . "'");
 					$log->logAction(ADM_ACTION, LOG_INFO, "added domain '" . $domain . "'");
 					inserttask('1');
-
-					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
-
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
@@ -699,22 +649,23 @@ if($page == 'domains'
 
 				while($row = $db->fetch_array($configs))
 				{
-					if ((int)$settings['phpfpm']['enabled'] == 1) {
+					$phpconfigs.= makeoption($row['description'], $row['id'], $settings['system']['mod_fcgid_defaultini'], true, true);
-						$phpconfigs.= makeoption($row['description'], $row['id'], $settings['phpfpm']['defaultini'], true, true);
-					} else {
-						$phpconfigs.= makeoption($row['description'], $row['id'], $settings['system']['mod_fcgid_defaultini'], true, true);
-					}
 				}
 
+				$isbinddomain = makeyesno('isbinddomain', '1', '0', '1');
+				$isemaildomain = makeyesno('isemaildomain', '1', '0', '1');
+				$email_only = makeyesno('email_only', '1', '0', '0');
 				$subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['always'], '3', '0', true, true);
+				$dkim = makeyesno('dkim', '1', '0', '1');
+				$wwwserveralias = makeyesno('wwwserveralias', '1', '0', '1');
+				$caneditdomain = makeyesno('caneditdomain', '1', '0', '1');
+				$openbasedir = makeyesno('openbasedir', '1', '0', '1');
+				$safemode = makeyesno('safemode', '1', '0', '1');
+				$speciallogfile = makeyesno('speciallogfile', '1', '0', '0');
+				$ssl = makeyesno('ssl', '1', '0', '0');
+				$ssl_redirect = makeyesno('ssl_redirect', '1', '0', '0');				
 				$add_date = date('Y-m-d');
 
-				$domain_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/domains/formfield.domains_add.php';
-				$domain_add_form = htmlform::genHTMLForm($domain_add_data);
-
-				$title = $domain_add_data['domain_add']['title'];
-				$image = $domain_add_data['domain_add']['image'];
-
 				eval("echo \"" . getTemplate("domains/domains_add") . "\";");
 			}
 		}
@@ -804,42 +755,21 @@ if($page == 'domains'
 
 				$aliasdomain = intval($_POST['alias']);
 				$issubof = intval($_POST['issubof']);
-				$subcanemaildomain = intval($_POST['subcanemaildomain']);
-				$caneditdomain = isset($_POST['caneditdomain']) ? intval($_POST['caneditdomain']) : 0;
-				$registration_date = trim($_POST['registration_date']);
-				$registration_date = validate($registration_date, 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
-
-				$isemaildomain = 0;
-				if(isset($_POST['isemaildomain']))
 				$isemaildomain = intval($_POST['isemaildomain']);
-
+				$email_only = intval($_POST['email_only']);
-				$email_only = 0;
+				$subcanemaildomain = intval($_POST['subcanemaildomain']);
-				if(isset($_POST['email_only']))
+				$caneditdomain = intval($_POST['caneditdomain']);
-					$email_only = intval($_POST['email_only']);
+				$wwwserveralias = intval($_POST['wwwserveralias']);
-
+				$registration_date = validate($_POST['registration_date'], 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
-				$wwwserveralias = 0;
-				if(isset($_POST['wwwserveralias']))
-					$wwwserveralias = intval($_POST['wwwserveralias']);
-
-				$speciallogfile = 0;
-				if(isset($_POST['speciallogfile']))
-					$speciallogfile = intval($_POST['speciallogfile']);
-
 
 				if($userinfo['change_serversettings'] == '1')
 				{
-					$isbinddomain = $result['isbinddomain'];
+					$isbinddomain = intval($_POST['isbinddomain']);
-					$zonefile = $result['zonefile'];
+					$zonefile = validate($_POST['zonefile'], 'zonefile');
-					if ($settings['system']['bind_enable'] == '1') {
-						if (isset($_POST['isbinddomain'])) {
-							$isbinddomain = (int)$_POST['isbinddomain'];
-						}
-						$zonefile = validate($_POST['zonefile'], 'zonefile');
-					}
 
 					if($settings['dkim']['use_dkim'] == '1')
 					{
-						$dkim = isset($_POST['dkim']) ? 1 : 0;
+						$dkim = intval($_POST['dkim']);
 					}
 					else
 					{
@@ -851,16 +781,7 @@ if($page == 'domains'
 
 					if($documentroot == '')
 					{
-						// If path is empty and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+						$documentroot = $customer['documentroot'];
-						// set default path to subdomain or domain name
-						if ($settings['system']['documentroot_use_default_value'] == 1)
-						{
-							$documentroot = makeCorrectDir($customer['documentroot'] . '/' . $result['domain']);
-						}
-						else
-						{
-							$documentroot = $customer['documentroot'];
-						}
 					}
 
 					if(!preg_match('/^https?\:\/\//', $documentroot)
@@ -881,9 +802,10 @@ if($page == 'domains'
 				if($userinfo['caneditphpsettings'] == '1'
 				   || $userinfo['change_serversettings'] == '1')
 				{
-					$openbasedir = isset($_POST['openbasedir']) ? intval($_POST['openbasedir']) : 0;
+					$openbasedir = intval($_POST['openbasedir']);
+					$safemode = intval($_POST['safemode']);
 
-					if((int)$settings['system']['mod_fcgid'] == 1 || (int)$settings['phpfpm']['enabled'] == 1)
+					if((int)$settings['system']['mod_fcgid'] == 1)
 					{
 						$phpsettingid = (int)$_POST['phpsettingid'];
 						$phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid);
@@ -895,13 +817,8 @@ if($page == 'domains'
 							standard_error('phpsettingidwrong');
 						}
 
-						if ((int)$settings['system']['mod_fcgid'] == 1) {
+						$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
-							$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
+						$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
-							$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
-						} else {
-							$mod_fcgid_starter = $result['mod_fcgid_starter'];
-							$mod_fcgid_maxrequests = $result['mod_fcgid_maxrequests'];
-						}
 					}
 					else
 					{
@@ -913,6 +830,7 @@ if($page == 'domains'
 				else
 				{
 					$openbasedir = $result['openbasedir'];
+					$safemode = $result['safemode'];
 					$phpsettingid = $result['phpsettingid'];
 					$mod_fcgid_starter = $result['mod_fcgid_starter'];
 					$mod_fcgid_maxrequests = $result['mod_fcgid_maxrequests'];
@@ -940,15 +858,12 @@ if($page == 'domains'
 
 				if($settings['system']['use_ssl'] == "1"
 				   && isset($_POST['ssl'])
-				   /*&& isset($_POST['ssl_redirect'])*/
+				   && isset($_POST['ssl_redirect'])
 				   && isset($_POST['ssl_ipandport'])
 				   && $_POST['ssl'] != '0')
 				{
-					$ssl = 1; // if ssl is set and != 0, it can only be 1
+					$ssl = (int)$_POST['ssl'];
-					$ssl_redirect = 0;
+					$ssl_redirect = (int)$_POST['ssl_redirect'];
-					if (isset($_POST['ssl_redirect'])) {
-						$ssl_redirect = (int)$_POST['ssl_redirect'];
-					}
 					$ssl_ipandport = (int)$_POST['ssl_ipandport'];
 					$ssl_ipandport_check = $db->query_first("SELECT `id`, `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = '" . $db->escape($ssl_ipandport) . "' AND `ssl` = '1'" . $additional_ip_condition);
 
@@ -976,6 +891,11 @@ if($page == 'domains'
 					$openbasedir = '0';
 				}
 
+				if($safemode != '1')
+				{
+					$safemode = '0';
+				}
+
 				if($isbinddomain != '1')
 				{
 					$isbinddomain = '0';
@@ -1053,17 +973,17 @@ if($page == 'domains'
 					'ssl_redirect' => $ssl_redirect,
 					'ssl_ipandport' => $ssl_ipandport,
 					'openbasedir' => $openbasedir,
+					'safemode' => $safemode,
 					'phpsettingid' => $phpsettingid,
 					'mod_fcgid_starter' => $mod_fcgid_starter,
 					'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests,
 					'specialsettings' => $specialsettings,
 					'registration_date' => $registration_date,
-					'issubof' => $issubof,
+					'issubof' => $issubof
-					'speciallogfile' => $speciallogfile
 				);
 
 				$security_questions = array(
-					'reallydisablesecuritysetting' => ($openbasedir == '0' && $userinfo['change_serversettings'] == '1'),
+					'reallydisablesecuritysetting' => (($openbasedir == '0' || $safemode == '0') && $userinfo['change_serversettings'] == '1'),
 					'reallydocrootoutofcustomerroot' => (substr($documentroot, 0, strlen($customer['documentroot'])) != $customer['documentroot'] && !preg_match('/^https?\:\/\//', $documentroot))
 				);
 				foreach($security_questions as $question_name => $question_launch)
@@ -1088,20 +1008,17 @@ if($page == 'domains'
 				   || $ssl_ipandport != $result['ssl_ipandport']
 				   || $wwwserveralias != $result['wwwserveralias']
 				   || $openbasedir != $result['openbasedir']
+				   || $safemode != $result['safemode']
 				   || $phpsettingid != $result['phpsettingid']
 				   || $mod_fcgid_starter != $result['mod_fcgid_starter']
 				   || $mod_fcgid_maxrequests != $result['mod_fcgid_maxrequests']
 				   || $specialsettings != $result['specialsettings']
 				   || $aliasdomain != $result['aliasdomain']
-				   || $issubof != $result['ismainbutsubto']
+				   || $issubof != $result['ismainbutsubto'])
-				   || $email_only != $result['email_only']
-				   || ($speciallogfile != $result['speciallogfile'] && $_POST['speciallogverified'] == '1'))
 				{
 					inserttask('1');
 				}
 
-				if($speciallogfile != $result['speciallogfile'] && $_POST['speciallogverified'] != '1') $speciallogfile = $result['speciallogfile'];
-
 				if($isbinddomain != $result['isbinddomain']
 				   || $zonefile != $result['zonefile']
 				   || $dkim != $result['dkim']
@@ -1147,7 +1064,7 @@ if($page == 'domains'
 					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` - 1 WHERE `adminid` = '" . (int)$result['adminid'] . "' ");
 				}
 
-				$ssfs = isset($_POST['specialsettingsforsubdomains']) ? 1 : 0;
+				$ssfs = isset($_POST['specialsettingsforsubdomains']) ? intval($_POST['specialsettingsforsubdomains']) : 1;
 				if($ssfs == 1)
 				{
 					$upd_specialsettings = ", `specialsettings`='" . $db->escape($specialsettings) . "' ";
@@ -1159,8 +1076,8 @@ if($page == 'domains'
 					$log->logAction(ADM_ACTION, LOG_INFO, "removed specialsettings on all subdomains of domain #" . $id);
 				}
 				
-				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `documentroot`='" . $db->escape($documentroot) . "', `ipandport`='" . $db->escape($ipandport) . "', `ssl`='" . (int)$ssl . "', `ssl_redirect`='" . (int)$ssl_redirect . "', `ssl_ipandport`='" . (int)$ssl_ipandport . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", `isbinddomain`='" . $db->escape($isbinddomain) . "', `isemaildomain`='" . $db->escape($isemaildomain) . "', `email_only`='" . $db->escape($email_only) . "', `subcanemaildomain`='" . $db->escape($subcanemaildomain) . "', `dkim`='" . $db->escape($dkim) . "', `caneditdomain`='" . $db->escape($caneditdomain) . "', `zonefile`='" . $db->escape($zonefile) . "', `wwwserveralias`='" . $db->escape($wwwserveralias) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `speciallogfile`='" . $db->escape($speciallogfile) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "', `specialsettings`='" . $db->escape($specialsettings) . "', `registration_date`='" . $db->escape($registration_date) . "', `ismainbutsubto`='" . (int)$issubof . "' WHERE `id`='" . (int)$id . "'");
+				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `documentroot`='" . $db->escape($documentroot) . "', `ipandport`='" . $db->escape($ipandport) . "', `ssl`='" . (int)$ssl . "', `ssl_redirect`='" . (int)$ssl_redirect . "', `ssl_ipandport`='" . (int)$ssl_ipandport . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", `isbinddomain`='" . $db->escape($isbinddomain) . "', `isemaildomain`='" . $db->escape($isemaildomain) . "', `email_only`='" . $db->escape($email_only) . "', `subcanemaildomain`='" . $db->escape($subcanemaildomain) . "', `dkim`='" . $db->escape($dkim) . "', `caneditdomain`='" . $db->escape($caneditdomain) . "', `zonefile`='" . $db->escape($zonefile) . "', `wwwserveralias`='" . $db->escape($wwwserveralias) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `safemode`='" . $db->escape($safemode) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "', `specialsettings`='" . $db->escape($specialsettings) . "', `registration_date`='" . $db->escape($registration_date) . "', `ismainbutsubto`='" . (int)$issubof . "' WHERE `id`='" . (int)$id . "'");
-				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `ipandport`='" . $db->escape($ipandport) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `speciallogfile`='" . $db->escape($speciallogfile) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "'" . $upd_specialsettings . $updatechildren . " WHERE `parentdomainid`='" . (int)$id . "'");
+				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `ipandport`='" . $db->escape($ipandport) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `safemode`='" . $db->escape($safemode) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "'" . $upd_specialsettings . $updatechildren . " WHERE `parentdomainid`='" . (int)$id . "'");
 				$log->logAction(ADM_ACTION, LOG_INFO, "edited domain #" . $id);
 				$redirect_props = Array(
 					'page' => $page,
@@ -1260,11 +1177,20 @@ if($page == 'domains'
 				}
 
 				$result['specialsettings'] = $result['specialsettings'];
-
+				$isbinddomain = makeyesno('isbinddomain', '1', '0', $result['isbinddomain']);
+				$wwwserveralias = makeyesno('wwwserveralias', '1', '0', $result['wwwserveralias']);
+				$isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
+				$email_only = makeyesno('email_only', '1', '0', $result['email_only']);
+				$ssl = makeyesno('ssl', '1', '0', $result['ssl']);
+				$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
 				$subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', $result['subcanemaildomain'], true, true);
 				$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', $result['subcanemaildomain'], true, true);
 				$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', $result['subcanemaildomain'], true, true);
 				$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['always'], '3', $result['subcanemaildomain'], true, true);
+				$dkim = makeyesno('dkim', '1', '0', $result['dkim']);
+				$caneditdomain = makeyesno('caneditdomain', '1', '0', $result['caneditdomain']);
+				$openbasedir = makeyesno('openbasedir', '1', '0', $result['openbasedir']);
+				$safemode = makeyesno('safemode', '1', '0', $result['safemode']);
 				$speciallogfile = ($result['speciallogfile'] == 1 ? $lng['panel']['yes'] : $lng['panel']['no']);
 				$result['add_date'] = date('Y-m-d', $result['add_date']);
 
@@ -1276,16 +1202,9 @@ if($page == 'domains'
 					$phpconfigs.= makeoption($phpconfigs_row['description'], $phpconfigs_row['id'], $result['phpsettingid'], true, true);
 				}
 
+				$specialsettingsforsubdomains = makeyesno('specialsettingsforsubdomains', '1', '0', '1');
+				
 				$result = htmlentities_array($result);
-
-				$domain_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/domains/formfield.domains_edit.php';
-				$domain_edit_form = htmlform::genHTMLForm($domain_edit_data);
-
-				$title = $domain_edit_data['domain_edit']['title'];
-				$image = $domain_edit_data['domain_edit']['image'];
-
-				$speciallogwarning = sprintf($lng['admin']['speciallogwarning'], $lng['admin']['delete_statistics']);
-
 				eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
 			}
 		}

admin_index.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -104,13 +104,11 @@ if($page == 'overview')
 					$_message = isset($latestversion[1]) ? $latestversion[1] : '';
 					$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
 
-					// add the branding so debian guys are not gettings confused
+					$lookfornewversion_lable = $_version;
-					// about their version-number
-					$lookfornewversion_lable = $_version.$branding;
 					$lookfornewversion_link = $_link;
 					$lookfornewversion_addinfo = $_message;
 					
-					if (version_compare2($version, $_version) == -1) {
+					if (version_compare($version, $_version) == -1) {
 						$isnewerversion = 1;
 					} else {
 						$isnewerversion = 0;
@@ -297,34 +295,5 @@ elseif($page == 'change_language')
 		eval("echo \"" . getTemplate("index/change_language") . "\";");
 	}
 }
-elseif($page == 'change_theme')
-{
-	if(isset($_POST['send'])
-		&& $_POST['send'] == 'send'
-	) {
-		$theme = validate($_POST['theme'], 'theme');
 
-		$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `adminid`='" . (int)$userinfo['adminid'] . "'");
+?>
-		$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
-
-		$log->logAction(ADM_ACTION, LOG_NOTICE, "changed his/her theme to '" . $theme . "'");
-		redirectTo($filename, Array('s' => $s));
-	}
-	else
-	{
-		$theme_options = '';
-
-		$default_theme = $settings['panel']['default_theme'];
-		if($userinfo['theme'] != '') {
-			$default_theme = $userinfo['theme'];
-		}
-
-		$themes_avail = getThemes();
-		foreach($themes_avail as $t)
-		{
-			$theme_options.= makeoption($t, $t, $default_theme, true);
-		}
-
-		eval("echo \"" . getTemplate("index/change_theme") . "\";");
-	}
-}

admin_ipsandports.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -104,10 +104,7 @@ if($page == 'ipsandports'
 								$db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'");
 								$log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'");
 								inserttask('1');
-
-								// Using nameserver, insert a task which rebuilds the server config
 								inserttask('4');
-
 								redirectTo($filename, Array('page' => $page, 's' => $s));
 							}
 							else
@@ -139,11 +136,11 @@ if($page == 'ipsandports'
 		{
 			$ip = validate_ip($_POST['ip']);
 			$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
-			$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
+			$listen_statement = intval($_POST['listen_statement']);
-			$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
+			$namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
-			$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
+			$vhostcontainer = intval($_POST['vhostcontainer']);
 			$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
-			$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
+			$vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
 			$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
 			$docroot = validate($_POST['docroot'], 'docroot');
 			if((int)$settings['system']['use_ssl'] == 1)
@@ -248,29 +245,17 @@ if($page == 'ipsandports'
 
 				$log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'");
 				inserttask('1');
-
-				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
-
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 		}
 		else
 		{
-			/*
 			$enable_ssl = makeyesno('ssl', '1', '0', '0');
 			$listen_statement = makeyesno('listen_statement', '1', '0', '1');
 			$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1');
 			$vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1');
 			$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1');
-			*/
-
-			$ipsandports_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_add.php';
-			$ipsandports_add_form = htmlform::genHTMLForm($ipsandports_add_data);
-
-			$title = $ipsandports_add_data['ipsandports_add']['title'];
-			$image = $ipsandports_add_data['ipsandports_add']['image'];
-
 			eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";");
 		}
 	}
@@ -288,23 +273,16 @@ if($page == 'ipsandports'
 				$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
 				$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");
 				$result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'");
-				$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
+				$listen_statement = intval($_POST['listen_statement']);
-				$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
+				$namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
-				$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
+				$vhostcontainer = intval($_POST['vhostcontainer']);
 				$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
-				$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
+				$vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
 				$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
 				$docroot =  validate($_POST['docroot'], 'docroot');
-
+				if((int)$settings['system']['use_ssl'] == 1)
-				if((int)$settings['system']['use_ssl'] == 1
+				{
-					/* 
+					$ssl = intval($_POST['ssl']);
-					 * check here if ssl is even checked, cause if not, we don't need
-					 * to validate and set all the $ssl_*_file vars
-					 */
-					&& isset($_POST['ssl'])
-					&& $_POST['ssl'] != 0
-				) {
-					$ssl = 1;
 					$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
 					$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
 					$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
@@ -406,30 +384,18 @@ if($page == 'ipsandports'
 
 					$log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'");
 					inserttask('1');
-
-					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
-
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
 			else
 			{
-				$result = htmlentities_array($result);
-				/*
 				$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
+				$result = htmlentities_array($result);
 				$listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']);
 				$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']);
 				$vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']);
 				$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']);
-				*/
-
-				$ipsandports_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_edit.php';
-				$ipsandports_edit_form = htmlform::genHTMLForm($ipsandports_edit_data);
-	
-				$title = $ipsandports_edit_data['ipsandports_edit']['title'];
-				$image = $ipsandports_edit_data['ipsandports_edit']['image'];
-
 				eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";");
 			}
 		}

admin_logger.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -22,17 +22,19 @@ define('AREA', 'admin');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-require('./lib/init.php');
 
-if ($page == 'log'
+require ("./lib/init.php");
-   && $userinfo['change_serversettings'] == '1'
+
-) {
+if($page == 'log'
-	if ($action == '') {
+   && $userinfo['change_serversettings'] == '1')
+{
+	if($action == '')
+	{
 		$fields = array(
+			'action' => $lng['logger']['action'],
 			'date' => $lng['logger']['date'],
 			'type' => $lng['logger']['type'],
-			'user' => $lng['logger']['user'],
+			'user' => $lng['logger']['user']
-			'text' => $lng['logger']['action']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$paging->sortfield = 'date';
@@ -45,21 +47,24 @@ if ($page == 'log'
 		$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
 		$clog = array();
 
-		while ($row = $db->fetch_array($result)) {
+		while($row = $db->fetch_array($result))
-			if (!isset($clog[$row['action']])
+		{
-			   || !is_array($clog[$row['action']])
+			if(!isset($clog[$row['action']])
-			) {
+			   || !is_array($clog[$row['action']]))
+			{
 				$clog[$row['action']] = array();
 			}
 
 			$clog[$row['action']][$row['logid']] = $row;
 		}
 
-		if ($paging->sortfield == 'date'
+		if($paging->sortfield == 'date'
-		   && $paging->sortorder == 'desc'
+		   && $paging->sortorder == 'desc')
-		) {
+		{
 			krsort($clog);
-		} else {
+		}
+		else
+		{
 			ksort($clog);
 		}
 
@@ -67,15 +72,20 @@ if ($page == 'log'
 		$count = 0;
 		$log_count = 0;
 		$log = '';
-		foreach ($clog as $action => $logrows) {
+		foreach($clog as $action => $logrows)
+		{
 			$_action = 0;
-			foreach ($logrows as $row) {
+			foreach($logrows as $row)
-				if ($paging->checkDisplay($i)) {
+			{
+				if($paging->checkDisplay($i))
+				{
 					$row = htmlentities_array($row);
 					$row['date'] = date("d.m.y H:i:s", $row['date']);
 
-					if ($_action != $action) {
+					if($_action != $action)
-						switch ($action) {
+					{
+						switch($action)
+						{
 							case USR_ACTION:
 								$_action = $lng['admin']['customer'];
 								break;
@@ -97,14 +107,15 @@ if ($page == 'log'
 						}
 
 						$row['action'] = $_action;
-						eval("\$log.=\"" . getTemplate('logger/logger_action') . "\";");
+						eval("\$log.=\"" . getTemplate("logger/logger_action") . "\";");
 					}
 
 					$log_count++;
 					$type = $row['type'];
 					$_type = 'unknown';
 
-					switch ($type) {
+					switch($type)
+					{
 						case LOG_INFO:
 							$_type = 'Information';
 							break;
@@ -126,28 +137,35 @@ if ($page == 'log'
 					}
 
 					$row['type'] = $_type;
-					eval("\$log.=\"" . getTemplate('logger/logger_log') . "\";");
+					eval("\$log.=\"" . getTemplate("logger/logger_log") . "\";");
 					$count++;
 					$_action = $action;
 				}
 			}
+
 			$i++;
 		}
 
-		eval("echo \"" . getTemplate('logger/logger') . "\";");
+		eval("echo \"" . getTemplate("logger/logger") . "\";");
-	} elseif ($action == 'truncate') {
+	}
-		if (isset($_POST['send'])
+	elseif($action == 'truncate')
-		   && $_POST['send'] == 'send'
+	{
-		) {
+		if(isset($_POST['send'])
+		   && $_POST['send'] == 'send')
+		{
 			$yesterday = time() - (60 * 10);
 
 			/* (60*60*24); */
 
 			$db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'");
-			$log->logAction(ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)');
+			$log->logAction(ADM_ACTION, LOG_WARNING, "truncated the system-log (mysql)");
 			redirectTo($filename, Array('page' => $page, 's' => $s));
-		} else {
+		}
+		else
+		{
 			ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG);
 		}
 	}
 }
+
+?>

admin_message.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -22,60 +22,79 @@ define('AREA', 'admin');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-require('./lib/init.php');
 
-if (isset($_POST['id'])) {
+require ("./lib/init.php");
+
+if(isset($_POST['id']))
+{
 	$id = intval($_POST['id']);
-} elseif (isset($_GET['id'])) {
+}
+elseif(isset($_GET['id']))
+{
 	$id = intval($_GET['id']);
 }
 
-if ($page == 'message') {
+if($page == 'message')
-	if ($action == '') {
+{
-		$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed panel_message');
+	if($action == '')
+	{
+		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed panel_message");
 
-		if (isset($_POST['send'])
+		if(isset($_POST['send'])
-		   && $_POST['send'] == 'send'
+		   && $_POST['send'] == 'send')
-		) {
+		{
-			if ($_POST['receipient'] == 0
+			if($_POST['receipient'] == 0
-			   && $userinfo['customers_see_all'] == '1'
+			   && $userinfo['customers_see_all'] == '1')
-			) {
+			{
-				$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to admins');
+				$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to admins");
 				$result = $db->query('SELECT `name`, `email`  FROM `' . TABLE_PANEL_ADMINS . "`");
-			} elseif ($_POST['receipient'] == 1) {
+			}
-				if ($userinfo['customers_see_all'] == '1') {
+			elseif($_POST['receipient'] == 1)
-					$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers');
+			{
+				if($userinfo['customers_see_all'] == "1")
+				{
+					$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to ALL customers");
 					$result = $db->query('SELECT `firstname`, `name`, `email`  FROM `' . TABLE_PANEL_CUSTOMERS . "`");
-				} else {
+				}
-					$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to customers');
+				else
+				{
+					$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to customers");
 					$result = $db->query('SELECT `firstname`, `name`, `email`  FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'");
 				}
-			} else {
+			}
+			else
+			{
 				standard_error('noreceipientsgiven');
 			}
 
 			$subject = $_POST['subject'];
 			$message = wordwrap($_POST['message'], 70);
 
-			if (!empty($message)) {
+			if(!empty($message))
+			{
 				$mailcounter = 0;
 				$mail->Body = $message;
 				$mail->Subject = $subject;
 
-				while ($row = $db->fetch_array($result)) {
+				while($row = $db->fetch_array($result))
+				{
 					$mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']);
 					$mail->From = $userinfo['email'];
 					$mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name'];
 
-					if (!$mail->Send()) {
+					if(!$mail->Send())
-						if ($mail->ErrorInfo != '') {
+					{
+						if($mail->ErrorInfo != '')
+						{
 							$mailerr_msg = $mail->ErrorInfo;
-						} else {
+						}
-							$mailerr_msg = $row['email'];
+						else
+						{
+							$mailerr_msg = $row["email"];
 						}
 
-						$log->logAction(ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg);
+						$log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
-						standard_error('errorsendingmail', $row['email']);
+						standard_error('errorsendingmail', $row["email"]);
 					}
 
 					$mailcounter++;
@@ -83,34 +102,47 @@ if ($page == 'message') {
 				}
 
 				redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter));
-			} else {
+			}
+			else
+			{
 				standard_error('nomessagetosend');
 			}
 		}
 	}
 
-	if ($action == 'showsuccess') {
+	if($action == 'showsuccess')
+	{
 		$success = 1;
 		$sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0;
 
-		if ($sentitems == 0) {
+		if($sentitems == 0)
+		{
 			$successmessage = $lng['message']['noreceipients'];
-		} else {
+		}
+		else
+		{
 			$successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
 		}
-	} else {
+
+		$action = '';
+	}
+	else
+	{
 		$success = 0;
 		$sentitems = 0;
 		$successmessage = '';
+		$action = '';
 	}
-	$action = '';
 
 	$receipients = '';
 
-	if ($userinfo['customers_see_all'] == '1') {
+	if($userinfo['customers_see_all'] == "1")
+	{
 		$receipients.= makeoption($lng['panel']['reseller'], 0);
 	}
 
-	$receipients .= makeoption($lng['panel']['customer'], 1);
+	$receipients.= makeoption($lng['panel']['customer'], 1);
-	eval("echo \"" . getTemplate('message/message') . "\";");
+	eval("echo \"" . getTemplate("message/message") . "\";");
 }
+
+?>

admin_phpsettings.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -25,58 +25,49 @@ define('AREA', 'admin');
 
 require ("./lib/init.php");
 
-if (isset($_POST['id'])) {
+if(isset($_POST['id']))
+{
 	$id = intval($_POST['id']);
-} elseif (isset($_GET['id'])) {
+}
+elseif(isset($_GET['id']))
+{
 	$id = intval($_GET['id']);
 }
 
-if ($page == 'overview') {
+if($page == 'overview')
-
+{
-	if ($action == '') {
+	if($action == '')
-
+	{
 		$tablecontent = '';
-		$count = 0;
 		$result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`");
 
-		while ($row = $db->fetch_array($result)) {
+		while($row = $db->fetch_array($result))
-
+		{
 			$domainresult = false;
 
-			$query = "SELECT * FROM `".TABLE_PANEL_DOMAINS."`
+			if((int)$userinfo['domains_see_all'] == 0)
-					WHERE `phpsettingid` = '".(int)$row['id']."'
+			{
-					AND `parentdomainid` = '0'";
+				$domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `adminid` = " . (int)$userinfo['userid'] . " AND `phpsettingid` = " . (int)$row['id']);
-
-			if ((int)$userinfo['domains_see_all'] == 0) {
-				$query .= " AND `adminid` = '".(int)$userinfo['userid']."'";
 			}
-
+			else
-			if ((int)$settings['panel']['phpconfigs_hidestdsubdomain'] == 1) {
+			{
-				$query2 = "SELECT DISTINCT `standardsubdomain`
+				$domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `phpsettingid` = " . (int)$row['id']);
-						FROM `".TABLE_PANEL_CUSTOMERS."`
-						WHERE `standardsubdomain` > 0 ORDER BY `standardsubdomain` ASC;";
-				$ssdids_res = $db->query($query2);
-				$ssdids = array();
-				while ($ssd = $db->fetch_array($ssdids_res)) {
-					$ssdids[] = $ssd['standardsubdomain'];
-				}
-				if (count($ssdids) > 0) {
-					$query .= " AND `id` NOT IN (".implode(', ', $ssdids).")";
-				}
 			}
 
-			$domainresult = $db->query($query);
-
 			$domains = '';
-			if ($db->num_rows($domainresult) > 0) {
+
-				while ($row2 = $db->fetch_array($domainresult)) {
+			if($db->num_rows($domainresult) > 0)
+			{
+				while($row2 = $db->fetch_array($domainresult))
+				{
 					$domains.= $row2['domain'] . '<br/>';
 				}
-			} else {
+			}
+			else
+			{
 				$domains = $lng['admin']['phpsettings']['notused'];
 			}
 
-			$count ++;
 			eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";");
 		}
 
@@ -112,13 +103,6 @@ if ($page == 'overview') {
 			else
 			{
 				$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1");
-
-				$phpconfig_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_add.php';
-				$phpconfig_add_form = htmlform::genHTMLForm($phpconfig_add_data);
-
-				$title = $phpconfig_add_data['phpconfig_add']['title'];
-				$image = $phpconfig_add_data['phpconfig_add']['image'];
-
 				eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";");
 			}
 		}
@@ -188,12 +172,6 @@ if ($page == 'overview') {
 			}
 			else
 			{
-				$phpconfig_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_edit.php';
-				$phpconfig_edit_form = htmlform::genHTMLForm($phpconfig_edit_data);
-
-				$title = $phpconfig_edit_data['phpconfig_edit']['title'];
-				$image = $phpconfig_edit_data['phpconfig_edit']['image'];
-
 				eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";");
 			}
 		}

admin_settings.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -65,11 +65,6 @@ if(($page == 'settings' || $page == 'overview')
 			$only_enabledisable = true;
 		}
 		
-		// check if the session timeout is too low #815
-		if (isset($_POST['session_sessiontimeout']) && $_POST['session_sessiontimeout'] <= 60) {
-			standard_error($lng['error']['session_timeout'], $lng['error']['session_timeout_desc']);
-		}
-
 		if(processFormEx(
 			$settings_data, 
 			$_POST, 
@@ -80,11 +75,6 @@ if(($page == 'settings' || $page == 'overview')
 			$only_enabledisable
 			)
 		) {
-			$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
-			inserttask('1');
-			// Using nameserver, insert a task which rebuilds the server config
-			inserttask('4');
-
 			standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page));
 		}
 	}
@@ -123,11 +113,9 @@ elseif($page == 'rebuildconfigs'
 	{
 		$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles");
 		inserttask('1');
-		inserttask('10');
-		// Using nameserver, insert a task which rebuilds the server config
 		inserttask('4');
-
+		inserttask('5');
-		standard_success('rebuildingconfigs', '', array('filename' => 'admin_index.php'));
+		redirectTo('admin_index.php', array('s' => $s));
 	}
 	else
 	{

admin_templates.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -48,28 +48,16 @@ elseif(isset($_GET['id']))
 $available_templates = array(
 	'createcustomer',
 	'pop_success',
+	'trafficninetypercent',
+	'new_ticket_by_customer',
+	'new_ticket_for_customer',
+	'new_ticket_by_staff',
+	'new_reply_ticket_by_customer',
+	'new_reply_ticket_by_staff',
 	'new_database_by_customer',
 	'new_ftpaccount_by_customer',
 	'password_reset'
 );
-
-// only show templates of features that are enabled #1191
-if ((int)$settings['system']['report_enable'] == 1) {
-	array_push($available_templates,
-		'trafficmaxpercent',
-		'diskmaxpercent'
-	);
-}
-if ((int)$settings['ticket']['enabled'] == 1) {
-	array_push($available_templates,
-		'new_ticket_by_customer',
-		'new_ticket_for_customer',
-		'new_ticket_by_staff',
-		'new_reply_ticket_by_customer',
-		'new_reply_ticket_by_staff'
-	);
-}
-
 $file_templates = array(
 	'index_html'
 );
@@ -163,7 +151,7 @@ elseif($action == 'delete'
 		}
 	}
 }
-elseif($action == 'deletef'
+elseif($action == 'delete'
        && $id != 0)
 {
 	//file templates
@@ -220,12 +208,6 @@ elseif($action == 'add')
 			$template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true);
 		}
 
-		$template_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_add.php';
-		$template_add_form = htmlform::genHTMLForm($template_add_data);
-
-		$title = $template_add_data['template_add']['title'];
-		$image = $template_add_data['template_add']['image'];
-
 		eval("echo \"" . getTemplate("templates/templates_add_2") . "\";");
 	}
 	elseif(isset($_POST['send'])
@@ -329,12 +311,6 @@ elseif($action == 'add')
 				$free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true);
 			}
 
-			$filetemplate_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_add.php';
-			$filetemplate_add_form = htmlform::genHTMLForm($filetemplate_add_data);
-
-			$title = $filetemplate_add_data['filetemplate_add']['title'];
-			$image = $filetemplate_add_data['filetemplate_add']['image'];
-
 			eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";");
 		}
 	}
@@ -367,18 +343,11 @@ elseif($action == 'edit'
 			$result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'");
 			$result = htmlentities_array($result);
 			$mailbody = $result['value'];
-
-			$template_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_edit.php';
-			$template_edit_form = htmlform::genHTMLForm($template_edit_data);
-
-			$title = $template_edit_data['template_edit']['title'];
-			$image = $template_edit_data['template_edit']['image'];
-
 			eval("echo \"" . getTemplate("templates/templates_edit") . "\";");
 		}
 	}
 }
-elseif($action == 'editf'
+elseif($action == 'edit'
        && $id != 0)
 {
 	//file templates
@@ -402,13 +371,6 @@ elseif($action == 'editf'
 		else
 		{
 			$row = htmlentities_array($row);
-
-			$filetemplate_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_edit.php';
-			$filetemplate_edit_form = htmlform::genHTMLForm($filetemplate_edit_data);
-
-			$title = $filetemplate_edit_data['filetemplate_edit']['title'];
-			$image = $filetemplate_edit_data['filetemplate_edit']['image'];
-
 			eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";");
 		}
 	}
@@ -418,3 +380,5 @@ elseif($action == 'editf'
 		exit;
 	}
 }
+
+?>

admin_tickets.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
@@ -32,22 +32,6 @@ if(isset($_POST['id']))
 elseif(isset($_GET['id']))
 {
 	$id = intval($_GET['id']);
-
-	// only check if this is not a category-id
-	if (!isset($_GET['page']) || (isset($_GET['page']) && $_GET['page'] != 'categories')) {
-		if (!$userinfo['customers_see_all']) {
-			/*
-			 * Check if the current user is allowed to see the current ticket.
-			 */
-			$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `adminid` = '".$userinfo['admindid']."'";
-
-			$result = $db->query_first($sql);
-			if ($result == null) {
-				// no rights to see the requested ticket
-				standard_error(array('ticketnotaccessible'));
-			}
-		}
-	}
 }
 
 if($page == 'tickets'
@@ -118,20 +102,16 @@ if($page == 'tickets'
 					if($_cid != $row['customerid'])
 					{
 						$cid = $row['customerid'];
-						$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						$usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
                                      WHERE `customerid` = "' . (int)$cid . '"');
 						
-						if(isset($usr['loginname']))
+						if(isset($usr['loginname'])) {
-						{
+							$customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
-							$customer = getCorrectFullUserDetails($usr);
+							//$customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
-							$customerloginname =  $usr['loginname'];
+						} else {
-							$customerid = $usr['customerid'];
-						}
-						else
-						{
 							$customer = $lng['ticket']['nonexistingcustomer'];
 						}
-						eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
+						eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
 					}
 
 					$tickets_count++;
@@ -166,7 +146,7 @@ if($page == 'tickets'
 						$row['subject'] = substr($row['subject'], 0, 17) . '...';
 					}
 
-					eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";");
+					eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
 					$count++;
 					$_cid = $row['customerid'];
 				}
@@ -175,7 +155,7 @@ if($page == 'tickets'
 			$i++;
 		}
 
-		eval("echo \"" . getTemplate("tickets/tickets") . "\";");
+		eval("echo \"" . getTemplate("ticket/tickets") . "\";");
 	}
 	elseif($action == 'new')
 	{
@@ -190,7 +170,7 @@ if($page == 'tickets'
 				$newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
 				$newticket->Set('category', validate($_POST['category'], 'category'), true, false);
 				$newticket->Set('customer', (int)$_POST['customer'], true, false);
-				$newticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false);
+				$newticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
 
 				if($newticket->Get('subject') == null)
 				{
@@ -219,16 +199,12 @@ if($page == 'tickets'
 			else
 			{
 				$categories = '';
-				$where = '';
+				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
-				if ($userinfo['tickets_see_all'] != '1') {
-					$where = 'WHERE `adminid` = "' . $userinfo['adminid'] . '"';
-				}
-				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');
 
 				if(isset($result['name'])
 				   && $result['name'] != '')
 				{
-					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');
+					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
 
 					while($row = $db->fetch_array($result2))
 					{
@@ -248,17 +224,10 @@ if($page == 'tickets'
 					$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
 				}
 
-				$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']);
+				$priorities = makeoption($lng['ticket']['unf_high'], '1', $settings['ticket']['default_priority']);
-				$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['unf_normal'], '2', $settings['ticket']['default_priority']);
-				$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['unf_low'], '3', $settings['ticket']['default_priority']);
-
+				eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
-				$ticket_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_new.php';
-				$ticket_new_form = htmlform::genHTMLForm($ticket_new_data);
-
-				$title = $ticket_new_data['ticket_new']['title'];
-				$image = $ticket_new_data['ticket_new']['image'];
-
-				eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
 			}
 		}
 		else
@@ -275,7 +244,7 @@ if($page == 'tickets'
 			$replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1);
 			$replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
 			$replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
-			$replyticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false);
+			$replyticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
 
 			if($replyticket->Get('message') == null)
 			{
@@ -326,25 +295,18 @@ if($page == 'tickets'
 				$isclosed = 1;
 			}
 
-			if ($mainticket->Get('by') == '1')
+			if($mainticket->Get('by') == '1')
 			{
 				$by = $lng['ticket']['staff'];
 			}
 			else
 			{
-				$cid = $mainticket->Get('customer');
+				$by = $lng['ticket']['customer'];
-				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
-						FROM `' . TABLE_PANEL_CUSTOMERS . '`
-						WHERE `customerid` = "' . (int)$cid . '"'
-				);
-				$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
-				$by .= getCorrectFullUserDetails($usr).'</a>';
-				//$by = $lng['ticket']['customer'];
 			}
 
 			$subject = $mainticket->Get('subject');
 			$message = $mainticket->Get('message');
-			eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
+			eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
 			$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
                                 WHERE `id`="' . (int)$mainticket->Get('category') . '"');
 			$row = $db->fetch_array($result);
@@ -361,19 +323,12 @@ if($page == 'tickets'
 				}
 				else
 				{
-					$cid = $subticket->Get('customer');
+					$by = $lng['ticket']['customer'];
-					$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
-						FROM `' . TABLE_PANEL_CUSTOMERS . '`
-						WHERE `customerid` = "' . (int)$cid . '"'
-					);
-					$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
-					$by .= getCorrectFullUserDetails($usr).'</a>';
-					//$by = $lng['ticket']['customer'];
 				}
 
 				$subject = $subticket->Get('subject');
 				$message = $subticket->Get('message');
-				eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
+				eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
 			}
 
 			$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -383,13 +338,8 @@ if($page == 'tickets'
 			$ticket_replies_count = $db->num_rows($andere) + 1;
 
 			// don't forget the main-ticket!
-			$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_reply.php';
-			$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
 
-			$title = $ticket_reply_data['ticket_reply']['title'];
+			eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
-			$image = $ticket_reply_data['ticket_reply']['image'];
-
-			eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
 		}
 	}
 	elseif($action == 'close'
@@ -475,16 +425,11 @@ elseif($page == 'categories'
 			'name' => $lng['ticket']['category'],
 			'logicalorder' => $lng['ticket']['logicalorder']
 		);
-
-		$where = '1'; // WHERE 1 is like no 'where-clause'
-		if ($userinfo['tickets_see_all'] != '1') {
-			$where = " `main`.`adminid` = '" . (int)$userinfo['adminid'] . "'";
-		}
 		$paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, (
                               SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub`
                               WHERE `sub`.`category` = `main`.`id`
-                              AND `sub`.`answerto` = '0'  AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
+                              AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
                               as `ticketcount`, (
                               SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2`
                               WHERE `sub2`.`category` = `main`.`id`
@@ -492,7 +437,7 @@ elseif($page == 'categories'
                               AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2')
                               AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "'
                               ) as `ticketcountnotclosed`
-                              FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE " . $where . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+                              FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE `main`.`adminid` = '" . (int)$userinfo['adminid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -509,14 +454,14 @@ elseif($page == 'categories'
 			{
 				$row = htmlentities_array($row);
 				$closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']);
-				eval("\$ticketcategories.=\"" . getTemplate("tickets/tickets_categories") . "\";");
+				eval("\$ticketcategories.=\"" . getTemplate("ticket/tickets_categories") . "\";");
 				$count++;
 			}
 
 			$i++;
 		}
 
-		eval("echo \"" . getTemplate("tickets/categories") . "\";");
+		eval("echo \"" . getTemplate("ticket/categories") . "\";");
 	}
 	elseif($action == 'addcategory')
 	{
@@ -529,7 +474,7 @@ elseif($page == 'categories'
 			if($order < 1 || $order >= 1000)
 			{
 				// use the latest available
-				$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1;
+				$order = ticket::getHighestOrderNumber($db) + 1;
 			}
 
 			if($category == '')
@@ -545,15 +490,8 @@ elseif($page == 'categories'
 		}
 		else
 		{
-			$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1;
+			$order = ticket::getHighestOrderNumber($db) + 1;
-
+			eval("echo \"" . getTemplate("ticket/tickets_newcategory") . "\";");
-			$category_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_new.php';
-			$category_new_form = htmlform::genHTMLForm($category_new_data);
-
-			$title = $category_new_data['category_new']['title'];
-			$image = $category_new_data['category_new']['image'];
-
-			eval("echo \"" . getTemplate("tickets/tickets_newcategory") . "\";");
 		}
 	}
 	elseif($action == 'editcategory'
@@ -584,14 +522,7 @@ elseif($page == 'categories'
 		else
 		{
 			$row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"');
-
+			eval("echo \"" . getTemplate("ticket/tickets_editcategory") . "\";");
-			$category_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_edit.php';
-			$category_edit_form = htmlform::genHTMLForm($category_edit_data);
-
-			$title = $category_edit_data['category_edit']['title'];
-			$image = $category_edit_data['category_edit']['image'];
-
-			eval("echo \"" . getTemplate("tickets/tickets_editcategory") . "\";");
 		}
 	}
 	elseif($action == 'deletecategory'
@@ -640,7 +571,8 @@ elseif($page == 'archive'
 			{
 				$categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : '';
 			}
-			$query = ticket::getArchiveSearchStatement($db, $subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
+
+			$query = ticket::getArchiveSearchStatement($subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
 			$fields = array(
 				'lastchange' => $lng['ticket']['lastchange'],
 				'ticket_answers' => $lng['ticket']['ticket_answers'],
@@ -698,39 +630,25 @@ elseif($page == 'archive'
 				{
 					if($paging->checkDisplay($i))
 					{
+						$ticket = htmlentities_array($ticket);
 						$ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']);
 
 						if($_cid != $ticket['customerid'])
 						{
 							$cid = $ticket['customerid'];
-							$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
+							$usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
                                        WHERE `customerid` = "' . (int)$cid . '"');
 							
-							if(isset($usr['loginname']))
+							if(isset($usr['loginname'])) {
-							{
+								$customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
-								$customer = getCorrectFullUserDetails($usr);
+							} else {
-								$customerloginname =  $usr['loginname'];
-								$customerid = $usr['customerid'];
-							}
-							else
-							{
 								$customer = $lng['ticket']['nonexistingcustomer'];
 							}
 							
-							eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
+							eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
 						}
 
 						$tickets_count++;
-						switch ($ticket['priority'])
-						{
-							case 1: $ticket['display'] = 'high';
-							break;
-							case 2: $ticket['display'] = 'normal';
-							break;
-							case 3: $ticket['display'] = 'low';
-							break;
-							default: $ticket['display'] = 'unknown';
-						}
 						$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);
 
 						if($ticket['lastreplier'] == '1')
@@ -746,8 +664,8 @@ elseif($page == 'archive'
 						{
 							$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
 						}
-						$ticket = htmlentities_array($ticket);
+
-						eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";");
+						eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
 						$count++;
 						$_cid = $ticket['customerid'];
 					}
@@ -756,7 +674,7 @@ elseif($page == 'archive'
 				$i++;
 			}
 
-			eval("echo \"" . getTemplate("tickets/archivesearch") . "\";");
+			eval("echo \"" . getTemplate("ticket/archivesearch") . "\";");
 		}
 		else
 		{
@@ -785,13 +703,13 @@ elseif($page == 'archive'
 						$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
 					}
 
-					eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";");
+					eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
 				}
 			}
 
-			$priorities_options = makecheckbox('priority1', $lng['ticket']['high'], '1');
+			$priorities_options = makecheckbox('priority1', $lng['ticket']['unf_high'], '1');
-			$priorities_options.= makecheckbox('priority2', $lng['ticket']['normal'], '2');
+			$priorities_options.= makecheckbox('priority2', $lng['ticket']['unf_normal'], '2');
-			$priorities_options.= makecheckbox('priority3', $lng['ticket']['low'], '3');
+			$priorities_options.= makecheckbox('priority3', $lng['ticket']['unf_low'], '3');
 			$category_options = '';
 			$ccount = 0;
 			$result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
@@ -810,7 +728,7 @@ elseif($page == 'archive'
 				$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
 			}
 
-			eval("echo \"" . getTemplate("tickets/archive") . "\";");
+			eval("echo \"" . getTemplate("ticket/archive") . "\";");
 		}
 	}
 	elseif($action == 'view'
@@ -830,19 +748,12 @@ elseif($page == 'archive'
 		}
 		else
 		{
-			$cid = $mainticket->Get('customer');
+			$by = $lng['ticket']['customer'];
-			$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
-						FROM `' . TABLE_PANEL_CUSTOMERS . '`
-						WHERE `customerid` = "' . (int)$cid . '"'
-			);
-			$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
-			$by .= getCorrectFullUserDetails($usr).'</a>';
-			//$by = $lng['ticket']['customer'];
 		}
 
 		$subject = $mainticket->Get('subject');
 		$message = $mainticket->Get('message');
-		eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
+		eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
 		$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
                               WHERE `id`="' . (int)$mainticket->Get('category') . '"');
 		$row = $db->fetch_array($result);
@@ -859,29 +770,23 @@ elseif($page == 'archive'
 			}
 			else
 			{
-				$cid = $subticket->Get('customer');
+				$by = $lng['ticket']['customer'];
-				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
-						FROM `' . TABLE_PANEL_CUSTOMERS . '`
-						WHERE `customerid` = "' . (int)$cid . '"'
-				);
-				$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
-				$by .= getCorrectFullUserDetails($usr).'</a>';
-				//$by = $lng['ticket']['customer'];
 			}
 
 			$subject = $subticket->Get('subject');
 			$message = $subticket->Get('message');
-			eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
+			eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
 		}
 
-		$priorities = makeoption($lng['ticket']['high'], '1', htmlentities($mainticket->Get('priority')), true, true);
+		$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
-		$priorities.= makeoption($lng['ticket']['normal'], '2', htmlentities($mainticket->Get('priority')), true, true);
+		$priorities.= makeoption($lng['ticket']['normal'], '2', $mainticket->Get('priority'), true, true);
-		$priorities.= makeoption($lng['ticket']['low'], '3', htmlentities($mainticket->Get('priority')), true, true);
+		$priorities.= makeoption($lng['ticket']['low'], '3', $mainticket->Get('priority'), true, true);
 		$subject = $mainticket->Get('subject');
 		$ticket_replies_count = $db->num_rows($andere) + 1;
 
 		// don't forget the main-ticket!
-		eval("echo \"" . getTemplate("tickets/tickets_view") . "\";");
+
+		eval("echo \"" . getTemplate("ticket/tickets_view") . "\";");
 	}
 	elseif($action == 'delete'
 	       && $id != 0)
@@ -900,6 +805,6 @@ elseif($page == 'archive'
 			ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
 		}
 	}
-} else {
-	standard_error('nocustomerforticket');
 }
+
+?>

admin_traffic.php

@@ -1,148 +0,0 @@
-<?php
-
-/**
- * This file is part of the Froxlor project.
- * Copyright (c) 2003-2009 the SysCP Team (see authors).
- * Copyright (c) 2010 the Froxlor Team (see authors).
- *
- * For the full copyright and license information, please view the COPYING
- * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
- *
- * @copyright  (c) the authors
- * @author     Morton Jonuschat <m.jonuschat@chrome-it.de>
- * @license    GPLv2 http://files.syscp.org/misc/COPYING.txt
- * @package    Panel
- *
- */
-
-define('AREA', 'admin');
-
-/**
- * Include our init.php, which manages Sessions, Language etc.
- */
-
-require ("./lib/init.php");
-
-if($action == 'logout')
-{
-	$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['adminid'] . "' AND `adminsession` = '1'");
-	redirectTo('index.php');
-	exit;
-}
-
-if(isset($_POST['id']))
-{
-	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
-	$id = intval($_GET['id']);
-}
-
-$months = array(
-	'0' => 'empty',
-	'1' => 'jan',
-	'2' => 'feb',
-	'3' => 'mar',
-	'4' => 'apr',
-	'5' => 'may',
-	'6' => 'jun',
-	'7' => 'jul',
-	'8' => 'aug',
-	'9' => 'sep',
-	'10' => 'oct',
-	'11' => 'nov',
-	'12' => 'dec',
-);
-
-if($page == 'overview' || $page == 'customers') 
-{
-	if($action == 'su' && $id != 0)
-	{
-		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$id . "' " . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' "));
-
-		if($result['loginname'] != '')
-		{
-			$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "'");
-			$s = md5(uniqid(microtime(), 1));
-			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
-			redirectTo('customer_traffic.php', Array(
-				's' => $s
-			));
-		}
-		else
-		{
-			redirectTo('index.php', Array(
-				'action' => 'login'
-			));
-		}
-	}
-	$customerview = 1;
-	$stats_tables = '';
-	$minyear = $db->query_first("SELECT `year` FROM `". TABLE_PANEL_TRAFFIC . "` ORDER BY `year` ASC LIMIT 1");
-	if (!isset($minyear['year']) || $minyear['year'] == 0)
-	{
-		$maxyears = 0;
-	}
-	else
-	{
-		$maxyears = date("Y") - $minyear['year'];
-	}
-	for($years = 0; $years<=$maxyears; $years++) {
-		$overview['year'] = date("Y")-$years;
-		$overview['type'] = $lng['traffic']['customer'];
-		$domain_list = '';
-		$customer_name_list = $db->query("SELECT `customerid`,`company`,`name`,`firstname` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' ") . " ORDER BY name");
-		$totals = array(
-			'jan' => 0,
-			'feb' => 0,
-			'mar' => 0,
-			'apr' => 0,
-			'may' => 0,
-			'jun' => 0,
-			'jul' => 0,
-			'aug' => 0,
-			'sep' => 0,
-			'oct' => 0,
-			'nov' => 0,
-			'dec' => 0,
-		);
-		while($customer_name = $db->fetch_array($customer_name_list)) {
-			$virtual_host = array(
-				'name' => ($customer_name['company'] == '' ? $customer_name['name'] . ", " . $customer_name['firstname'] : $customer_name['company']),
-				'customerid' => $customer_name['customerid'],
-				'jan' => '-',
-				'feb' => '-',
-				'mar' => '-',
-				'apr' => '-',
-				'may' => '-',
-				'jun' => '-',
-				'jul' => '-',
-				'aug' => '-',
-				'sep' => '-',
-				'oct' => '-',
-				'nov' => '-',
-				'dec' => '-',
-			);
-			
-			$traffic_list = $db->query("SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE year = " . (date("Y")-$years) . " AND `customerid` = '" . $customer_name['customerid'] . "' GROUP BY month ORDER BY month");
-			while($traffic_month = $db->fetch_array($traffic_list)) {
-				$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s');
-				$totals[$months[(int)$traffic_month['month']]] += $traffic_month['traffic'];
-			}
-			eval("\$domain_list .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
-		}
-		// sum up totals
-		$virtual_host = array(
-			'name' => $lng['traffic']['months']['total'],
-		);
-		foreach($totals as $month => $bytes) {
-			$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s'));
-		}
-		$customerview = 0;
-		eval("\$total_list = sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
-		eval("\$stats_tables .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table") . "\");");
-	}
-	eval("echo \"" . getTemplate("traffic/index") . "\";");
-}

admin_updates.php

@@ -12,13 +12,14 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'admin');
-require('./lib/init.php');
+require ("./lib/init.php");
 
-if ($page == 'overview') {
+if($page == 'overview')
+{
 	$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates");
 
 	/**
@@ -28,13 +29,13 @@ if ($page == 'overview') {
 	 */
 	if (!isFroxlor()) {
 		if (!isset($settings['panel']['version'])
-			|| $settings['panel']['version'] == ''
+		|| $settings['panel']['version'] == ''
 		) {
 			$settings['panel']['version'] = '1.4.2.1';
 			$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')");
 		}
 		if (!isset($settings['system']['dbversion'])
-			|| $settings['system']['dbversion'] == ''
+		|| $settings['system']['dbversion'] == ''
 		) {
 			/**
 			 * for syscp-stable (1.4.2.1) this value has to be 0
@@ -42,9 +43,11 @@ if ($page == 'overview') {
 			 * and the svn-version has its value in the database
 			 * -> bug #54
 			 */
+			
 			$result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'");
 			
-			if (isset($result['value'])) {
+			if(isset($result['value']))
+			{
 				$settings['system']['dbversion'] = (int)$result['value'];
 			} else {
 				$settings['system']['dbversion'] = 0;
@@ -52,36 +55,40 @@ if ($page == 'overview') {
 		}
 	}
 
-	if (hasUpdates($version)) {
+	if(hasUpdates($version))
+	{
 		$successful_update = false;
 		$message = '';
 
-		if (isset($_POST['send'])
+		if(isset($_POST['send'])
-			&& $_POST['send'] == 'send'
+		&& $_POST['send'] == 'send')
-		) {
+		{
-			if ((isset($_POST['update_preconfig'])
+			if((isset($_POST['update_preconfig'])
 				&& isset($_POST['update_changesagreed'])
 				&& intval($_POST['update_changesagreed']) != 0)
 				|| !isset($_POST['update_preconfig'])
 			) {
-				eval("echo \"" . getTemplate('update/update_start') . "\";");
+				eval("echo \"" . getTemplate("update/update_start") . "\";");
 	
 				include_once './install/updatesql.php';
 	
 				$redirect_url = 'admin_index.php?s=' . $s;
-				eval("echo \"" . getTemplate('update/update_end') . "\";");
+				eval("echo \"" . getTemplate("update/update_end") . "\";");
 	
 				updateCounters();
 				inserttask('1');
 				@chmod('./lib/userdata.inc.php', 0440);
 				
 				$successful_update = true;
-			} else {
+			}
-				$message = '<br /><strong style="color: red">You have to agree that you have read the update notifications.</strong>';
+			else
+			{
+				$message = '<br /><strong style="color:#ff0000;">You have to agree that you have read the update notifications.</strong>';
 			}
 		}
 
-		if (!$successful_update) {
+		if(!$successful_update)
+		{
 			$current_version = $settings['panel']['version'];
 			$new_version = $version;
 
@@ -92,20 +99,26 @@ if ($page == 'overview') {
 			
 			include_once './install/updates/preconfig.php';
 			$preconfig = getPreConfig($current_version);
-			if ($preconfig != '') {
+			if($preconfig != '')
-				$update_information .= '<br />' . $preconfig . $message;
+			{
+				$update_information .= '<br />'.$preconfig.$message;
 			}
 			
 			$update_information .= $lng['update']['update_information']['part_b'];
 
-			eval("echo \"" . getTemplate('update/index') . "\";");
+			eval("echo \"" . getTemplate("update/index") . "\";");
 		}
-	} else {
+	}
+	else
+	{
 		/*
 		 * @TODO version-webcheck check here
 		 */
+
 		$success_message = $lng['update']['noupdatesavail'];
 		$redirect_url = 'admin_index.php?s=' . $s;
-		eval("echo \"" . getTemplate('update/noupdatesavail') . "\";");
+		eval("echo \"" . getTemplate("update/noupdatesavail") . "\";");
 	}
 }
+
+?>

cache/.gitignore

@@ -1 +0,0 @@
-*

css/jquery.jqplot.css

@@ -1,226 +0,0 @@
-/*rules for the plot target div.  These will be cascaded down to all plot elements according to css rules*/
-.jqplot-target {
-    position: relative;
-    color: #666666;
-    font-family: "Trebuchet MS", Arial, Helvetica, sans-serif;
-    font-size: 1em;
-/*    height: 300px;
-    width: 400px;*/
-}
-
-/*rules applied to all axes*/
-.jqplot-axis {
-    font-size: 0.75em;
-}
-
-.jqplot-xaxis {
-    margin-top: 10px;
-}
-
-.jqplot-x2axis {
-    margin-bottom: 10px;
-}
-
-.jqplot-yaxis {
-    margin-right: 10px;
-}
-
-.jqplot-y2axis, .jqplot-y3axis, .jqplot-y4axis, .jqplot-y5axis, .jqplot-y6axis, .jqplot-y7axis, .jqplot-y8axis, .jqplot-y9axis {
-    margin-left: 10px;
-    margin-right: 10px;
-}
-
-/*rules applied to all axis tick divs*/
-.jqplot-axis-tick, .jqplot-xaxis-tick, .jqplot-yaxis-tick, .jqplot-x2axis-tick, .jqplot-y2axis-tick, .jqplot-y3axis-tick, .jqplot-y4axis-tick, .jqplot-y5axis-tick, .jqplot-y6axis-tick, .jqplot-y7axis-tick, .jqplot-y8axis-tick, .jqplot-y9axis-tick {
-    position: absolute;
-}
-
-
-.jqplot-xaxis-tick {
-    top: 0px;
-    /* initial position untill tick is drawn in proper place */
-    left: 15px;
-/*    padding-top: 10px;*/
-    vertical-align: top;
-}
-
-.jqplot-x2axis-tick {
-    bottom: 0px;
-    /* initial position untill tick is drawn in proper place */
-    left: 15px;
-/*    padding-bottom: 10px;*/
-    vertical-align: bottom;
-}
-
-.jqplot-yaxis-tick {
-    right: 0px;
-    /* initial position untill tick is drawn in proper place */
-    top: 15px;
-/*    padding-right: 10px;*/
-    text-align: right;
-}
-
-.jqplot-yaxis-tick.jqplot-breakTick {
-	right: -20px;
-	margin-right: 0px;
-	padding:1px 5px 1px 5px;
-/*	background-color: white;*/
-	z-index: 2;
-	font-size: 1.5em;
-}
-
-.jqplot-y2axis-tick, .jqplot-y3axis-tick, .jqplot-y4axis-tick, .jqplot-y5axis-tick, .jqplot-y6axis-tick, .jqplot-y7axis-tick, .jqplot-y8axis-tick, .jqplot-y9axis-tick {
-    left: 0px;
-    /* initial position untill tick is drawn in proper place */
-    top: 15px;
-/*    padding-left: 10px;*/
-/*    padding-right: 15px;*/
-    text-align: left;
-}
-
-.jqplot-meterGauge-tick {
-    font-size: 0.75em;
-    color: #999999;
-}
-
-.jqplot-meterGauge-label {
-    font-size: 1em;
-    color: #999999;
-}
-.jqplot-xaxis-label {
-    margin-top: 10px;
-    font-size: 11pt;
-    position: absolute;
-}
-
-.jqplot-x2axis-label {
-    margin-bottom: 10px;
-    font-size: 11pt;
-    position: absolute;
-}
-
-.jqplot-yaxis-label {
-    margin-right: 10px;
-/*    text-align: center;*/
-    font-size: 11pt;
-    position: absolute;
-}
-
-.jqplot-y2axis-label, .jqplot-y3axis-label, .jqplot-y4axis-label, .jqplot-y5axis-label, .jqplot-y6axis-label, .jqplot-y7axis-label, .jqplot-y8axis-label, .jqplot-y9axis-label {
-/*    text-align: center;*/
-    font-size: 11pt;
-    position: absolute;
-}
-
-table.jqplot-table-legend {
-    margin-top: 12px;
-    margin-bottom: 12px;
-    margin-left: 12px;
-    margin-right: 12px;
-}
-
-table.jqplot-table-legend, table.jqplot-cursor-legend {
-    background-color: rgba(255,255,255,0.6);
-    border: 1px solid #cccccc;
-    position: absolute;
-    font-size: 0.75em;
-}
-
-td.jqplot-table-legend {
-    vertical-align:middle;
-}
-
-td.jqplot-seriesToggle:hover, td.jqplot-seriesToggle:active {
-    cursor: pointer;
-}
-
-td.jqplot-table-legend > div {
-    border: 1px solid #cccccc;
-    padding:1px;
-}
-
-div.jqplot-table-legend-swatch {
-    width:0px;
-    height:0px;
-    border-top-width: 5px;
-    border-bottom-width: 5px;
-    border-left-width: 6px;
-    border-right-width: 6px;
-    border-top-style: solid;
-    border-bottom-style: solid;
-    border-left-style: solid;
-    border-right-style: solid;
-}
-
-.jqplot-title {
-    top: 0px;
-    left: 0px;
-    padding-bottom: 0.5em;
-    font-size: 1.2em;
-}
-
-table.jqplot-cursor-tooltip {
-    border: 1px solid #cccccc;
-    font-size: 0.75em;
-}
-
-
-.jqplot-cursor-tooltip {
-    border: 1px solid #cccccc;
-    font-size: 0.75em;
-    white-space: nowrap;
-    background: rgba(208,208,208,0.5);
-    padding: 1px;
-}
-
-.jqplot-highlighter-tooltip {
-    border: 1px solid #cccccc;
-    font-size: 0.75em;
-    white-space: nowrap;
-    background: rgba(208,208,208,0.5);
-    padding: 1px;
-}
-
-.jqplot-point-label {
-    font-size: 0.75em;
-    z-index: 2;
-}
-      
-td.jqplot-cursor-legend-swatch {
-vertical-align:middle;
-text-align:center;
-}
-
-div.jqplot-cursor-legend-swatch {
-width:1.2em;
-height:0.7em;
-}
-
-.jqplot-error {
-/*   Styles added to the plot target container when there is an error go here.*/
-    text-align: center;
-}
-
-.jqplot-error-message {
-/*    Styling of the custom error message div goes here.*/
-    position: relative;
-    top: 46%;
-    display: inline-block;
-}
-
-div.jqplot-bubble-label {
-    font-size: 0.8em;
-/*    background: rgba(90%, 90%, 90%, 0.15);*/
-    padding-left: 2px;
-    padding-right: 2px;
-    color: rgb(20%, 20%, 20%);
-}
-
-div.jqplot-bubble-label.jqplot-bubble-label-highlight {
-    background: rgba(90%, 90%, 90%, 0.7);
-}
-
-div.jqplot-noData-container {
-	text-align: center;
-	background-color: rgba(96%, 96%, 96%, 0.3);
-}

css/jquery.jqplot.min.css

@@ -1 +0,0 @@
-.jqplot-target{position:relative;color:#666;font-family:"Trebuchet MS",Arial,Helvetica,sans-serif;font-size:1em;}.jqplot-axis{font-size:.75em;}.jqplot-xaxis{margin-top:10px;}.jqplot-x2axis{margin-bottom:10px;}.jqplot-yaxis{margin-right:10px;}.jqplot-y2axis,.jqplot-y3axis,.jqplot-y4axis,.jqplot-y5axis,.jqplot-y6axis,.jqplot-y7axis,.jqplot-y8axis,.jqplot-y9axis{margin-left:10px;margin-right:10px;}.jqplot-axis-tick,.jqplot-xaxis-tick,.jqplot-yaxis-tick,.jqplot-x2axis-tick,.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{position:absolute;}.jqplot-xaxis-tick{top:0;left:15px;vertical-align:top;}.jqplot-x2axis-tick{bottom:0;left:15px;vertical-align:bottom;}.jqplot-yaxis-tick{right:0;top:15px;text-align:right;}.jqplot-yaxis-tick.jqplot-breakTick{right:-20px;margin-right:0;padding:1px 5px 1px 5px;z-index:2;font-size:1.5em;}.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{left:0;top:15px;text-align:left;}.jqplot-meterGauge-tick{font-size:.75em;color:#999;}.jqplot-meterGauge-label{font-size:1em;color:#999;}.jqplot-xaxis-label{margin-top:10px;font-size:11pt;position:absolute;}.jqplot-x2axis-label{margin-bottom:10px;font-size:11pt;position:absolute;}.jqplot-yaxis-label{margin-right:10px;font-size:11pt;position:absolute;}.jqplot-y2axis-label,.jqplot-y3axis-label,.jqplot-y4axis-label,.jqplot-y5axis-label,.jqplot-y6axis-label,.jqplot-y7axis-label,.jqplot-y8axis-label,.jqplot-y9axis-label{font-size:11pt;position:absolute;}table.jqplot-table-legend{margin-top:12px;margin-bottom:12px;margin-left:12px;margin-right:12px;}table.jqplot-table-legend,table.jqplot-cursor-legend{background-color:rgba(255,255,255,0.6);border:1px solid #ccc;position:absolute;font-size:.75em;}td.jqplot-table-legend{vertical-align:middle;}td.jqplot-seriesToggle:hover,td.jqplot-seriesToggle:active{cursor:pointer;}td.jqplot-table-legend>div{border:1px solid #ccc;padding:1px;}div.jqplot-table-legend-swatch{width:0;height:0;border-top-width:5px;border-bottom-width:5px;border-left-width:6px;border-right-width:6px;border-top-style:solid;border-bottom-style:solid;border-left-style:solid;border-right-style:solid;}.jqplot-title{top:0;left:0;padding-bottom:.5em;font-size:1.2em;}table.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;}.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px;}.jqplot-highlighter-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px;}.jqplot-point-label{font-size:.75em;z-index:2;}td.jqplot-cursor-legend-swatch{vertical-align:middle;text-align:center;}div.jqplot-cursor-legend-swatch{width:1.2em;height:.7em;}.jqplot-error{text-align:center;}.jqplot-error-message{position:relative;top:46%;display:inline-block;}div.jqplot-bubble-label{font-size:.8em;padding-left:2px;padding-right:2px;color:rgb(20%,20%,20%);}div.jqplot-bubble-label.jqplot-bubble-label-highlight{background:rgba(90%,90%,90%,0.7);}div.jqplot-noData-container{text-align:center;background-color:rgba(96%,96%,96%,0.3);}

css/jquery.jquery-ui.css

@@ -1,563 +0,0 @@
-/*
- * jQuery UI CSS Framework 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Theming/API
- */
-
-/* Layout helpers
-----------------------------------*/
-.ui-helper-hidden { display: none; }
-.ui-helper-hidden-accessible { position: absolute !important; clip: rect(1px 1px 1px 1px); clip: rect(1px,1px,1px,1px); }
-.ui-helper-reset { margin: 0; padding: 0; border: 0; outline: 0; line-height: 1.3; text-decoration: none; font-size: 100%; list-style: none; }
-.ui-helper-clearfix:before, .ui-helper-clearfix:after { content: ""; display: table; }
-.ui-helper-clearfix:after { clear: both; }
-.ui-helper-clearfix { zoom: 1; }
-.ui-helper-zfix { width: 100%; height: 100%; top: 0; left: 0; position: absolute; opacity: 0; filter:Alpha(Opacity=0); }
-
-
-/* Interaction Cues
-----------------------------------*/
-.ui-state-disabled { cursor: default !important; }
-
-
-/* Icons
-----------------------------------*/
-
-/* states and images */
-.ui-icon { display: block; text-indent: -99999px; overflow: hidden; background-repeat: no-repeat; }
-
-
-/* Misc visuals
-----------------------------------*/
-
-/* Overlays */
-.ui-widget-overlay { position: absolute; top: 0; left: 0; width: 100%; height: 100%; }
-/*
- * jQuery UI Accordion 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Accordion#theming
- */
-/* IE/Win - Fix animation bug - #4615 */
-.ui-accordion { width: 100%; }
-.ui-accordion .ui-accordion-header { cursor: pointer; position: relative; margin-top: 1px; zoom: 1; }
-.ui-accordion .ui-accordion-li-fix { display: inline; }
-.ui-accordion .ui-accordion-header-active { border-bottom: 0 !important; }
-.ui-accordion .ui-accordion-header a { display: block; font-size: 1em; padding: .5em .5em .5em .7em; }
-.ui-accordion-icons .ui-accordion-header a { padding-left: 2.2em; }
-.ui-accordion .ui-accordion-header .ui-icon { position: absolute; left: .5em; top: 50%; margin-top: -8px; }
-.ui-accordion .ui-accordion-content { padding: 1em 2.2em; border-top: 0; margin-top: -2px; position: relative; top: 1px; margin-bottom: 2px; overflow: auto; display: none; zoom: 1; }
-.ui-accordion .ui-accordion-content-active { display: block; }
-/*
- * jQuery UI Autocomplete 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Autocomplete#theming
- */
-.ui-autocomplete { position: absolute; cursor: default; }
-
-/* workarounds */
-* html .ui-autocomplete { width:1px; } /* without this, the menu expands to 100% in IE6 */
-
-/*
- * jQuery UI Menu 1.8.17
- *
- * Copyright 2010, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Menu#theming
- */
-.ui-menu {
-	list-style:none;
-	padding: 2px;
-	margin: 0;
-	display:block;
-	float: left;
-}
-.ui-menu .ui-menu {
-	margin-top: -3px;
-}
-.ui-menu .ui-menu-item {
-	margin:0;
-	padding: 0;
-	zoom: 1;
-	float: left;
-	clear: left;
-	width: 100%;
-}
-.ui-menu .ui-menu-item a {
-	text-decoration:none;
-	display:block;
-	padding:.2em .4em;
-	line-height:1.5;
-	zoom:1;
-}
-.ui-menu .ui-menu-item a.ui-state-hover,
-.ui-menu .ui-menu-item a.ui-state-active {
-	font-weight: normal;
-	margin: -1px;
-}
-/*
- * jQuery UI Button 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Button#theming
- */
-.ui-button { display: inline-block; position: relative; padding: 0; margin-right: .1em; text-decoration: none !important; cursor: pointer; text-align: center; zoom: 1; overflow: visible; } /* the overflow property removes extra width in IE */
-.ui-button-icon-only { width: 2.2em; } /* to make room for the icon, a width needs to be set here */
-button.ui-button-icon-only { width: 2.4em; } /* button elements seem to need a little more width */
-.ui-button-icons-only { width: 3.4em; }
-button.ui-button-icons-only { width: 3.7em; }
-
-/*button text element */
-.ui-button .ui-button-text { display: block; line-height: 1.4;  }
-.ui-button-text-only .ui-button-text { padding: .4em 1em; }
-.ui-button-icon-only .ui-button-text, .ui-button-icons-only .ui-button-text { padding: .4em; text-indent: -9999999px; }
-.ui-button-text-icon-primary .ui-button-text, .ui-button-text-icons .ui-button-text { padding: .4em 1em .4em 2.1em; }
-.ui-button-text-icon-secondary .ui-button-text, .ui-button-text-icons .ui-button-text { padding: .4em 2.1em .4em 1em; }
-.ui-button-text-icons .ui-button-text { padding-left: 2.1em; padding-right: 2.1em; }
-/* no icon support for input elements, provide padding by default */
-input.ui-button { padding: .4em 1em; }
-
-/*button icon element(s) */
-.ui-button-icon-only .ui-icon, .ui-button-text-icon-primary .ui-icon, .ui-button-text-icon-secondary .ui-icon, .ui-button-text-icons .ui-icon, .ui-button-icons-only .ui-icon { position: absolute; top: 50%; margin-top: -8px; }
-.ui-button-icon-only .ui-icon { left: 50%; margin-left: -8px; }
-.ui-button-text-icon-primary .ui-button-icon-primary, .ui-button-text-icons .ui-button-icon-primary, .ui-button-icons-only .ui-button-icon-primary { left: .5em; }
-.ui-button-text-icon-secondary .ui-button-icon-secondary, .ui-button-text-icons .ui-button-icon-secondary, .ui-button-icons-only .ui-button-icon-secondary { right: .5em; }
-.ui-button-text-icons .ui-button-icon-secondary, .ui-button-icons-only .ui-button-icon-secondary { right: .5em; }
-
-/*button sets*/
-.ui-buttonset { margin-right: 7px; }
-.ui-buttonset .ui-button { margin-left: 0; margin-right: -.3em; }
-
-/* workarounds */
-button.ui-button::-moz-focus-inner { border: 0; padding: 0; } /* reset extra padding in Firefox */
-/*
- * jQuery UI Datepicker 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Datepicker#theming
- */
-.ui-datepicker { width: 17em; padding: .2em .2em 0; display: none; }
-.ui-datepicker .ui-datepicker-header { position:relative; padding:.2em 0; }
-.ui-datepicker .ui-datepicker-prev, .ui-datepicker .ui-datepicker-next { position:absolute; top: 2px; width: 1.8em; height: 1.8em; }
-.ui-datepicker .ui-datepicker-prev-hover, .ui-datepicker .ui-datepicker-next-hover { top: 1px; }
-.ui-datepicker .ui-datepicker-prev { left:2px; }
-.ui-datepicker .ui-datepicker-next { right:2px; }
-.ui-datepicker .ui-datepicker-prev-hover { left:1px; }
-.ui-datepicker .ui-datepicker-next-hover { right:1px; }
-.ui-datepicker .ui-datepicker-prev span, .ui-datepicker .ui-datepicker-next span { display: block; position: absolute; left: 50%; margin-left: -8px; top: 50%; margin-top: -8px;  }
-.ui-datepicker .ui-datepicker-title { margin: 0 2.3em; line-height: 1.8em; text-align: center; }
-.ui-datepicker .ui-datepicker-title select { font-size:1em; margin:1px 0; }
-.ui-datepicker select.ui-datepicker-month-year {width: 100%;}
-.ui-datepicker select.ui-datepicker-month,
-.ui-datepicker select.ui-datepicker-year { width: 49%;}
-.ui-datepicker table {width: 100%; font-size: .9em; border-collapse: collapse; margin:0 0 .4em; }
-.ui-datepicker th { padding: .7em .3em; text-align: center; font-weight: bold; border: 0;  }
-.ui-datepicker td { border: 0; padding: 1px; }
-.ui-datepicker td span, .ui-datepicker td a { display: block; padding: .2em; text-align: right; text-decoration: none; }
-.ui-datepicker .ui-datepicker-buttonpane { background-image: none; margin: .7em 0 0 0; padding:0 .2em; border-left: 0; border-right: 0; border-bottom: 0; }
-.ui-datepicker .ui-datepicker-buttonpane button { float: right; margin: .5em .2em .4em; cursor: pointer; padding: .2em .6em .3em .6em; width:auto; overflow:visible; }
-.ui-datepicker .ui-datepicker-buttonpane button.ui-datepicker-current { float:left; }
-
-/* with multiple calendars */
-.ui-datepicker.ui-datepicker-multi { width:auto; }
-.ui-datepicker-multi .ui-datepicker-group { float:left; }
-.ui-datepicker-multi .ui-datepicker-group table { width:95%; margin:0 auto .4em; }
-.ui-datepicker-multi-2 .ui-datepicker-group { width:50%; }
-.ui-datepicker-multi-3 .ui-datepicker-group { width:33.3%; }
-.ui-datepicker-multi-4 .ui-datepicker-group { width:25%; }
-.ui-datepicker-multi .ui-datepicker-group-last .ui-datepicker-header { border-left-width:0; }
-.ui-datepicker-multi .ui-datepicker-group-middle .ui-datepicker-header { border-left-width:0; }
-.ui-datepicker-multi .ui-datepicker-buttonpane { clear:left; }
-.ui-datepicker-row-break { clear:both; width:100%; font-size:0em; }
-
-/* RTL support */
-.ui-datepicker-rtl { direction: rtl; }
-.ui-datepicker-rtl .ui-datepicker-prev { right: 2px; left: auto; }
-.ui-datepicker-rtl .ui-datepicker-next { left: 2px; right: auto; }
-.ui-datepicker-rtl .ui-datepicker-prev:hover { right: 1px; left: auto; }
-.ui-datepicker-rtl .ui-datepicker-next:hover { left: 1px; right: auto; }
-.ui-datepicker-rtl .ui-datepicker-buttonpane { clear:right; }
-.ui-datepicker-rtl .ui-datepicker-buttonpane button { float: left; }
-.ui-datepicker-rtl .ui-datepicker-buttonpane button.ui-datepicker-current { float:right; }
-.ui-datepicker-rtl .ui-datepicker-group { float:right; }
-.ui-datepicker-rtl .ui-datepicker-group-last .ui-datepicker-header { border-right-width:0; border-left-width:1px; }
-.ui-datepicker-rtl .ui-datepicker-group-middle .ui-datepicker-header { border-right-width:0; border-left-width:1px; }
-
-/* IE6 IFRAME FIX (taken from datepicker 1.5.3 */
-.ui-datepicker-cover {
-    display: none; /*sorry for IE5*/
-    display/**/: block; /*sorry for IE5*/
-    position: absolute; /*must have*/
-    z-index: -1; /*must have*/
-    filter: mask(); /*must have*/
-    top: -4px; /*must have*/
-    left: -4px; /*must have*/
-    width: 200px; /*must have*/
-    height: 200px; /*must have*/
-}/*
- * jQuery UI Dialog 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Dialog#theming
- */
-.ui-dialog { position: absolute; padding: .2em; width: 300px; overflow: hidden; }
-.ui-dialog .ui-dialog-titlebar { padding: .4em 1em; position: relative;  }
-.ui-dialog .ui-dialog-title { float: left; margin: .1em 16px .1em 0; }
-.ui-dialog .ui-dialog-titlebar-close { position: absolute; right: .3em; top: 50%; width: 19px; margin: -10px 0 0 0; padding: 1px; height: 18px; }
-.ui-dialog .ui-dialog-titlebar-close span { display: block; margin: 1px; }
-.ui-dialog .ui-dialog-titlebar-close:hover, .ui-dialog .ui-dialog-titlebar-close:focus { padding: 0; }
-.ui-dialog .ui-dialog-content { position: relative; border: 0; padding: .5em 1em; background: none; overflow: auto; zoom: 1; }
-.ui-dialog .ui-dialog-buttonpane { text-align: left; border-width: 1px 0 0 0; background-image: none; margin: .5em 0 0 0; padding: .3em 1em .5em .4em; }
-.ui-dialog .ui-dialog-buttonpane .ui-dialog-buttonset { float: right; }
-.ui-dialog .ui-dialog-buttonpane button { margin: .5em .4em .5em 0; cursor: pointer; }
-.ui-dialog .ui-resizable-se { width: 14px; height: 14px; right: 3px; bottom: 3px; }
-.ui-draggable .ui-dialog-titlebar { cursor: move; }
-/*
- * jQuery UI Progressbar 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Progressbar#theming
- */
-.ui-progressbar { height:2em; text-align: left; overflow: hidden; }
-.ui-progressbar .ui-progressbar-value {margin: -1px; height:100%; }/*
- * jQuery UI Resizable 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Resizable#theming
- */
-.ui-resizable { position: relative;}
-.ui-resizable-handle { position: absolute;font-size: 0.1px;z-index: 99999; display: block; }
-.ui-resizable-disabled .ui-resizable-handle, .ui-resizable-autohide .ui-resizable-handle { display: none; }
-.ui-resizable-n { cursor: n-resize; height: 7px; width: 100%; top: -5px; left: 0; }
-.ui-resizable-s { cursor: s-resize; height: 7px; width: 100%; bottom: -5px; left: 0; }
-.ui-resizable-e { cursor: e-resize; width: 7px; right: -5px; top: 0; height: 100%; }
-.ui-resizable-w { cursor: w-resize; width: 7px; left: -5px; top: 0; height: 100%; }
-.ui-resizable-se { cursor: se-resize; width: 12px; height: 12px; right: 1px; bottom: 1px; }
-.ui-resizable-sw { cursor: sw-resize; width: 9px; height: 9px; left: -5px; bottom: -5px; }
-.ui-resizable-nw { cursor: nw-resize; width: 9px; height: 9px; left: -5px; top: -5px; }
-.ui-resizable-ne { cursor: ne-resize; width: 9px; height: 9px; right: -5px; top: -5px;}/*
- * jQuery UI Selectable 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Selectable#theming
- */
-.ui-selectable-helper { position: absolute; z-index: 100; border:1px dotted black; }
-/*
- * jQuery UI Slider 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Slider#theming
- */
-.ui-slider { position: relative; text-align: left; }
-.ui-slider .ui-slider-handle { position: absolute; z-index: 2; width: 1.2em; height: 1.2em; cursor: default; }
-.ui-slider .ui-slider-range { position: absolute; z-index: 1; font-size: .7em; display: block; border: 0; background-position: 0 0; }
-
-.ui-slider-horizontal { height: .8em; }
-.ui-slider-horizontal .ui-slider-handle { top: -.3em; margin-left: -.6em; }
-.ui-slider-horizontal .ui-slider-range { top: 0; height: 100%; }
-.ui-slider-horizontal .ui-slider-range-min { left: 0; }
-.ui-slider-horizontal .ui-slider-range-max { right: 0; }
-
-.ui-slider-vertical { width: .8em; height: 100px; }
-.ui-slider-vertical .ui-slider-handle { left: -.3em; margin-left: 0; margin-bottom: -.6em; }
-.ui-slider-vertical .ui-slider-range { left: 0; width: 100%; }
-.ui-slider-vertical .ui-slider-range-min { bottom: 0; }
-.ui-slider-vertical .ui-slider-range-max { top: 0; }/*
- * jQuery UI Tabs 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Tabs#theming
- */
-.ui-tabs { position: relative; padding: .2em; zoom: 1; } /* position: relative prevents IE scroll bug (element with position: relative inside container with overflow: auto appear as "fixed") */
-.ui-tabs .ui-tabs-nav { margin: 0; padding: .2em .2em 0; }
-.ui-tabs .ui-tabs-nav li { list-style: none; float: left; position: relative; top: 1px; margin: 0 .2em 1px 0; border-bottom: 0 !important; padding: 0; white-space: nowrap; }
-.ui-tabs .ui-tabs-nav li a { float: left; padding: .5em 1em; text-decoration: none; }
-.ui-tabs .ui-tabs-nav li.ui-tabs-selected { margin-bottom: 0; padding-bottom: 1px; }
-.ui-tabs .ui-tabs-nav li.ui-tabs-selected a, .ui-tabs .ui-tabs-nav li.ui-state-disabled a, .ui-tabs .ui-tabs-nav li.ui-state-processing a { cursor: text; }
-.ui-tabs .ui-tabs-nav li a, .ui-tabs.ui-tabs-collapsible .ui-tabs-nav li.ui-tabs-selected a { cursor: pointer; } /* first selector in group seems obsolete, but required to overcome bug in Opera applying cursor: text overall if defined elsewhere... */
-.ui-tabs .ui-tabs-panel { display: block; border-width: 0; padding: 1em 1.4em; background: none; }
-.ui-tabs .ui-tabs-hide { display: none !important; }
-/*
- * jQuery UI CSS Framework 1.8.17
- *
- * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
- * Dual licensed under the MIT or GPL Version 2 licenses.
- * http://jquery.org/license
- *
- * http://docs.jquery.com/UI/Theming/API
- *
- * To view and modify this theme, visit http://jqueryui.com/themeroller/
- */
-
-
-/* Component containers
-----------------------------------*/
-.ui-widget { font-family: Verdana,Arial,sans-serif/*{ffDefault}*/; font-size: 1.1em/*{fsDefault}*/; }
-.ui-widget .ui-widget { font-size: 1em; }
-.ui-widget input, .ui-widget select, .ui-widget textarea, .ui-widget button { font-family: Verdana,Arial,sans-serif/*{ffDefault}*/; font-size: 1em; }
-.ui-widget-content { border: 1px solid #aaaaaa/*{borderColorContent}*/; background: #ffffff/*{bgColorContent}*/ url(images/ui-bg_flat_75_ffffff_40x100.png)/*{bgImgUrlContent}*/ 50%/*{bgContentXPos}*/ 50%/*{bgContentYPos}*/ repeat-x/*{bgContentRepeat}*/; color: #222222/*{fcContent}*/; }
-.ui-widget-content a { color: #222222/*{fcContent}*/; }
-.ui-widget-header { border: 1px solid #aaaaaa/*{borderColorHeader}*/; background: #cccccc/*{bgColorHeader}*/ url(images/ui-bg_highlight-soft_75_cccccc_1x100.png)/*{bgImgUrlHeader}*/ 50%/*{bgHeaderXPos}*/ 50%/*{bgHeaderYPos}*/ repeat-x/*{bgHeaderRepeat}*/; color: #222222/*{fcHeader}*/; font-weight: bold; }
-.ui-widget-header a { color: #222222/*{fcHeader}*/; }
-
-/* Interaction states
-----------------------------------*/
-.ui-state-default, .ui-widget-content .ui-state-default, .ui-widget-header .ui-state-default { border: 1px solid #d3d3d3/*{borderColorDefault}*/; background: #e6e6e6/*{bgColorDefault}*/ url(images/ui-bg_glass_75_e6e6e6_1x400.png)/*{bgImgUrlDefault}*/ 50%/*{bgDefaultXPos}*/ 50%/*{bgDefaultYPos}*/ repeat-x/*{bgDefaultRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #555555/*{fcDefault}*/; }
-.ui-state-default a, .ui-state-default a:link, .ui-state-default a:visited { color: #555555/*{fcDefault}*/; text-decoration: none; }
-.ui-state-hover, .ui-widget-content .ui-state-hover, .ui-widget-header .ui-state-hover, .ui-state-focus, .ui-widget-content .ui-state-focus, .ui-widget-header .ui-state-focus { border: 1px solid #999999/*{borderColorHover}*/; background: #dadada/*{bgColorHover}*/ url(images/ui-bg_glass_75_dadada_1x400.png)/*{bgImgUrlHover}*/ 50%/*{bgHoverXPos}*/ 50%/*{bgHoverYPos}*/ repeat-x/*{bgHoverRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #212121/*{fcHover}*/; }
-.ui-state-hover a, .ui-state-hover a:hover { color: #212121/*{fcHover}*/; text-decoration: none; }
-.ui-state-active, .ui-widget-content .ui-state-active, .ui-widget-header .ui-state-active { border: 1px solid #aaaaaa/*{borderColorActive}*/; background: #ffffff/*{bgColorActive}*/ url(images/ui-bg_glass_65_ffffff_1x400.png)/*{bgImgUrlActive}*/ 50%/*{bgActiveXPos}*/ 50%/*{bgActiveYPos}*/ repeat-x/*{bgActiveRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #212121/*{fcActive}*/; }
-.ui-state-active a, .ui-state-active a:link, .ui-state-active a:visited { color: #212121/*{fcActive}*/; text-decoration: none; }
-.ui-widget :active { outline: none; }
-
-/* Interaction Cues
-----------------------------------*/
-.ui-state-highlight, .ui-widget-content .ui-state-highlight, .ui-widget-header .ui-state-highlight  {border: 1px solid #fcefa1/*{borderColorHighlight}*/; background: #fbf9ee/*{bgColorHighlight}*/ url(images/ui-bg_glass_55_fbf9ee_1x400.png)/*{bgImgUrlHighlight}*/ 50%/*{bgHighlightXPos}*/ 50%/*{bgHighlightYPos}*/ repeat-x/*{bgHighlightRepeat}*/; color: #363636/*{fcHighlight}*/; }
-.ui-state-highlight a, .ui-widget-content .ui-state-highlight a,.ui-widget-header .ui-state-highlight a { color: #363636/*{fcHighlight}*/; }
-.ui-state-error, .ui-widget-content .ui-state-error, .ui-widget-header .ui-state-error {border: 1px solid #cd0a0a/*{borderColorError}*/; background: #fef1ec/*{bgColorError}*/ url(images/ui-bg_glass_95_fef1ec_1x400.png)/*{bgImgUrlError}*/ 50%/*{bgErrorXPos}*/ 50%/*{bgErrorYPos}*/ repeat-x/*{bgErrorRepeat}*/; color: #cd0a0a/*{fcError}*/; }
-.ui-state-error a, .ui-widget-content .ui-state-error a, .ui-widget-header .ui-state-error a { color: #cd0a0a/*{fcError}*/; }
-.ui-state-error-text, .ui-widget-content .ui-state-error-text, .ui-widget-header .ui-state-error-text { color: #cd0a0a/*{fcError}*/; }
-.ui-priority-primary, .ui-widget-content .ui-priority-primary, .ui-widget-header .ui-priority-primary { font-weight: bold; }
-.ui-priority-secondary, .ui-widget-content .ui-priority-secondary,  .ui-widget-header .ui-priority-secondary { opacity: .7; filter:Alpha(Opacity=70); font-weight: normal; }
-.ui-state-disabled, .ui-widget-content .ui-state-disabled, .ui-widget-header .ui-state-disabled { opacity: .35; filter:Alpha(Opacity=35); background-image: none; }
-
-/* Icons
-----------------------------------*/
-
-/* states and images */
-.ui-icon { width: 16px; height: 16px; background-image: url(images/ui-icons_222222_256x240.png)/*{iconsContent}*/; }
-.ui-widget-content .ui-icon {background-image: url(images/ui-icons_222222_256x240.png)/*{iconsContent}*/; }
-.ui-widget-header .ui-icon {background-image: url(images/ui-icons_222222_256x240.png)/*{iconsHeader}*/; }
-.ui-state-default .ui-icon { background-image: url(images/ui-icons_888888_256x240.png)/*{iconsDefault}*/; }
-.ui-state-hover .ui-icon, .ui-state-focus .ui-icon {background-image: url(images/ui-icons_454545_256x240.png)/*{iconsHover}*/; }
-.ui-state-active .ui-icon {background-image: url(images/ui-icons_454545_256x240.png)/*{iconsActive}*/; }
-.ui-state-highlight .ui-icon {background-image: url(images/ui-icons_2e83ff_256x240.png)/*{iconsHighlight}*/; }
-.ui-state-error .ui-icon, .ui-state-error-text .ui-icon {background-image: url(images/ui-icons_cd0a0a_256x240.png)/*{iconsError}*/; }
-
-/* positioning */
-.ui-icon-carat-1-n { background-position: 0 0; }
-.ui-icon-carat-1-ne { background-position: -16px 0; }
-.ui-icon-carat-1-e { background-position: -32px 0; }
-.ui-icon-carat-1-se { background-position: -48px 0; }
-.ui-icon-carat-1-s { background-position: -64px 0; }
-.ui-icon-carat-1-sw { background-position: -80px 0; }
-.ui-icon-carat-1-w { background-position: -96px 0; }
-.ui-icon-carat-1-nw { background-position: -112px 0; }
-.ui-icon-carat-2-n-s { background-position: -128px 0; }
-.ui-icon-carat-2-e-w { background-position: -144px 0; }
-.ui-icon-triangle-1-n { background-position: 0 -16px; }
-.ui-icon-triangle-1-ne { background-position: -16px -16px; }
-.ui-icon-triangle-1-e { background-position: -32px -16px; }
-.ui-icon-triangle-1-se { background-position: -48px -16px; }
-.ui-icon-triangle-1-s { background-position: -64px -16px; }
-.ui-icon-triangle-1-sw { background-position: -80px -16px; }
-.ui-icon-triangle-1-w { background-position: -96px -16px; }
-.ui-icon-triangle-1-nw { background-position: -112px -16px; }
-.ui-icon-triangle-2-n-s { background-position: -128px -16px; }
-.ui-icon-triangle-2-e-w { background-position: -144px -16px; }
-.ui-icon-arrow-1-n { background-position: 0 -32px; }
-.ui-icon-arrow-1-ne { background-position: -16px -32px; }
-.ui-icon-arrow-1-e { background-position: -32px -32px; }
-.ui-icon-arrow-1-se { background-position: -48px -32px; }
-.ui-icon-arrow-1-s { background-position: -64px -32px; }
-.ui-icon-arrow-1-sw { background-position: -80px -32px; }
-.ui-icon-arrow-1-w { background-position: -96px -32px; }
-.ui-icon-arrow-1-nw { background-position: -112px -32px; }
-.ui-icon-arrow-2-n-s { background-position: -128px -32px; }
-.ui-icon-arrow-2-ne-sw { background-position: -144px -32px; }
-.ui-icon-arrow-2-e-w { background-position: -160px -32px; }
-.ui-icon-arrow-2-se-nw { background-position: -176px -32px; }
-.ui-icon-arrowstop-1-n { background-position: -192px -32px; }
-.ui-icon-arrowstop-1-e { background-position: -208px -32px; }
-.ui-icon-arrowstop-1-s { background-position: -224px -32px; }
-.ui-icon-arrowstop-1-w { background-position: -240px -32px; }
-.ui-icon-arrowthick-1-n { background-position: 0 -48px; }
-.ui-icon-arrowthick-1-ne { background-position: -16px -48px; }
-.ui-icon-arrowthick-1-e { background-position: -32px -48px; }
-.ui-icon-arrowthick-1-se { background-position: -48px -48px; }
-.ui-icon-arrowthick-1-s { background-position: -64px -48px; }
-.ui-icon-arrowthick-1-sw { background-position: -80px -48px; }
-.ui-icon-arrowthick-1-w { background-position: -96px -48px; }
-.ui-icon-arrowthick-1-nw { background-position: -112px -48px; }
-.ui-icon-arrowthick-2-n-s { background-position: -128px -48px; }
-.ui-icon-arrowthick-2-ne-sw { background-position: -144px -48px; }
-.ui-icon-arrowthick-2-e-w { background-position: -160px -48px; }
-.ui-icon-arrowthick-2-se-nw { background-position: -176px -48px; }
-.ui-icon-arrowthickstop-1-n { background-position: -192px -48px; }
-.ui-icon-arrowthickstop-1-e { background-position: -208px -48px; }
-.ui-icon-arrowthickstop-1-s { background-position: -224px -48px; }
-.ui-icon-arrowthickstop-1-w { background-position: -240px -48px; }
-.ui-icon-arrowreturnthick-1-w { background-position: 0 -64px; }
-.ui-icon-arrowreturnthick-1-n { background-position: -16px -64px; }
-.ui-icon-arrowreturnthick-1-e { background-position: -32px -64px; }
-.ui-icon-arrowreturnthick-1-s { background-position: -48px -64px; }
-.ui-icon-arrowreturn-1-w { background-position: -64px -64px; }
-.ui-icon-arrowreturn-1-n { background-position: -80px -64px; }
-.ui-icon-arrowreturn-1-e { background-position: -96px -64px; }
-.ui-icon-arrowreturn-1-s { background-position: -112px -64px; }
-.ui-icon-arrowrefresh-1-w { background-position: -128px -64px; }
-.ui-icon-arrowrefresh-1-n { background-position: -144px -64px; }
-.ui-icon-arrowrefresh-1-e { background-position: -160px -64px; }
-.ui-icon-arrowrefresh-1-s { background-position: -176px -64px; }
-.ui-icon-arrow-4 { background-position: 0 -80px; }
-.ui-icon-arrow-4-diag { background-position: -16px -80px; }
-.ui-icon-extlink { background-position: -32px -80px; }
-.ui-icon-newwin { background-position: -48px -80px; }
-.ui-icon-refresh { background-position: -64px -80px; }
-.ui-icon-shuffle { background-position: -80px -80px; }
-.ui-icon-transfer-e-w { background-position: -96px -80px; }
-.ui-icon-transferthick-e-w { background-position: -112px -80px; }
-.ui-icon-folder-collapsed { background-position: 0 -96px; }
-.ui-icon-folder-open { background-position: -16px -96px; }
-.ui-icon-document { background-position: -32px -96px; }
-.ui-icon-document-b { background-position: -48px -96px; }
-.ui-icon-note { background-position: -64px -96px; }
-.ui-icon-mail-closed { background-position: -80px -96px; }
-.ui-icon-mail-open { background-position: -96px -96px; }
-.ui-icon-suitcase { background-position: -112px -96px; }
-.ui-icon-comment { background-position: -128px -96px; }
-.ui-icon-person { background-position: -144px -96px; }
-.ui-icon-print { background-position: -160px -96px; }
-.ui-icon-trash { background-position: -176px -96px; }
-.ui-icon-locked { background-position: -192px -96px; }
-.ui-icon-unlocked { background-position: -208px -96px; }
-.ui-icon-bookmark { background-position: -224px -96px; }
-.ui-icon-tag { background-position: -240px -96px; }
-.ui-icon-home { background-position: 0 -112px; }
-.ui-icon-flag { background-position: -16px -112px; }
-.ui-icon-calendar { background-position: -32px -112px; }
-.ui-icon-cart { background-position: -48px -112px; }
-.ui-icon-pencil { background-position: -64px -112px; }
-.ui-icon-clock { background-position: -80px -112px; }
-.ui-icon-disk { background-position: -96px -112px; }
-.ui-icon-calculator { background-position: -112px -112px; }
-.ui-icon-zoomin { background-position: -128px -112px; }
-.ui-icon-zoomout { background-position: -144px -112px; }
-.ui-icon-search { background-position: -160px -112px; }
-.ui-icon-wrench { background-position: -176px -112px; }
-.ui-icon-gear { background-position: -192px -112px; }
-.ui-icon-heart { background-position: -208px -112px; }
-.ui-icon-star { background-position: -224px -112px; }
-.ui-icon-link { background-position: -240px -112px; }
-.ui-icon-cancel { background-position: 0 -128px; }
-.ui-icon-plus { background-position: -16px -128px; }
-.ui-icon-plusthick { background-position: -32px -128px; }
-.ui-icon-minus { background-position: -48px -128px; }
-.ui-icon-minusthick { background-position: -64px -128px; }
-.ui-icon-close { background-position: -80px -128px; }
-.ui-icon-closethick { background-position: -96px -128px; }
-.ui-icon-key { background-position: -112px -128px; }
-.ui-icon-lightbulb { background-position: -128px -128px; }
-.ui-icon-scissors { background-position: -144px -128px; }
-.ui-icon-clipboard { background-position: -160px -128px; }
-.ui-icon-copy { background-position: -176px -128px; }
-.ui-icon-contact { background-position: -192px -128px; }
-.ui-icon-image { background-position: -208px -128px; }
-.ui-icon-video { background-position: -224px -128px; }
-.ui-icon-script { background-position: -240px -128px; }
-.ui-icon-alert { background-position: 0 -144px; }
-.ui-icon-info { background-position: -16px -144px; }
-.ui-icon-notice { background-position: -32px -144px; }
-.ui-icon-help { background-position: -48px -144px; }
-.ui-icon-check { background-position: -64px -144px; }
-.ui-icon-bullet { background-position: -80px -144px; }
-.ui-icon-radio-off { background-position: -96px -144px; }
-.ui-icon-radio-on { background-position: -112px -144px; }
-.ui-icon-pin-w { background-position: -128px -144px; }
-.ui-icon-pin-s { background-position: -144px -144px; }
-.ui-icon-play { background-position: 0 -160px; }
-.ui-icon-pause { background-position: -16px -160px; }
-.ui-icon-seek-next { background-position: -32px -160px; }
-.ui-icon-seek-prev { background-position: -48px -160px; }
-.ui-icon-seek-end { background-position: -64px -160px; }
-.ui-icon-seek-start { background-position: -80px -160px; }
-/* ui-icon-seek-first is deprecated, use ui-icon-seek-start instead */
-.ui-icon-seek-first { background-position: -80px -160px; }
-.ui-icon-stop { background-position: -96px -160px; }
-.ui-icon-eject { background-position: -112px -160px; }
-.ui-icon-volume-off { background-position: -128px -160px; }
-.ui-icon-volume-on { background-position: -144px -160px; }
-.ui-icon-power { background-position: 0 -176px; }
-.ui-icon-signal-diag { background-position: -16px -176px; }
-.ui-icon-signal { background-position: -32px -176px; }
-.ui-icon-battery-0 { background-position: -48px -176px; }
-.ui-icon-battery-1 { background-position: -64px -176px; }
-.ui-icon-battery-2 { background-position: -80px -176px; }
-.ui-icon-battery-3 { background-position: -96px -176px; }
-.ui-icon-circle-plus { background-position: 0 -192px; }
-.ui-icon-circle-minus { background-position: -16px -192px; }
-.ui-icon-circle-close { background-position: -32px -192px; }
-.ui-icon-circle-triangle-e { background-position: -48px -192px; }
-.ui-icon-circle-triangle-s { background-position: -64px -192px; }
-.ui-icon-circle-triangle-w { background-position: -80px -192px; }
-.ui-icon-circle-triangle-n { background-position: -96px -192px; }
-.ui-icon-circle-arrow-e { background-position: -112px -192px; }
-.ui-icon-circle-arrow-s { background-position: -128px -192px; }
-.ui-icon-circle-arrow-w { background-position: -144px -192px; }
-.ui-icon-circle-arrow-n { background-position: -160px -192px; }
-.ui-icon-circle-zoomin { background-position: -176px -192px; }
-.ui-icon-circle-zoomout { background-position: -192px -192px; }
-.ui-icon-circle-check { background-position: -208px -192px; }
-.ui-icon-circlesmall-plus { background-position: 0 -208px; }
-.ui-icon-circlesmall-minus { background-position: -16px -208px; }
-.ui-icon-circlesmall-close { background-position: -32px -208px; }
-.ui-icon-squaresmall-plus { background-position: -48px -208px; }
-.ui-icon-squaresmall-minus { background-position: -64px -208px; }
-.ui-icon-squaresmall-close { background-position: -80px -208px; }
-.ui-icon-grip-dotted-vertical { background-position: 0 -224px; }
-.ui-icon-grip-dotted-horizontal { background-position: -16px -224px; }
-.ui-icon-grip-solid-vertical { background-position: -32px -224px; }
-.ui-icon-grip-solid-horizontal { background-position: -48px -224px; }
-.ui-icon-gripsmall-diagonal-se { background-position: -64px -224px; }
-.ui-icon-grip-diagonal-se { background-position: -80px -224px; }
-
-
-/* Misc visuals
-----------------------------------*/
-
-/* Corner radius */
-.ui-corner-all, .ui-corner-top, .ui-corner-left, .ui-corner-tl { -moz-border-radius-topleft: 4px/*{cornerRadius}*/; -webkit-border-top-left-radius: 4px/*{cornerRadius}*/; -khtml-border-top-left-radius: 4px/*{cornerRadius}*/; border-top-left-radius: 4px/*{cornerRadius}*/; }
-.ui-corner-all, .ui-corner-top, .ui-corner-right, .ui-corner-tr { -moz-border-radius-topright: 4px/*{cornerRadius}*/; -webkit-border-top-right-radius: 4px/*{cornerRadius}*/; -khtml-border-top-right-radius: 4px/*{cornerRadius}*/; border-top-right-radius: 4px/*{cornerRadius}*/; }
-.ui-corner-all, .ui-corner-bottom, .ui-corner-left, .ui-corner-bl { -moz-border-radius-bottomleft: 4px/*{cornerRadius}*/; -webkit-border-bottom-left-radius: 4px/*{cornerRadius}*/; -khtml-border-bottom-left-radius: 4px/*{cornerRadius}*/; border-bottom-left-radius: 4px/*{cornerRadius}*/; }
-.ui-corner-all, .ui-corner-bottom, .ui-corner-right, .ui-corner-br { -moz-border-radius-bottomright: 4px/*{cornerRadius}*/; -webkit-border-bottom-right-radius: 4px/*{cornerRadius}*/; -khtml-border-bottom-right-radius: 4px/*{cornerRadius}*/; border-bottom-right-radius: 4px/*{cornerRadius}*/; }
-
-/* Overlays */
-.ui-widget-overlay { background: #aaaaaa/*{bgColorOverlay}*/ url(images/ui-bg_flat_0_aaaaaa_40x100.png)/*{bgImgUrlOverlay}*/ 50%/*{bgOverlayXPos}*/ 50%/*{bgOverlayYPos}*/ repeat-x/*{bgOverlayRepeat}*/; opacity: .3;filter:Alpha(Opacity=30)/*{opacityOverlay}*/; }
-.ui-widget-shadow { margin: -8px/*{offsetTopShadow}*/ 0 0 -8px/*{offsetLeftShadow}*/; padding: 8px/*{thicknessShadow}*/; background: #aaaaaa/*{bgColorShadow}*/ url(images/ui-bg_flat_0_aaaaaa_40x100.png)/*{bgImgUrlShadow}*/ 50%/*{bgShadowXPos}*/ 50%/*{bgShadowYPos}*/ repeat-x/*{bgShadowRepeat}*/; opacity: .3;filter:Alpha(Opacity=30)/*{opacityShadow}*/; -moz-border-radius: 8px/*{cornerRadiusShadow}*/; -khtml-border-radius: 8px/*{cornerRadiusShadow}*/; -webkit-border-radius: 8px/*{cornerRadiusShadow}*/; border-radius: 8px/*{cornerRadiusShadow}*/; }

customer_aps.php

@@ -14,21 +14,21 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
+// Required code
+
 define('AREA', 'customer');
-require ('./lib/init.php');
+require ("./lib/init.php");
-
 $Id = 0;
-if (isset($_GET['id'])) {
-    $Id = (int)$_GET['id'];
-}
-if (isset($_POST['id'])) {
-    $Id = (int)$_POST['id'];
-}
 
-eval("echo \"" . getTemplate('aps/header') . "\";");
+if(isset($_GET['id']))$Id = (int)$_GET['id'];
+
+if(isset($_POST['id']))$Id = (int)$_POST['id'];
+eval("echo \"" . getTemplate("aps/header") . "\";");
 $Aps = new ApsParser($userinfo, $settings, $db);
 $Aps->MainHandler($action);
-eval("echo \"" . getTemplate('aps/footer') . "\";");
+eval("echo \"" . getTemplate("aps/footer") . "\";");
+
+?>

customer_autoresponder.php

@@ -14,17 +14,21 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
-define('AREA', 'customer');
+// Required code
-require('./lib/init.php');
 
-if ($action == 'add') {
+define('AREA', 'customer');
-	// Create new autoresponder
+require ("./lib/init.php");
-	if (isset($_POST['send'])
+
-	   && $_POST['send'] == 'send'
+// Create new autoresponder
-	) {
+
+if($action == "add")
+{
+	if(isset($_POST['send'])
+	   && $_POST['send'] == 'send')
+	{
 		$account = trim($_POST['account']);
 		$subject = trim($_POST['subject']);
 		$message = trim($_POST['message']);
@@ -38,31 +42,39 @@ if ($action == 'add') {
 		$ts_from = -1;
 		$ts_until = -1;
 
-		if ($date_from_off > -1) {
+		if($date_from_off > -1)
+		{
 			$date_from = $_POST['date_from'];
 			$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
 		}
-		if ($date_until_off > -1) {
+		if($date_until_off > -1)
+		{
 			$date_until = $_POST['date_until'];
 			$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
 		}
 
-		if (empty($account)
+		if(empty($account)
 		   || empty($subject)
-		   || empty($message)
+		   || empty($message))
-		) {
+		{
 			standard_error('missingfields');
 		}
 
 		// Does account exist?
+
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-		if ($db->num_rows($result) == 0) {
+
+		if($db->num_rows($result) == 0)
+		{
 			standard_error('accountnotexisting');
 		}
 
 		// Does autoresponder exist?
+
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-		if ($db->num_rows($result) == 1) {
+
+		if($db->num_rows($result) == 1)
+		{
 			standard_error('autoresponderalreadyexists');
 		}
 
@@ -80,33 +92,36 @@ if ($action == 'add') {
 	}
 
 	// Get accounts
+
 	$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC");
-	if ($db->num_rows($result) == 0) {
+
+	if($db->num_rows($result) == 0)
+	{
 		standard_error('noemailaccount');
 	}
 
 	$accounts = '';
-	while ($row = $db->fetch_array($result)) {
+
-		$accounts .= '<option value="' . $row['email'] . '">' . $row['email'] . '</option>';
+	while($row = $db->fetch_array($result))
+	{
+		$accounts.= "<option value=\"" . $row['email'] . "\">" . $row['email'] . "</option>";
 	}
 	
 	$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
 	$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
 
-	//$isactive = makeyesno('active', '1', '0', '1');
+	eval("echo \"" . getTemplate("email/autoresponder_add") . "\";");
+}
 
-	$autoresponder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_add.php';
+// Edit autoresponder
-	$autoresponder_add_form = htmlform::genHTMLForm($autoresponder_add_data);
 
-	$title = $autoresponder_add_data['autoresponder_add']['title'];
+else
-	$image = $autoresponder_add_data['autoresponder_add']['image'];
 
-	eval("echo \"" . getTemplate('autoresponder/autoresponder_add') . "\";");
+if($action == "edit")
-} elseif ($action == 'edit') {
+{
-	// Edit autoresponder
+	if(isset($_POST['send'])
-	if (isset($_POST['send'])
+	   && $_POST['send'] == 'send')
-	   && $_POST['send'] == 'send'
+	{
-	) {
 		$account = trim($_POST['account']);
 		$subject = trim($_POST['subject']);
 		$message = trim($_POST['message']);
@@ -120,36 +135,49 @@ if ($action == 'add') {
 		$ts_from = -1;
 		$ts_until = -1;
 
-		if ($date_from_off > -1) {
+		if($date_from_off > -1)
+		{
 			$date_from = $_POST['date_from'];
 			$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
 		}
-		if ($date_until_off > -1) {
+		if($date_until_off > -1)
+		{
 			$date_until = $_POST['date_until'];
 			$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
 		}	
 
-		if (empty($account)
+		if(empty($account)
 		   || empty($subject)
-		   || empty($message)
+		   || empty($message))
-		) {
+		{
 			standard_error('missingfields');
 		}
 
 		// Does account exist?
+
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-		if ($db->num_rows($result) == 0)
+
+		if($db->num_rows($result) == 0)
 		{
 			standard_error('accountnotexisting');
 		}
 
 		// Does autoresponder exist?
+
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-		if ($db->num_rows($result) == 0) {
+
+		if($db->num_rows($result) == 0)
+		{
 			standard_error('invalidautoresponder');
 		}
 
-		$ResponderActive = (isset($_POST['active']) && $_POST['active'] == '1') ? 1 : 0;
+		$ResponderActive = 0;
+
+		if(isset($_POST['active'])
+		   && $_POST['active'] == '1')
+		{
+			$ResponderActive = 1;
+		}
 
 		$db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "`
 			SET `message` = '" . $db->escape($message) . "',
@@ -166,8 +194,11 @@ if ($action == 'add') {
 	$email = trim(htmlspecialchars($_GET['email']));
 
 	// Get account data
+
 	$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1");
-	if ($db->num_rows($result) == 0) {
+
+	if($db->num_rows($result) == 0)
+	{
 		standard_error('invalidautoresponder');
 	}
 
@@ -178,43 +209,56 @@ if ($action == 'add') {
 	$date_from = (int)$row['date_from'];
 	$date_until = (int)$row['date_until'];
 	
-	if ($date_from == -1) {
+	if($date_from == -1)
+	{
 		$deactivated = '-1';
-		$date_from = '';
+	}
-	} else {
+	else
+	{
 		$deactivated = '0';
 		$date_from = date('d-m-Y', $date_from);
 	}
 	$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
 	
-	if ($date_until == -1) {
+	if($date_until == -1)
+	{
 		$deactivated = '-1';
-		$date_until = '';
+		$date_until = '-1';
-	} else {
+	}
+	else
+	{
 		$deactivated = '0';
 		$date_until = date('d-m-Y', $date_until);
 	}
 	$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
 
-	//$isactive = makeyesno('active', '1', '0', $row['enabled']);
+	$checked = '';
 
-	$autoresponder_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_edit.php';
+	if($row['enabled'] == 1)
-	$autoresponder_edit_form = htmlform::genHTMLForm($autoresponder_edit_data);
+	{
+		$checked = "checked=\"checked\"";
+	}
 
-	$title = $autoresponder_edit_data['autoresponder_edit']['title'];
+	eval("echo \"" . getTemplate("email/autoresponder_edit") . "\";");
-	$image = $autoresponder_edit_data['autoresponder_edit']['image'];
+}
 
-	eval("echo \"" . getTemplate('autoresponder/autoresponder_edit') . "\";");
+// Delete autoresponder
-} elseif ($action == 'delete') {
+
-	// Delete autoresponder
+else
-	if (isset($_POST['send'])
+
-	   && $_POST['send'] == 'send'
+if($action == "delete")
-	) {
+{
+	if(isset($_POST['send'])
+	   && $_POST['send'] == 'send')
+	{
 		$account = trim($_POST['account']);
 
 		// Does autoresponder exist?
+
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-		if ($db->num_rows($result) == 0) {
+
+		if($db->num_rows($result) == 0)
+		{
 			standard_error('invalidautoresponder');
 		}
 
@@ -228,25 +272,37 @@ if ($action == 'add') {
 
 	$email = trim(htmlspecialchars($_GET['email']));
 	ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email));
-} else {
+}
-	// List existing autoresponders
+
+// List existing autoresponders
+
+else 
+{
 	$autoresponder = '';
-	$count = 0;
 	$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC");
 
-	while ($row = $db->fetch_array($result)) {
+	while($row = $db->fetch_array($result))
-		if ($row['date_from'] == -1 && $row['date_until'] == -1) {
+	{
+		if($row['date_from'] == -1 && $row['date_until'] == -1)
+		{
 			$activated_date = $lng['panel']['not_activated'];
-		} elseif($row['date_from'] == -1 && $row['date_until'] != -1) {
+		}
+		elseif($row['date_from'] == -1 && $row['date_until'] != -1)
+		{
 			$activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']);
-		} elseif($row['date_from'] != -1 && $row['date_until'] == -1) {
+		}
+		elseif($row['date_from'] != -1 && $row['date_until'] == -1)
+		{
 			$activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']);
-		} else {
+		}	
+		else
+		{
 			$activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']);
 		}
-		eval("\$autoresponder.=\"" . getTemplate('autoresponder/autoresponder_autoresponder') . "\";");
+		eval("\$autoresponder.=\"" . getTemplate("email/autoresponder_autoresponder") . "\";");
-		$count++;
 	}	
 
-	eval("echo \"" . getTemplate('autoresponder/autoresponder') . "\";");
+	eval("echo \"" . getTemplate("email/autoresponder") . "\";");
 }
+
+?>

customer_domains.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -50,7 +50,7 @@ elseif($page == 'domains')
 			'd.aliasdomain' => $lng['domains']['aliasdomain']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_ipandport`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -151,15 +151,6 @@ elseif($page == 'domains')
 						$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
 					}
 
-					// get ssl-ips if activated
-					// FIXME for multi-ip later
-					$show_ssledit = false;
-					if ($settings['system']['use_ssl'] == '1'
-							&& $row['ssl_ipandport'] != 0
-							&& $row['caneditdomain'] == '1'
-					) {
-						$show_ssledit = true;
-					}
 					$row = htmlentities_array($row);
 					eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
 				}
@@ -205,10 +196,7 @@ elseif($page == 'domains')
 				$result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 				$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				inserttask('1');
-
-				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
-
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 			else
@@ -261,17 +249,8 @@ elseif($page == 'domains')
 				if(!preg_match('/^https?\:\/\//', $path)
 				   || !validateUrl($idna_convert->encode($path)))
 				{
-					// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+					$path = $userinfo['documentroot'] . '/' . $path;
-					// set default path to subdomain or domain name
+					$path = makeCorrectDir($path);
-					if((($path == '') || ($path == '/'))
-						&& $settings['system']['documentroot_use_default_value'] == 1)
-					{
-						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
-					}
-					else
-					{
-						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
-					}
 					if (strstr($path, ":") !== FALSE)
 					{
 						standard_error('pathmaynotcontaincolon');
@@ -351,6 +330,7 @@ elseif($page == 'domains')
 								`isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', 
 								`openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "', 
 								`openbasedir_path` = '" . $db->escape($openbasedir_path) . "', 
+								`safemode` = '" . $db->escape($domain_check['safemode']) . "', 
 								`speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "', 
 								`specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "', 
 								`ssl_redirect` = '" . $ssl_redirect . "', 
@@ -366,10 +346,7 @@ elseif($page == 'domains')
 					$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 					$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
 					inserttask('1');
-
-					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
-
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
@@ -391,9 +368,9 @@ elseif($page == 'domains')
 					$aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
 				}
 
-				$redirectcode = '';
 				if($settings['customredirect']['enabled'] == '1')
 				{
+					$redirectcode = '';
 					$codes = getRedirectCodesArray();
 					foreach($codes as $rc)
 					{
@@ -401,22 +378,9 @@ elseif($page == 'domains')
 					}
 				}
 
-				// check if we at least have one ssl-ip/port, #1179
+				$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
-				$ssl_ipsandports = '';
-				$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
-				if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
-					$ssl_ipsandports = 'notempty';
-				}
-
 				$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
 				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
-
-				$subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php';
-				$subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data);
-
-				$title = $subdomain_add_data['domain_add']['title'];
-				$image = $subdomain_add_data['domain_add']['image'];
-
 				eval("echo \"" . getTemplate("domains/domains_add") . "\";");
 			}
 		}
@@ -424,7 +388,7 @@ elseif($page == 'domains')
 	elseif($action == 'edit'
 	       && $id != 0)
 	{
-		$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
+		$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
 		$alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\'');
 		$alias_check = $alias_check['count'];
 		$_doredirect = false;
@@ -450,17 +414,8 @@ elseif($page == 'domains')
 				if(!preg_match('/^https?\:\/\//', $path)
 				   || !validateUrl($idna_convert->encode($path)))
 				{
-					// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+					$path = $userinfo['documentroot'] . '/' . $path;
-					// set default path to subdomain or domain name
+					$path = makeCorrectDir($path);
-					if((($path == '') || ($path == '/'))
-						&& $settings['system']['documentroot_use_default_value'] == 1)
-					{
-						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
-					}
-					else
-					{
-						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
-					}
 					if (strstr($path, ":") !== FALSE)
 					{
 						standard_error('pathmaynotcontaincolon');
@@ -559,10 +514,7 @@ elseif($page == 'domains')
 						$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
 						$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 						inserttask('1');
-
-						// Using nameserver, insert a task which rebuilds the server config
 						inserttask('4');
-
 					}
 
 					redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -582,17 +534,10 @@ elseif($page == 'domains')
 
 				if(preg_match('/^https?\:\/\//', $result['documentroot'])
 				   && validateUrl($idna_convert->encode($result['documentroot']))
-				) {
+				   && $settings['panel']['pathedit'] == 'Dropdown')
-					if($settings['panel']['pathedit'] == 'Dropdown')
+				{
-					{
+					$urlvalue = $result['documentroot'];
-						$urlvalue = $result['documentroot'];
+					$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
-						$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
-					}
-					else
-					{
-						$urlvalue = '';
-						$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot'], true);						
-					}
 				}
 				else
 				{
@@ -600,10 +545,10 @@ elseif($page == 'domains')
 					$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']);
 				}
 
-				$redirectcode = '';
 				if($settings['customredirect']['enabled'] == '1')
 				{
 					$def_code = getDomainRedirectId($id);
+					$redirectcode = '';
 					$codes = getRedirectCodesArray();
 					foreach($codes as $rc)
 					{
@@ -611,13 +556,9 @@ elseif($page == 'domains')
 					}
 				}
 
-				// check if we at least have one ssl-ip/port, #1179
+				$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
-				$ssl_ipsandports = '';
+				$iswildcarddomain = makeyesno('iswildcarddomain', '1', '0', $result['iswildcarddomain']);
-				$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
+				$isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
-				if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
-					$ssl_ipsandports = 'notempty';
-				}
-
 				$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
 
 				$result_ipandport = $db->query_first("SELECT `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` WHERE `id`='".(int)$result['ipandport']."'");
@@ -628,12 +569,6 @@ elseif($page == 'domains')
 				$domainip = $result_ipandport['ip'];
 				$result = htmlentities_array($result);
 
-				$subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php';
-				$subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data);
-
-				$title = $subdomain_edit_data['domain_edit']['title'];
-				$image = $subdomain_edit_data['domain_edit']['image'];
-
 				eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
 			}
 		}
@@ -643,127 +578,5 @@ elseif($page == 'domains')
 		}
 	}
 }
-elseif ($page == 'domainssleditor') {
-
-	if ($action == ''
-			|| $action == 'view'
-	) {
-		if (isset($_POST['send'])
-				&& $_POST['send'] == 'send'
-		) {
-
-			$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
-			$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
-			$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
-			$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
-			$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
-
-			if ($ssl_cert_file != '' && $ssl_key_file == '') {
-				standard_error('sslcertificateismissingprivatekey');
-			}
-
-			$do_verify = true;
-
-			// no cert-file given -> forget everything
-			if ($ssl_cert_file == '') {
-				$ssl_key_file = '';
-				$ssl_ca_file = '';
-				$ssl_cert_chainfile = '';
-				$do_verify = false;
-			}
-
-			// verify certificate content
-			if ($do_verify) {
-				// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
-				// openssl_x509_parse() returns information about the supplied x509cert, including fields such as 
-				// subject name, issuer name, purposes, valid from and valid to dates etc.
-				$cert_content = openssl_x509_parse($ssl_cert_file);
-
-				if (is_array($cert_content)
-						&& isset($cert_content['subject'])
-						&& isset($cert_content['subject']['CN'])
-				) {
-					// TODO self-signed certs might differ and don't need/want this
-					/*
-					$domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'");
-					if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) {
-						standard_error('sslcertificatewrongdomain');
-					}
-					*/
-
-					// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
-					// Checks whether the given key is the private key that corresponds to cert.
-					if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
-						standard_error('sslcertificateinvalidcertkeypair');
-					}
-
-					// check optional stuff
-					if ($ssl_ca_file != '') {
-						$ca_content = openssl_x509_parse($ssl_ca_file);
-						if (!is_array($ca_content)) {
-							// invalid
-							standard_error('sslcertificateinvalidca');
-						}
-					}
-					if ($ssl_cert_chainfile != '') {
-						$chain_content = openssl_x509_parse($ssl_cert_chainfile);
-						if (!is_array($chain_content)) {
-							// invalid
-							standard_error('sslcertificateinvalidchain');
-						}
-					}
-				} else {
-					standard_error('sslcertificateinvalidcert');
-				}
-			}
-
-			// Add/Update database entry
-			$qrystart = "UPDATE ";
-			$qrywhere = "WHERE ";
-			if ($do_insert) {
-				$qrystart = "INSERT INTO ";
-				$qrywhere = ", ";
-			}
-			$db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
-					`ssl_cert_file` = '".$db->escape($ssl_cert_file)."',
-					`ssl_key_file` = '".$db->escape($ssl_key_file)."',
-					`ssl_ca_file` = '".$db->escape($ssl_ca_file)."',
-					`ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."'
-					".$qrywhere." `domainid`='".(int)$id."';"
-			);
-
-			// insert task to re-generate webserver-configs (#1260)
-			inserttask('1');
-
-			// back to domain overview
-			redirectTo($filename, array('page' => 'domains', 's' => $s));
-		}
-
-		$result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
-			WHERE `domainid`='".(int)$id."';"
-		);
-
-		$do_insert = false;
-		// if no entry can be found, behave like we have empty values
-		if (!is_array($result) || !isset($result['ssl_cert_file'])) {
-			$result = array(
-				'ssl_cert_file' => '',
-				'ssl_key_file' => '',
-				'ssl_ca_file' => '',
-				'ssl_cert_chainfile' => ''
-			);
-			$do_insert = true;
-		}
-
-		$result = htmlentities_array($result);
-
-		$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
-		$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
-
-		$title = $ssleditor_data['domain_ssleditor']['title'];
-		$image = $ssleditor_data['domain_ssleditor']['image'];
-
-		eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
-	}
-}
 
+?>

customer_email.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -237,7 +237,7 @@ elseif($page == 'emails')
 					standard_error('emailiswrong', $email_full);
 				}
 
-				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE (`email` = '" . strtolower($db->escape($email)) . "' OR `email_full` = '" . strtolower($db->escape($email_full)) . "') AND `customerid`='" . (int)$userinfo['customerid'] . "'");
+				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE ( `email`='" . $db->escape($email) . "' OR `email_full` = '" . $db->escape($email_full) . "' ) AND `customerid`='" . (int)$userinfo['customerid'] . "'");
 
 				if($email == ''
 				   || $email_full == ''
@@ -253,7 +253,7 @@ elseif($page == 'emails')
 				{
 					standard_error('maindomainnonexist', $domain);
 				}
-				elseif(strtolower($email_check['email_full']) == strtolower($email_full))
+				elseif($email_check['email_full'] == $email_full)
 				{
 					standard_error('emailexistalready', $email_full);
 				}
@@ -281,20 +281,7 @@ elseif($page == 'emails')
 					$domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']);
 				}
 
-				//$iscatchall = makeyesno('iscatchall', '1', '0', '0');
+				$iscatchall = makeyesno('iscatchall', '1', '0', '0');
-
-				$email_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_add.php';
-
-				if ( $settings['catchall']['catchall_enabled'] != '1' )
-				{
-					unset($email_add_data['emails_add']['sections']['section_a']['fields']['iscatchall']);
-				}
-
-				$email_add_form = htmlform::genHTMLForm($email_add_data);
-
-				$title = $email_add_data['emails_add']['title'];
-				$image = $email_add_data['emails_add']['image'];
-
 				eval("echo \"" . getTemplate("email/emails_add") . "\";");
 			}
 		}
@@ -334,60 +321,40 @@ elseif($page == 'emails')
 
 			$destinations_count = count($result['destination']);
 			$result = htmlentities_array($result);
-
-			$email_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_edit.php';
-
-			if ( $settings['catchall']['catchall_enabled'] != '1' )
-			{
-				unset($email_edit_data['emails_edit']['sections']['section_a']['fields']['mail_catchall']);
-			}
-
-			$email_edit_form = htmlform::genHTMLForm($email_edit_data);
-
-			$title = $email_edit_data['emails_edit']['title'];
-			$image = $email_edit_data['emails_edit']['image'];
-			
 			eval("echo \"" . getTemplate("email/emails_edit") . "\";");
 		}
 	}
 	elseif($action == 'togglecatchall'
 	       && $id != 0)
 	{
-		if ( $settings['catchall']['catchall_enabled'] == '1' )
+		$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-		{
-			$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 
-			if(isset($result['email'])
+		if(isset($result['email'])
-			   && $result['email'] != '')
+		   && $result['email'] != '')
+		{
+			if($result['iscatchall'] == '1')
 			{
-				if($result['iscatchall'] == '1')
+				$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
+			}
+			else
+			{
+				$email_parts = explode('@', $result['email_full']);
+				$email = '@' . $email_parts[1];
+				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
+
+				if($email_check['email'] == $email)
 				{
-					$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
+					standard_error('youhavealreadyacatchallforthisdomain');
+					exit;
 				}
 				else
 				{
-					$email_parts = explode('@', $result['email_full']);
+					$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
-					$email = '@' . $email_parts[1];
+					$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
-					$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
-
-					if($email_check['email'] == $email)
-					{
-						standard_error('youhavealreadyacatchallforthisdomain');
-						exit;
-					}
-					else
-					{
-						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
-						$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
-					}
 				}
-
-				redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
 			}
-		}
+
-		else
+			redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
-		{
-			standard_error(array('operationnotpermitted', 'featureisdisabled'), 'Catchall');
 		}
 	}
 }
@@ -458,42 +425,11 @@ elseif($page == 'accounts')
 							$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
 						}
 
-						$cryptPassword = makeCryptPassword($password);
+						$db->query("INSERT INTO `" . TABLE_MAIL_USERS . "` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($email_full) . "', '" . $db->escape($username) . "', " . ($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "'," : '') . " ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_full . '/') . "', '" . (int)$settings['system']['vmail_uid'] . "', '" . (int)$settings['system']['vmail_gid'] . "', '" . (int)$result['domainid'] . "', 'y', '" . (int)$quota . "', '" . (int)$userinfo['imap'] . "', '" . (int)$userinfo['pop3'] . "')");
-
-						$email_user=substr($email_full,0,strrpos($email_full,"@"));
-						$email_domain=substr($email_full,strrpos($email_full,"@")+1);
-						$maildirname=trim($settings['system']['vmail_maildirname']);
-						// Add trailing slash to Maildir if needed
-						$maildirpath=$maildirname;
-						if (!empty($maildirname) and substr($maildirname,-1) != "/") $maildirpath.="/";
-
-						$db->query("INSERT INTO `" . TABLE_MAIL_USERS . 
-							"` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) ".
-							"VALUES (".
-							"'" . (int)$userinfo['customerid'] . "', ".
-							"'" . $db->escape($email_full) . "', ".
-							"'" . $db->escape($username) . "', " .
-							($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "', " : '') .
-							"'" . $db->escape($cryptPassword) . "', ".
-							"'" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_domain . "/" . $email_user . "/" . $maildirpath) . "', ".
-							"'" . (int)$settings['system']['vmail_uid'] . "', ".
-							"'" . (int)$settings['system']['vmail_gid'] . "', ".
-							"'" . (int)$result['domainid'] . "', ".
-							"'y', ".
-							"'" . (int)$quota . "', ".
-							"'" . (int)$userinfo['imap'] . "', ".
-							"'" . (int)$userinfo['pop3'] . "')");
-
 						$popaccountid = $db->insert_id();
 						$result['destination'].= ' ' . $email_full;
-						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET ".
+						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', `popaccountid` = '" . (int)$popaccountid . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-							"`destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', ".
+						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used`=`email_accounts_used`+1, `email_quota_used`=`email_quota_used`+" . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
-							"`popaccountid` = '" . (int)$popaccountid . "' ".
-							"WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET ".
-							"`email_accounts_used`=`email_accounts_used`+1, ".
-							"`email_quota_used`=`email_quota_used`+" . (int)$quota . " ".
-							"WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 						$log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'");
 						$replace_arr = array(
 							'EMAIL' => $email_full,
@@ -512,7 +448,7 @@ elseif($page == 'accounts')
 							$mail->Subject = $mail_subject;
 							$mail->AltBody = $mail_body;
 							$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
-							$mail->AddAddress($email_full);
+							$mail->AddAddress($email_full, getCorrectUserSalutation($userinfo));
 							$mail->Send();
 						} catch(phpmailerException $e) {
 							$mailerr_msg = $e->errorMessage();
@@ -569,13 +505,6 @@ elseif($page == 'accounts')
 					$result['email_full'] = $idna_convert->decode($result['email_full']);
 					$result = htmlentities_array($result);
 					$quota = $settings['system']['mail_quota'];
-
-					$account_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addaccount.php';
-					$account_add_form = htmlform::genHTMLForm($account_add_data);
-
-					$title = $account_add_data['emails_addaccount']['title'];
-					$image = $account_add_data['emails_addaccount']['image'];
-
 					eval("echo \"" . getTemplate("email/account_add") . "\";");
 				}
 			}
@@ -607,21 +536,13 @@ elseif($page == 'accounts')
 				$password = validatePassword($password);
 				
 				$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'");
-				$cryptPassword = makeCryptPassword($password);
+				$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
-				$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
 				redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
 			}
 			else
 			{
 				$result['email_full'] = $idna_convert->decode($result['email_full']);
 				$result = htmlentities_array($result);
-
-				$account_changepw_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangepasswd.php';
-				$account_changepw_form = htmlform::genHTMLForm($account_changepw_data);
-
-				$title = $account_changepw_data['emails_accountchangepasswd']['title'];
-				$image = $account_changepw_data['emails_accountchangepasswd']['image'];
-
 				eval("echo \"" . getTemplate("email/account_changepw") . "\";");
 			}
 		}
@@ -663,13 +584,6 @@ elseif($page == 'accounts')
 			{
 				$result['email_full'] = $idna_convert->decode($result['email_full']);
 				$result = htmlentities_array($result);
-
-				$quota_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangequota.php';
-				$quota_edit_form = htmlform::genHTMLForm($quota_edit_data);
-
-				$title = $quota_edit_data['emails_accountchangequota']['title'];
-				$image = $quota_edit_data['emails_accountchangequota']['image'];
-        
 				eval("echo \"" . getTemplate("email/account_changequota") . "\";");
 			}
 		}
@@ -764,13 +678,6 @@ elseif($page == 'forwarders')
 				{
 					$result['email_full'] = $idna_convert->decode($result['email_full']);
 					$result = htmlentities_array($result);
-
-					$forwarder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addforwarder.php';
-					$forwarder_add_form = htmlform::genHTMLForm($forwarder_add_data);
-
-					$title = $forwarder_add_data['emails_addforwarder']['title'];
-					$image = $forwarder_add_data['emails_addforwarder']['image'];
-
 					eval("echo \"" . getTemplate("email/forwarder_add") . "\";");
 				}
 			}

customer_extras.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -39,30 +39,6 @@ if($page == 'overview')
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras");
 	eval("echo \"" . getTemplate("extras/extras") . "\";");
 }
-elseif($page == 'backup')
-{
-    $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras_backup");
-
-    $result = $db->query("SELECT `backup_enabled` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
-    $row = $db->fetch_array($result);
-
-    $backup_enabled = makeyesno('backup_enabled', '1', '0', $row['backup_enabled']);
-
-    if(isset($_POST['send']) && $_POST['send'] == 'send'){
-	$backup_enabled = ($_POST['backup_enabled'] == '1' ? '1' : '0');
-	
-        $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `backup_enabled`='" . $backup_enabled . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
-	redirectTo($filename, Array('page' => $page, 's' => $s));
-    }
-
-    $backup_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.backup.php';
-	$backup_form = htmlform::genHTMLForm($backup_data);
-
-	$title = $backup_data['backup']['title'];
-	$image = $backup_data['backup']['image'];
-    
-    eval("echo \"" . getTemplate("extras/backup") . "\";");
-}
 elseif($page == 'htpasswds')
 {
 	if($action == '')
@@ -185,13 +161,6 @@ elseif($page == 'htpasswds')
 		else
 		{
 			$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
-
-			$htpasswd_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_add.php';
-			$htpasswd_add_form = htmlform::genHTMLForm($htpasswd_add_data);
-
-			$title = $htpasswd_add_data['htpasswd_add']['title'];
-			$image = $htpasswd_add_data['htpasswd_add']['image'];
-
 			eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";");
 		}
 	}
@@ -251,13 +220,6 @@ elseif($page == 'htpasswds')
 				}
 
 				$result = htmlentities_array($result);
-
-				$htpasswd_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_edit.php';
-				$htpasswd_edit_form = htmlform::genHTMLForm($htpasswd_edit_data);
-
-				$title = $htpasswd_edit_data['htpasswd_edit']['title'];
-				$image = $htpasswd_edit_data['htpasswd_edit']['image'];
-
 				eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";");
 			}
 		}
@@ -352,28 +314,18 @@ elseif($page == 'htaccess')
 				standard_error('invalidpath');
 			}
 
-			if(isset($_POST['options_cgi'])
+			if(isset($_POST['options_cgi']))
-				&& (int)$_POST['options_cgi'] != 0
+			{
-			) {
+				$options_cgi = intval($_POST['options_cgi']);
-				$options_cgi = '1';
 			}
 			else
 			{
 				$options_cgi = '0';
 			} 
 
-			$error404path = '';
+			$error404path = correctErrorDocument($_POST['error404path']);
-			if (isset($_POST['error404path'])) {
+			$error403path = correctErrorDocument($_POST['error403path']);
-				$error404path = correctErrorDocument($_POST['error404path']);
+			$error500path = correctErrorDocument($_POST['error500path']);
-			}
-			$error403path = '';
-			if (isset($_POST['error403path'])) {
-				$error403path = correctErrorDocument($_POST['error403path']);
-			}
-			$error500path = '';
-			if (isset($_POST['error500path'])) {
-				$error500path = correctErrorDocument($_POST['error500path']);
-			}
 
 			if($path_dupe_check['path'] == $path)
 			{
@@ -402,18 +354,9 @@ elseif($page == 'htaccess')
 		else
 		{
 			$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
-			$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
-			/*
 			$options_indexes = makeyesno('options_indexes', '1', '0', '0');
+			$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
 			$options_cgi = makeyesno('options_cgi', '1', '0', '0');
-			*/
-
-			$htaccess_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_add.php';
-			$htaccess_add_form = htmlform::genHTMLForm($htaccess_add_data);
-
-			$title = $htaccess_add_data['htaccess_add']['title'];
-			$image = $htaccess_add_data['htaccess_add']['image'];
-
 			eval("echo \"" . getTemplate("extras/htaccess_add") . "\";");
 		}
 	}
@@ -471,19 +414,10 @@ elseif($page == 'htaccess')
 				$result['error404path'] = $result['error404path'];
 				$result['error403path'] = $result['error403path'];
 				$result['error500path'] = $result['error500path'];
-				$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
-				/*
 				$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
+				$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
 				$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
-				*/
 				$result = htmlentities_array($result);
-
-				$htaccess_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_edit.php';
-				$htaccess_edit_form = htmlform::genHTMLForm($htaccess_edit_data);
-	
-				$title = $htaccess_edit_data['htaccess_edit']['title'];
-				$image = $htaccess_edit_data['htaccess_edit']['image'];
-
 				eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";");
 			}
 		}

customer_ftp.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -22,27 +22,34 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-require('./lib/init.php');
 
-$id = 0;
+require ("./lib/init.php");
-if (isset($_POST['id'])) {
+
+if(isset($_POST['id']))
+{
 	$id = intval($_POST['id']);
-} elseif(isset($_GET['id'])) {
+}
+elseif(isset($_GET['id']))
+{
 	$id = intval($_GET['id']);
 }
 
-if ($page == 'overview') {
+if($page == 'overview')
+{
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
-	eval("echo \"" . getTemplate('ftp/ftp') . "\";");
+	eval("echo \"" . getTemplate("ftp/ftp") . "\";");
-} elseif ($page == 'accounts') {
+}
-	if ($action == '') {
+elseif($page == 'accounts')
+{
+	if($action == '')
+	{
 		$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
 		$fields = array(
 			'username' => $lng['login']['username'],
 			'homedir' => $lng['panel']['path']
 		);
 		$paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "'  AND `username` NOT LIKE '%_backup'" . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -52,18 +59,23 @@ if ($page == 'overview') {
 		$count = 0;
 		$accounts = '';
 
-		while ($row = $db->fetch_array($result)) {
+		while($row = $db->fetch_array($result))
-			if ($paging->checkDisplay($i)) {
+		{
-				if (strpos($row['homedir'], $userinfo['documentroot']) === 0) {
+			if($paging->checkDisplay($i))
+			{
+				if(strpos($row['homedir'], $userinfo['documentroot']) === 0)
+				{
 					$row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot']));
-				} else {
+				}
+				else
+				{
 					$row['documentroot'] = $row['homedir'];
 				}
 
 				$row['documentroot'] = makeCorrectDir($row['documentroot']);
 				
 				$row = htmlentities_array($row);
-				eval("\$accounts.=\"" . getTemplate('ftp/accounts_account') . "\";");
+				eval("\$accounts.=\"" . getTemplate("ftp/accounts_account") . "\";");
 				$count++;
 			}
 
@@ -71,87 +83,119 @@ if ($page == 'overview') {
 		}
 
 		$ftps_count = $db->num_rows($result);
-		eval("echo \"" . getTemplate('ftp/accounts') . "\";");
+		eval("echo \"" . getTemplate("ftp/accounts") . "\";");
-	} elseif ($action == 'delete' && $id != 0) {
+	}
+	elseif($action == 'delete'
+	       && $id != 0)
+	{
 		$result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 
-		if (isset($result['username'])
+		if(isset($result['username'])
-		   && $result['username'] != $userinfo['loginname']
+		   && $result['username'] != $userinfo['loginname'])
-		) {
+		{
-			if (isset($_POST['send'])
+			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send'
+			   && $_POST['send'] == 'send')
-			) {
+			{
 				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'");
-				$result = $db->query_first("SELECT `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+				$result = $db->query("SELECT `username` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-				$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($result['username']) . "'");
+				while($row = $db->fetch_array($result))
+				{
+					$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($row['username']) . "'");
+				}
 				$db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 				$log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'");
 				$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 
-				$resetaccnumber = ($userinfo['ftps_used'] == '1') ? " , `ftp_lastaccountnumber`='0'" : '';
+				if($userinfo['ftps_used'] == '1')
+				{
+					$resetaccnumber = " , `ftp_lastaccountnumber`='0'";
+				}
+				else
+				{
+					$resetaccnumber = '';
+				}
 
 				// refs #293
-				if (isset($_POST['delete_userfiles'])
+				if(isset($_POST['delete_userfiles'])
-				  && (int)$_POST['delete_userfiles'] == 1
+				  && (int)$_POST['delete_userfiles'] == 1)
-				) {
+				{
 					inserttask('8', $userinfo['loginname'], $result['homedir']);
 				}
 
 				$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			} else {
+			}
+			else
+			{
 				ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
 			}
-		} else {
+		}
+		else
+		{
 			standard_error('ftp_cantdeletemainaccount');
 		}
-	} elseif ($action == 'add') {
+	}
-		if ($userinfo['ftps_used'] < $userinfo['ftps']
+	elseif($action == 'add')
-		   || $userinfo['ftps'] == '-1'
+	{
-		) {
+		if($userinfo['ftps_used'] < $userinfo['ftps']
-			if (isset($_POST['send'])
+		   || $userinfo['ftps'] == '-1')
-			   && $_POST['send'] == 'send'
+		{
-			) {
+			if(isset($_POST['send'])
+			   && $_POST['send'] == 'send')
+			{
 				$path = validate($_POST['path'], 'path');
 				$password = validate($_POST['ftp_password'], 'password');
 				$password = validatePassword($password);
 
-				$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
+				$sendinfomail = intval($_POST['sendinfomail']);
-				if ($sendinfomail != 1) {
+				if($sendinfomail != 1)
+				{
 					$sendinfomail = 0;
 				}
 
-				if ($settings['customer']['ftpatdomain'] == '1') {
+				if($settings['customer']['ftpatdomain'] == '1')
+				{
 					$ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
-					if ($ftpusername == '') {
+					if($ftpusername == '')
+					{
 						standard_error(array('stringisempty', 'username'));
 					}
 					$ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain'));
 					$ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
-					if ($ftpdomain_check['domain'] != $ftpdomain) {
+					if($ftpdomain_check['domain'] != $ftpdomain)
+					{
 						standard_error('maindomainnonexist', $domain);
 					}
 					$username = $ftpusername . "@" . $ftpdomain;
-				} else {
+				}
+				else
+				{
 					$username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1);
 				}
 				
 				$username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\'');
 				
-				if (!empty($username_check) && $username_check['username'] = $username) {
+				if(!empty($username_check) && $username_check['username'] = $username)
+				{
 					standard_error('usernamealreadyexists', $username);
-				} elseif ($password == '') {
+				}
+				elseif($password == '')
+				{
 					standard_error(array('stringisempty', 'mypassword'));
-				} elseif ($path == '') {
+				}
+				elseif($path == '')
+				{
 					standard_error('patherror');
-				} else {
+				}
+				else
+				{
 					$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
 					
-					$cryptPassword = makeCryptPassword($password);
+					$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
-					$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
 					$result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'");
-					while ($row = $db->fetch_array($result)) {
+					while($row = $db->fetch_array($result))
-						$db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')");
+					{
+						$db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row[bytes_in_used]) . "', '0', '0', '0', '0', '0')");
 					}
 					$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'");
 					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`+1, `ftp_lastaccountnumber`=`ftp_lastaccountnumber`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
@@ -159,10 +203,10 @@ if ($page == 'overview') {
 					$log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'");
 					inserttask(5);
 
-					if ($sendinfomail == 1) {
+					if($sendinfomail == 1)
+					{
 						$replace_arr = array(
-							'SALUTATION' => getCorrectUserSalutation($userinfo),
+							'CUST_NAME' => getCorrectUserSalutation($userinfo),
-							'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
 							'USR_NAME' => $username,
 							'USR_PASS' => $password,
 							'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot'])))
@@ -199,80 +243,73 @@ if ($page == 'overview') {
 
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
-			} else {
+			}
+			else
+			{
 				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/');
 
-				if ($settings['customer']['ftpatdomain'] == '1') {
+				if($settings['customer']['ftpatdomain'] == '1')
-					$domainlist = array();
+				{
 					$domains = '';
 
 					$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 
-					while ($row_domain = $db->fetch_array($result_domains)) {
+					while($row_domain = $db->fetch_array($result_domains))
-						$domainlist[] =  $row_domain['domain'];
+					{
-					}
+						$domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
-
-					sort($domainlist);
-
-					if (isset($domainlist[0]) && $domainlist[0] != '') {
-						foreach ($domainlist as $dom) {
-							$domains .= makeoption($idna_convert->decode($dom), $dom);
-						}
 					}
 				}
 
-				//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
+				$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
 
-				$ftp_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_add.php';
+				eval("echo \"" . getTemplate("ftp/accounts_add") . "\";");
-				$ftp_add_form = htmlform::genHTMLForm($ftp_add_data);
-
-				$title = $ftp_add_data['ftp_add']['title'];
-				$image = $ftp_add_data['ftp_add']['image'];
-
-				eval("echo \"" . getTemplate('ftp/accounts_add') . "\";");
 			}
 		}
-	} elseif ($action == 'edit' && $id != 0) {
+	}
+	elseif($action == 'edit'
+	       && $id != 0)
+	{
 		$result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 
-		if (isset($result['username'])
+		if(isset($result['username'])
-		   && $result['username'] != ''
+		   && $result['username'] != '')
-		) {
+		{
-			if (isset($_POST['send'])
+			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send'
+			   && $_POST['send'] == 'send')
-			) {
+			{
 				$path = validate($_POST['path'], 'path');
 				
 				$_setnewpass = false;
-				if (isset($_POST['ftp_password']) && $_POST['ftp_password'] != '') {
+				if(isset($_POST['ftp_password']) && $_POST['ftp_password'] != '')
+				{
 					$password = validate($_POST['ftp_password'], 'password');
 					$password = validatePassword($password);
 					$_setnewpass = true;
 				}
 
-				if ($_setnewpass) {
+				if($_setnewpass)
-					if ($password == '') {
+				{
+					if($password == '')
+					{
 						standard_error(array('stringisempty', 'mypassword'));
 						exit;
 					}
-					$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
+					else
-					$cryptPassword = makeCryptPassword($password);
+					{
-					$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+						$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
-						
+						$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-					// also update customers backup user password if password of main ftp user is changed
-					if(!preg_match('/' . $settings['customer']['ftpprefix'] . '/', $result['username'])){
-					    $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $result['username'] . "_backup'");
 					}
 				}
 				
-				if ($path != '') {
+				if($path != '')
+				{
 					$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
 					
-					if ($path != $result['homedir']) {
+					if($path != $result['homedir'])
-						if (!file_exists($path)) {
+					{
-							// it's the task for "new ftp" but that will 
+						if(!file_exists($path))
-							// create all directories and correct their permissions
+						{
-							inserttask(5);
+							mkDirWithCorrectOwnership($userinfo['documentroot'], $path, $result['uid'], $result['gid']);
 						}
 
 						$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'");
@@ -281,34 +318,37 @@ if ($page == 'overview') {
 				}
 
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			} else {
+			}
-				if (strpos($result['homedir'], $userinfo['documentroot']) === 0) {
+			else
+			{
+				if(strpos($result['homedir'], $userinfo['documentroot']) === 0)
+				{
 					$homedir = substr($result['homedir'], strlen($userinfo['documentroot']));
-				} else {
+				}
+				else
+				{
 					$homedir = $result['homedir'];
 				}
 				$homedir = makeCorrectDir($homedir);
 
 				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir);
 
-				if ($settings['customer']['ftpatdomain'] == '1') {
+				if($settings['customer']['ftpatdomain'] == '1')
+				{
 					$domains = '';
 
 					$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 
-					while ($row_domain = $db->fetch_array($result_domains)) {
+					while($row_domain = $db->fetch_array($result_domains))
-						$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
+					{
+						$domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
 					}
 				}
 				
-				$ftp_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_edit.php';
+				eval("echo \"" . getTemplate("ftp/accounts_edit") . "\";");
-				$ftp_edit_form = htmlform::genHTMLForm($ftp_edit_data);
-
-				$title = $ftp_edit_data['ftp_edit']['title'];
-				$image = $ftp_edit_data['ftp_edit']['image'];
-
-				eval("echo \"" . getTemplate('ftp/accounts_edit') . "\";");
 			}
 		}
 	}
 }
+
+?>

customer_index.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -22,32 +22,40 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-require('./lib/init.php');
 
-if ($action == 'logout') {
+require ("./lib/init.php");
-	$log->logAction(USR_ACTION, LOG_NOTICE, 'logged out');
 
-        $query = "DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'";
+if($action == 'logout')
-	if ($settings['session']['allow_multiple_login'] == '1') {
+{
-		$query .= " AND `hash` = '" . $s . "'";
+	$log->logAction(USR_ACTION, LOG_NOTICE, "logged out");
+
+	if($settings['session']['allow_multiple_login'] == '1')
+	{
+		$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0' AND `hash` = '" . $s . "'");
 	}
-	$db->query($query);
+	else
+	{
+		$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'");
+	}
+
 	redirectTo('index.php');
 	exit;
 }
 
-if ($page == 'overview') {
+if($page == 'overview')
+{
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index");
 	$domains = '';
 	$result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' ");
 	$domainArray = array();
 
-	while ($row = $db->fetch_array($result)) {
+	while($row = $db->fetch_array($result))
+	{
 		$domainArray[] = $idna_convert->decode($row['domain']);
 	}
 
 	natsort($domainArray);
-	$domains = implode(',<br />', $domainArray);
+	$domains = implode(', ', $domainArray);
 	$userinfo['email'] = $idna_convert->decode($userinfo['email']);
 	$yesterday = time() - (60 * 60 * 24);
 	$month = date('M Y', $yesterday);
@@ -69,49 +77,67 @@ if ($page == 'overview') {
 	$awaitingtickets = $opentickets['count'];
 	$awaitingtickets_text = '';
 
-	if ($opentickets > 0) {
+	if($opentickets > 0)
+	{
 		$awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>'));
 	}
 
-	eval("echo \"" . getTemplate('index/index') . "\";");
+	eval("echo \"" . getTemplate("index/index") . "\";");
-} elseif ($page == 'change_password') {
+}
-	if (isset($_POST['send']) && $_POST['send'] == 'send') {
+elseif($page == 'change_password')
+{
+	if(isset($_POST['send'])
+	   && $_POST['send'] == 'send')
+	{
 		$old_password = validate($_POST['old_password'], 'old password');
-		if (md5($old_password) != $userinfo['password']) {
+
+		if(md5($old_password) != $userinfo['password'])
+		{
 			standard_error('oldpasswordnotcorrect');
 			exit;
 		}
 
-		$new_password = validatePassword($_POST['new_password'], 'new password');
+		$new_password = validate($_POST['new_password'], 'new password');
-		$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm');
+		$new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
 
-		if ($old_password == '') {
+		if($old_password == '')
+		{
 			standard_error(array('stringisempty', 'oldpassword'));
-		} elseif($new_password == '') {
+		}
+		elseif($new_password == '')
+		{
 			standard_error(array('stringisempty', 'newpassword'));
-		} elseif($new_password_confirm == '') {
+		}
+		elseif($new_password_confirm == '')
+		{
 			standard_error(array('stringisempty', 'newpasswordconfirm'));
-		} elseif($new_password != $new_password_confirm) {
+		}
+		elseif($new_password != $new_password_confirm)
+		{
 			standard_error('newpasswordconfirmerror');
-		} else {
+		}
+		else
+		{
 			$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'");
 			$log->logAction(USR_ACTION, LOG_NOTICE, 'changed password');
 
-			if (isset($_POST['change_main_ftp'])
+			if(isset($_POST['change_main_ftp'])
-			   && $_POST['change_main_ftp'] == 'true'
+			   && $_POST['change_main_ftp'] == 'true')
-			) {
+			{
-				$cryptPassword = makeCryptPassword($new_password);
+				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($new_password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
-				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
 				$log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password');
 			}
 
-			if (isset($_POST['change_webalizer'])
+			if(isset($_POST['change_webalizer'])
-			   && $_POST['change_webalizer'] == 'true'
+			   && $_POST['change_webalizer'] == 'true')
-			) {
+			{
-				if (CRYPT_STD_DES == 1) {
+				if(CRYPT_STD_DES == 1)
+				{
 					$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
 					$new_webalizer_password = crypt($new_password, $saltfordescrypt);
-				} else {
+				}
+				else
+				{
 					$new_webalizer_password = crypt($new_password);
 				}
 
@@ -120,52 +146,44 @@ if ($page == 'overview') {
 
 			redirectTo($filename, Array('s' => $s));
 		}
-	} else {
-		eval("echo \"" . getTemplate('index/change_password') . "\";");
 	}
-} elseif ($page == 'change_language') {
+	else
-	if (isset($_POST['send']) && $_POST['send'] == 'send') {
+	{
+		eval("echo \"" . getTemplate("index/change_password") . "\";");
+	}
+}
+elseif($page == 'change_language')
+{
+	if(isset($_POST['send'])
+	   && $_POST['send'] == 'send')
+	{
 		$def_language = validate($_POST['def_language'], 'default language');
-		if (isset($languages[$def_language])) {
+
+		if(isset($languages[$def_language]))
+		{
 			$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 			$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'");
 			$log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
 		}
 
 		redirectTo($filename, Array('s' => $s));
-	} else {
+	}
+	else
+	{
+		$language_options = '';
+
 		$default_lang = $settings['panel']['standardlanguage'];
-		if ($userinfo['def_language'] != '') { 
+		if($userinfo['def_language'] != '') { 
 			$default_lang = $userinfo['def_language'];
 		}
 
-		$language_options = '';
+		while(list($language_file, $language_name) = each($languages))
-		while (list($language_file, $language_name) = each($languages)) {
+		{
-			$language_options .= makeoption($language_name, $language_file, $default_lang, true);
+			$language_options.= makeoption($language_name, $language_file, $default_lang, true);
 		}
 
-		eval("echo \"" . getTemplate('index/change_language') . "\";");
+		eval("echo \"" . getTemplate("index/change_language") . "\";");
-	}
-} elseif ($page == 'change_theme') {
-	if (isset($_POST['send']) && $_POST['send'] == 'send') {
-		$theme = validate($_POST['theme'], 'theme');
- 
-		$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
-		$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
-		$log->logAction(USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'");
-		redirectTo($filename, Array('s' => $s));
-	} else {
-		$default_theme = $settings['panel']['default_theme'];
-		if ($userinfo['theme'] != '') {
-			$default_theme = $userinfo['theme'];
-		}
-
-		$theme_options = '';
-		$themes_avail = getThemes();
-		foreach ($themes_avail as $t) {
-			$theme_options .= makeoption($t, $t, $default_theme, true);
-		}
-
-		eval("echo \"" . getTemplate('index/change_theme') . "\";");
 	}
 }
+
+?>

customer_mysql.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -22,22 +22,30 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
+
 $need_db_sql_data = true;
 $need_root_db_sql_data = true;
-require('./lib/init.php');
+require ("./lib/init.php");
 
-if (isset($_POST['id'])) {
+if(isset($_POST['id']))
+{
 	$id = intval($_POST['id']);
-} elseif(isset($_GET['id'])) {
+}
+elseif(isset($_GET['id']))
+{
 	$id = intval($_GET['id']);
 }
 
-if ($page == 'overview') {
+if($page == 'overview')
+{
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
 	$lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']);
-	eval("echo \"" . getTemplate('mysql/mysql') . "\";");
+	eval("echo \"" . getTemplate("mysql/mysql") . "\";");
-} elseif($page == 'mysqls') {
+}
-	if ($action == '') {
+elseif($page == 'mysqls')
+{
+	if($action == '')
+	{
 		$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
 		$fields = array(
 			'databasename' => $lng['mysql']['databasename'],
@@ -54,117 +62,125 @@ if ($page == 'overview') {
 		$count = 0;
 		$mysqls = '';
 
-		// Begin root-session
+		while($row = $db->fetch_array($result))
-		$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
+		{
-		while ($row = $db->fetch_array($result)) {
+			if($paging->checkDisplay($i))
-			if ($paging->checkDisplay($i)) {
+			{
 				$row = htmlentities_array($row);
-				$mbdata = $db_root->query_first("SELECT SUM( data_length + index_length) / 1024 / 1024 'MB' FROM information_schema.TABLES WHERE table_schema = '" . $db_root->escape($row['databasename']) . "' GROUP BY table_schema ;");
+				eval("\$mysqls.=\"" . getTemplate("mysql/mysqls_database") . "\";");
-				$row['size'] = number_format($mbdata['MB'], 3, '.', '');
-				eval("\$mysqls.=\"" . getTemplate('mysql/mysqls_database') . "\";");
 				$count++;
 			}
+
 			$i++;
 		}
-		$db_root->close();
-		// End root-session
 
 		$mysqls_count = $db->num_rows($result);
-		eval("echo \"" . getTemplate('mysql/mysqls') . "\";");
+		eval("echo \"" . getTemplate("mysql/mysqls") . "\";");
-	} elseif($action == 'delete' && $id != 0) {
+	}
-		$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
+	elseif($action == 'delete'
+	       && $id != 0)
+	{
+		$result = $db->query_first('SELECT `id`, `databasename`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
 
-		if (isset($result['databasename'])
+		if(isset($result['databasename'])
-		   && $result['databasename'] != ''
+		   && $result['databasename'] != '')
-		) {
+		{
-			if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) {
+			if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
+			{
 				$result['dbserver'] = 0;
 			}
 
-			if (isset($_POST['send'])
+			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send'
+			   && $_POST['send'] == 'send')
-			) {
+			{
 				// Begin root-session
-				$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
-				$log->logAction(USR_ACTION, LOG_INFO, "deleted database '" . $result['databasename'] . "'");
-				if (mysql_get_server_info() < '5.0.2') { 
-					// Revoke privileges (only required for MySQL 4.1.2 - 5.0.1)
-					$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($result['databasename']) .'\'',false,true);
-				}
 
-				$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($result['databasename']) . "'");
+				$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
-				while ($host = $db_root->fetch_array($host_res)) {
+				unset($db_root->password);
-					// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+)
+				foreach(array_map('trim', array_unique(explode(',', $settings['system']['mysql_access_host']))) as $mysql_access_host)
-					$db_root->query('DROP USER \'' . $db_root->escape($result['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true);
+				{
+					$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
+					$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($result['databasename'])) . '` . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
+					$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($result['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
 				}
 
 				$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`');
 				$db_root->query('FLUSH PRIVILEGES');
 				$db_root->close();
+
 				// End root-session
 
 				$db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
 
-				$resetaccnumber = ($userinfo['mysqls_used'] == '1') ? " , `mysql_lastaccountnumber`='0' " : '';
+				if($userinfo['mysqls_used'] == '1')
+				{
+					$resetaccnumber = " , `mysql_lastaccountnumber`='0' ";
+				}
+				else
+				{
+					$resetaccnumber = '';
+				}
 
 				$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			} else {
+			}
+			else
+			{
 				$dbnamedesc = $result['databasename'];
-				if (isset($result['description']) && $result['description'] != '') {
+				if($result['description'] != '') {
-					$dbnamedesc .= ' ('.$result['description'].')';
+					$dbnamedesc.= ' ('.$result['description'].')';
 				}
 				ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc);
 			}
 		}
-	} elseif ($action == 'add') {
+	}
-		if ($userinfo['mysqls_used'] < $userinfo['mysqls']
+	elseif($action == 'add')
-		   || $userinfo['mysqls'] == '-1'
+	{
-		) {
+		if($userinfo['mysqls_used'] < $userinfo['mysqls']
-			if (isset($_POST['send'])
+		   || $userinfo['mysqls'] == '-1')
-			   && $_POST['send'] == 'send'
+		{
-			) {
+			if(isset($_POST['send'])
+			   && $_POST['send'] == 'send')
+			{
 				$password = validate($_POST['mysql_password'], 'password');
 				$password = validatePassword($password);
 
-				$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
+				$sendinfomail = intval($_POST['sendinfomail']);
-				if ($sendinfomail != 1) {
+				if($sendinfomail != 1)
+				{
 					$sendinfomail = 0;
 				}
 
-				if ($password == '') {
+				if($password == '')
+				{
 					standard_error(array('stringisempty', 'mypassword'));
-				} else {
+				}
-					$dbserver = 0;
+				else
-					if (count($sql_root) > 1) {
+				{
+					$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
+
+					if(count($sql_root) > 1)
+					{
 						$dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0);
-						if (!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver])) {
+
+						if(!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver]))
+						{
 							$dbserver = 0;
 						}
 					}
-					
+					else
-					// validate description before actual adding the database, #1052
+					{
-					$databasedescription = validate(trim($_POST['description']), 'description');
+						$dbserver = 0;
-
-					// Begin root-session
-					$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
-
-					if (strtoupper($settings['customer']['mysqlprefix']) == 'RANDOM') {
-						$result = $db_root->query('SELECT `User` FROM mysql.user');
-						while ($row = $db_root->fetch_array($result)) {
-							$allsqlusers[] = $row[User];
-						}
-						$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
-						while (in_array($username , $allsqlusers)) {
-							$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
-						}
-					} else {
-						$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
 					}
 
+					// Begin root-session
+
+					$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
+					unset($db_root->password);
 					$db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`');
 					$log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'");
-					foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) {
+					foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
+					{
 						$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\'');
 						$db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
 						$log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'");
@@ -172,21 +188,24 @@ if ($page == 'overview') {
 
 					$db_root->query('FLUSH PRIVILEGES');
 					$db_root->close();
-					// End root-session
 
-					// Statement modified for Database description -- PH 2004-11-29
+					// End root-session
+					// Statement modifyed for Database description -- PH 2004-11-29
+
+					$databasedescription = validate($_POST['description'], 'description');
 					$result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")');
 					$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
 
-					if ($sendinfomail == 1) {
+					if($sendinfomail == 1)
+					{
 						$pma = $lng['admin']['notgiven'];
-						if ($settings['panel']['phpmyadmin_url'] != '') {
+						if($settings['panel']['phpmyadmin_url'] != '')
+						{
 							$pma = $settings['panel']['phpmyadmin_url'];
 						}
 
 						$replace_arr = array(
-							'SALUTATION' => getCorrectUserSalutation($userinfo),
+							'CUST_NAME' => getCorrectUserSalutation($userinfo),
-							'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
 							'DB_NAME' => $username,
 							'DB_PASS' => $password,
 							'DB_DESC' => $databasedescription,
@@ -225,68 +244,73 @@ if ($page == 'overview') {
 
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
-			} else {
+			}
+			else
+			{
 				$mysql_servers = '';
 
-				foreach ($sql_root as $mysql_server => $mysql_server_details) {
+				foreach($sql_root as $mysql_server => $mysql_server_details)
+				{
 					$mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server);
 				}
 
-				//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
+				$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
 
-				$mysql_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_add.php';
+				eval("echo \"" . getTemplate("mysql/mysqls_add") . "\";");
-				$mysql_add_form = htmlform::genHTMLForm($mysql_add_data);
-
-				$title = $mysql_add_data['mysql_add']['title'];
-				$image = $mysql_add_data['mysql_add']['image'];
-
-				eval("echo \"" . getTemplate('mysql/mysqls_add') . "\";");
 			}
 		}
-	} elseif ($action == 'edit' && $id != 0) {
+	}
+	elseif($action == 'edit'
+	       && $id != 0)
+	{
 		$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"');
 
-		if (isset($result['databasename'])
+		if(isset($result['databasename'])
-		   && $result['databasename'] != ''
+		   && $result['databasename'] != '')
-		) {
+		{
-			if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) {
+			if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
+			{
 				$result['dbserver'] = 0;
 			}
 
-			if (isset($_POST['send'])
+			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send'
+			   && $_POST['send'] == 'send')
-			) {
+			{
 				// Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29
 				$password = validate($_POST['mysql_password'], 'password');
-				if ($password != '') {
+
+				if($password != '')
+				{
 					// validate password
 					$password = validatePassword($password);
 
 					// Begin root-session
 					$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
-					foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) {
+					unset($db_root->password);
+					foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
+					{
 						$db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
 					}
 
 					$db_root->query('FLUSH PRIVILEGES');
 					$db_root->close();
+
 					// End root-session
 				}
 
 				// Update the Database description -- PH 2004-11-29
+
 				$log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'");
 				$databasedescription = validate($_POST['description'], 'description');
 				$result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			} else {
+			}
-				$mysql_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_edit.php';
+			else
-				$mysql_edit_form = htmlform::genHTMLForm($mysql_edit_data);
+			{
-
+				eval("echo \"" . getTemplate("mysql/mysqls_edit") . "\";");
-				$title = $mysql_edit_data['mysql_edit']['title'];
-				$image = $mysql_edit_data['mysql_edit']['image'];
-
-				eval("echo \"" . getTemplate('mysql/mysqls_edit') . "\";");
 			}
 		}
 	}
 }
+
+?>

customer_tickets.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -28,17 +28,6 @@ require ("./lib/init.php");
 if(isset($_POST['id']))
 {
 	$id = intval($_POST['id']);
-	
-	/*
-	 * Check if the current user is allowed to see the current ticket.
-	 */
-	$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `customerid` = '".$userinfo['customerid']."'";
-	
-	$result = $db->query_first($sql);
-	if ($result == null) {
-		// no rights to see the requested ticket
-		standard_error(array('ticketnotaccessible'));
-	}
 }
 elseif(isset($_GET['id']))
 {
@@ -48,7 +37,7 @@ elseif(isset($_GET['id']))
 if($page == 'overview')
 {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets");
-	eval("echo \"" . getTemplate("tickets/ticket") . "\";");
+	eval("echo \"" . getTemplate("ticket/ticket") . "\";");
 }
 elseif($page == 'tickets')
 {
@@ -66,7 +55,7 @@ elseif($page == 'tickets')
 		$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$paging->sortfield = 'lastchange';
 		$paging->sortorder = 'desc';
-		$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" AND `adminid`="' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -115,7 +104,7 @@ elseif($page == 'tickets')
 					$row['subject'] = substr($row['subject'], 0, 17) . '...';
 				}
 
-				eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";");
+				eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
 				$count++;
 			}
 
@@ -168,7 +157,7 @@ elseif($page == 'tickets')
 		}
 
 		$ticketsopen = (int)$opentickets['count'];
-		eval("echo \"" . getTemplate("tickets/tickets") . "\";");
+		eval("echo \"" . getTemplate("ticket/tickets") . "\";");
 	}
 	elseif($action == 'new')
 	{
@@ -221,12 +210,12 @@ elseif($page == 'tickets')
 			else
 			{
 				$categories = '';
-				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
+				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
 
 				if(isset($result['name'])
 				   && $result['name'] != '')
 				{
-					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
+					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
 
 					while($row = $db->fetch_array($result2))
 					{
@@ -238,9 +227,9 @@ elseif($page == 'tickets')
 					$categories = makeoption($lng['ticket']['no_cat'], '0');
 				}
 
-				$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']);
+				$priorities = makeoption($lng['ticket']['unf_high'], '1', $settings['ticket']['default_priority']);
-				$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['unf_normal'], '2', $settings['ticket']['default_priority']);
-				$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['unf_low'], '3', $settings['ticket']['default_priority']);
 				$ticketsopen = 0;
 				$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
                                            WHERE `customerid` = "' . $userinfo['customerid'] . '"
@@ -258,14 +247,7 @@ elseif($page == 'tickets')
 				}
 
 				$ticketsopen = (int)$opentickets['count'];
-
+				eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
-				$ticket_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_add.php';
-				$ticket_add_form = htmlform::genHTMLForm($ticket_add_data);
-
-				$title = $ticket_add_data['ticket_add']['title'];
-				$image = $ticket_add_data['ticket_add']['image'];
-
-				eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
 			}
 		}
 		else
@@ -340,18 +322,12 @@ elseif($page == 'tickets')
 			}
 			else
 			{
-				$cid = $mainticket->Get('customer');
+				$by = $lng['ticket']['customer'];
-				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
-						FROM `' . TABLE_PANEL_CUSTOMERS . '`
-						WHERE `customerid` = "' . (int)$cid . '"'
-				);
-				$by = getCorrectFullUserDetails($usr);
-				//$by = $lng['ticket']['customer'];
 			}
 
 			$subject = $mainticket->Get('subject');
 			$message = $mainticket->Get('message');
-			eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
+			eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
 			$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
                                 WHERE `id`="' . (int)$mainticket->Get('category') . '"');
 			$row = $db->fetch_array($result);
@@ -368,13 +344,12 @@ elseif($page == 'tickets')
 				}
 				else
 				{
-					$by = getCorrectFullUserDetails($usr);
+					$by = $lng['ticket']['customer'];
-					//$by = $lng['ticket']['customer'];
 				}
 
 				$subject = $subticket->Get('subject');
 				$message = $subticket->Get('message');
-				eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
+				eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
 			}
 
 			$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -385,13 +360,7 @@ elseif($page == 'tickets')
 
 			// don't forget the main-ticket!
 
-			$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_reply.php';
+			eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
-			$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
-
-			$title = $ticket_reply_data['ticket_reply']['title'];
-			$image = $ticket_reply_data['ticket_reply']['image'];
-
-			eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
 		}
 	}
 	elseif($action == 'close'

customer_traffic.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'customer');
@@ -22,20 +22,21 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-$intrafficpage = 1;
+
-require('./lib/init.php');
+require ("./lib/init.php");
 $traffic = '';
 $month = null;
 $year = null;
 
-if (isset($_POST['month'])
+if(isset($_POST['month'])
-	&& isset($_POST['year'])
+   && isset($_POST['year']))
-) {
+{
 	$month = intval($_POST['month']);
 	$year = intval($_POST['year']);
-} elseif (isset($_GET['month'])
+}
-	&& isset($_GET['year'])
+elseif(isset($_GET['month'])
-) {
+       && isset($_GET['year']))
+{
 	$month = intval($_GET['month']);
 	$year = intval($_GET['year']);
 }
@@ -43,25 +44,40 @@ if (isset($_POST['month'])
 //BAM! $_GET???
 
 elseif (isset($_GET['page'])
-	&& $_GET['page'] == 'current'
+       && $_GET['page'] == "current")
-) {
+{
-	if (date('d') != '01') {
+	if(date('d') != '01')
+	{
 		$month = date('m');
 		$year = date('Y');
-	} else {
+	}
-		if (date('m') == '01') {
+	else
+	{
+		if(date('m') == '01')
+		{
 			$month = 12;
 			$year = date('Y') - 1;
-		} else {
+		}
+		else
+		{
 			$month = date('m') - 1;
 			$year = date('Y');
 		}
 	}
 }
 
-if (!is_null($month)
+if(!is_null($month)
-	&& !is_null($year)) {
+   && !is_null($year))
+{
 	$traf['byte'] = 0;
+	$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
+	                     FROM `" . TABLE_PANEL_TRAFFIC . "`
+	                     WHERE `customerid`='" . $userinfo['customerid'] . "'
+	                     AND `month` = '" . $month . "'
+	                     AND `year` = '" . $year . "'");
+	$row = mysql_fetch_row($result);
+	rsort($row);
+	$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));;
 	$result = $db->query("SELECT
                                 SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail',
                                 `day`, `month`, `year`
@@ -74,50 +90,106 @@ if (!is_null($month)
 	$traffic_complete['mail'] = 0;
 	$show = '';
 
-	while ($row = $db->fetch_array($result)) {
+	while($row = $db->fetch_array($result))
+	{
 		$http = $row['http'];
 		$ftp = $row['ftp_up'] + $row['ftp_down'];
 		$mail = $row['mail'];
 		$traf['byte'] = $http + $ftp + $mail;
-		$traffic_complete['http'] += $http;
+		$traffic_complete['http']+= $http;
-		$traffic_complete['ftp'] += $ftp;
+		$traffic_complete['ftp']+= $ftp;
-		$traffic_complete['mail'] += $mail;
+		$traffic_complete['mail']+= $mail;
-		$traf['day'] = $row['day'] . '.';
+		$traf['day'] = $row['day'];
 
-		if (extension_loaded('bcmath')) {
+		if(extension_loaded('bcmath'))
+		{
 			$traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
 			$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
 			$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
-			$traf['ftp'] = bcdiv($ftp, 1024, $settings['panel']['decimal_places']);
+		}
-			$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']);
+		else
-			$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']);
+		{
-			$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
-		} else {
 			$traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
 			$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
 			$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
-			$traf['http'] = round($http, $settings['panel']['decimal_places']);
+		}
-			$traf['ftp'] = round($ftp, $settings['panel']['decimal_places']);
+
-			$traf['mail'] = round($mail, $settings['panel']['decimal_places']);
+		if($traf['byte'] != 0
+		   && $traf['max'] != 0)
+		{
+			$proz = $traf['max'] / 100;
+			$traf['http'] = round($http / $proz, 0);
+			$traf['ftp'] = round($ftp / $proz, 0);
+			$traf['mail'] = round($mail / $proz, 0);
+
+			if($traf['http'] == 0)
+			{
+				$traf['http'] = 1;
+			}
+
+			if($traf['ftp'] == 0)
+			{
+				$traf['ftp'] = 1;
+			}
+
+			if($traf['mail'] == 0)
+			{
+				$traf['mail'] = 1;
+			}
+		}
+		else
+		{
+			$traf['http'] = 0;
+			$traf['ftp'] = 0;
+			$traf['mail'] = 0;
+		}
+
+		if(extension_loaded('bcmath'))
+		{
+			$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
+		}
+		else
+		{
 			$traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']);
 		}
 
-		eval("\$traffic.=\"" . getTemplate('traffic/traffic_month') . "\";");
+		eval("\$traffic.=\"" . getTemplate("traffic/traffic_month") . "\";");
-		$show = $lng['traffic']['months'][intval($row['month'])] . ' ' . $row['year'];
+		$show = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
 	}
 
-	if (extension_loaded('bcmath')) {
+	if(extension_loaded('bcmath'))
+	{
 		$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']);
-	} else {
+	}
+	else
+	{
 		$traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']);
 	}
 
-	eval("echo \"" . getTemplate('traffic/traffic_details') . "\";");
+	eval("echo \"" . getTemplate("traffic/traffic_details") . "\";");
-} else {
+}
+else
+{
+	$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
+	                     FROM `" . TABLE_PANEL_TRAFFIC . "`
+	                     WHERE `customerid`='" . $userinfo['customerid'] . "'
+	                     GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
+	
+	$nums = mysql_num_rows($result);
+	if($nums > 0)
+	{
+		$row = mysql_fetch_row($result);
+		rsort($row);
+		$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));
+	} else {
+		// no records yet
+		$traf['max'] = 0;
+	}
+	
 	$result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail
 	                     FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "'
 	                     GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
@@ -125,49 +197,88 @@ if (!is_null($month)
 	$traffic_complete['ftp'] = 0;
 	$traffic_complete['mail'] = 0;
 
-	while ($row = $db->fetch_array($result)) {
+	while($row = $db->fetch_array($result))
+	{
 		$http = $row['http'];
 		$ftp_up = $row['ftp_up'];
 		$ftp_down = $row['ftp_down'];
 		$mail = $row['mail'];
-		$traffic_complete['http'] += $http;
+		$traffic_complete['http']+= $http;
-		$traffic_complete['ftp'] += $ftp_up + $ftp_down;
+		$traffic_complete['ftp']+= $ftp_up + $ftp_down;
-		$traffic_complete['mail'] += $mail;
+		$traffic_complete['mail']+= $mail;
 		$traf['month'] = $row['month'];
 		$traf['year'] = $row['year'];
 		$traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
 		$traf['byte'] = $http + $ftp_up + $ftp_down + $mail;
 
-		if (extension_loaded('bcmath')) {
+		if(extension_loaded('bcmath'))
-			$traf['ftptext'] = bcdiv($ftp_up, 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($ftp_down, 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
+		{
-			$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
+			$traf['ftptext'] = bcdiv($ftp_up, 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . bcdiv($ftp_down, 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
-			$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
+			$traf['httptext'] = bcdiv($http, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
-			$traf['ftp'] = bcdiv(($ftp_up + $ftp_down), 1024, $settings['panel']['decimal_places']);
+			$traf['mailtext'] = bcdiv($mail, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
-			$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']);
+		}
-			$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']);
+		else
-			$traf['byte'] = bcdiv($traf['byte'], 1024 * 1024, $settings['panel']['decimal_places']);
+		{
-		} else {
+			$traf['ftptext'] = round($ftp_up / 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . round($ftp_down / 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
-			$traf['ftptext'] = round($ftp_up / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($ftp_down / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
+			$traf['httptext'] = round($http / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
-			$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
+			$traf['mailtext'] = round($mail / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
-			$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
-			$traf['ftp'] = round(($ftp_up + $ftp_down) / 1024, $settings['panel']['decimal_places']);
-			$traf['http'] = round($http / 1024, $settings['panel']['decimal_places']);
-			$traf['mail'] = round($mail / 1024, $settings['panel']['decimal_places']);
-			$traf['byte'] = round($traf['byte'] / (1024 * 1024), $settings['panel']['decimal_places']);
 		}
 
-		eval("\$traffic.=\"" . getTemplate('traffic/traffic_traffic') . "\";");
+		if($traf['max'] != 0)
+		{
+			$proz = $traf['max'] / 100;
+			$traf['ftp'] = round(($ftp_up + $ftp_down) / $proz, 0);
+			$traf['http'] = round($http / $proz, 0);
+			$traf['mail'] = round($mail / $proz, 0);
+
+			if($traf['http'] == 0)
+			{
+				$traf['http'] = 1;
+			}
+
+			if($traf['ftp'] == 0)
+			{
+				$traf['ftp'] = 1;
+			}
+
+			if($traf['mail'] == 0)
+			{
+				$traf['mail'] = 1;
+			}
+		}
+		else
+		{
+			$traf['ftp'] = 0;
+			$traf['http'] = 0;
+			$traf['mail'] = 0;
+		}
+
+		if(extension_loaded('bcmath'))
+		{
+			$traf['byte'] = bcadd($traf['byte'] / (1024 * 1024), 0.0000, 4);
+		}
+		else
+		{
+			$traf['byte'] = round($traf['byte'] + (1024 * 1024), 4);
+		}
+
+		eval("\$traffic.=\"" . getTemplate("traffic/traffic_traffic") . "\";");
 	}
 
-	if (extension_loaded('bcmath')) {
+	if(extension_loaded('bcmath'))
+	{
 		$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']);
-	} else {
+	}
-		$traffic_complete['http'] = round($traffic_complete['http'] / (1024 * 1024), $settings['panel']['decimal_places']);
+	else
-		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / (1024 * 1024), $settings['panel']['decimal_places']);
+	{
-		$traffic_complete['mail'] = round($traffic_complete['mail'] / (1024 * 1024), $settings['panel']['decimal_places']);
+		$traffic_complete['http'] = round($traffic_complete['http'] / 1024 * 1024, $settings['panel']['decimal_places']);
+		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024 * 1024, $settings['panel']['decimal_places']);
+		$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024 * 1024, $settings['panel']['decimal_places']);
 	}
 
-	eval("echo \"" . getTemplate('traffic/traffic') . "\";");
+	eval("echo \"" . getTemplate("traffic/traffic") . "\";");
 }
+
+?>

index.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Panel
- *
+ * @version    $Id$
  */
 
 define('AREA', 'login');
@@ -22,74 +22,106 @@ define('AREA', 'login');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-require ('./lib/init.php');
 
-if ($action == '') {
+require ("./lib/init.php");
+
+if($action == '')
+{
 	$action = 'login';
 }
 
-if ($action == 'login') {
+if($action == 'login')
-	if (isset($_POST['send'])
+{
-		&& $_POST['send'] == 'send'
+	if(isset($_POST['send'])
-	) {
+	&& $_POST['send'] == 'send')
+	{
 		$loginname = validate($_POST['loginname'], 'loginname');
 		$password = validate($_POST['password'], 'password');
 
 		$row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
 
-		if ($row['customer'] == $loginname) {
+		if($row['customer'] == $loginname)
+		{
 			$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
 			$uid = 'customerid';
 			$adminsession = '0';
 			$is_admin = false;
-		} else {
+		}
-			$is_admin = true;
+		else
-			if ((int)$settings['login']['domain_login'] == 1) {
+		{
+			if((int)$settings['login']['domain_login'] == 1)
+			{
 				/**
 				 * check if the customer tries to login with a domain, #374
 				 */
 				$domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname));
 				$row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'");
 	
-				if (isset($row2['customerid']) && $row2['customerid'] > 0) {
+				if(isset($row2['customerid']) && $row2['customerid'] > 0)
+				{
 					$loginname = getCustomerDetail($row2['customerid'], 'loginname');
-					if ($loginname !== false) {
+					
+					if($loginname !== false)
+					{
 						$row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
-						if ($row3['customer'] == $loginname) {
+		
+						if($row3['customer'] == $loginname)
+						{
 							$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
 							$uid = 'customerid';
 							$adminsession = '0';
 							$is_admin = false;
 						}
 					}
+					else
+					{
+						$is_admin = true;
+					}
 				}
+				else
+				{
+					$is_admin = true;
+				}
+			}
+			else
+			{
+				$is_admin = true;
 			}
 		}
 
-		if (hasUpdates($version) && $is_admin == false) {
+		if(hasUpdates($version) && $is_admin == false)
+		{
 			redirectTo('index.php');
 			exit;
 		}
 
-		if ($is_admin) {
+		if($is_admin)
-			if (hasUpdates($version)) {
+		{
+			if(hasUpdates($version))
+			{
 				$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'");
 				/*
 				 * not an admin who can see updates
 				 */
-				if (!isset($row['admin'])) {
+				if(!isset($row['admin']))
+				{
 					redirectTo('index.php');
 					exit;
 				}
-			} else {
+			}
+			else
+			{
 				$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
 			}
 
-			if ($row['admin'] == $loginname) {
+			if($row['admin'] == $loginname)
+			{
 				$table = "`" . TABLE_PANEL_ADMINS . "`";
 				$uid = 'adminid';
 				$adminsession = '1';
-			} else {
+			}
+			else
+			{
 				redirectTo('index.php', Array('showmessage' => '2'), true);
 				exit;
 			}
@@ -97,174 +129,191 @@ if ($action == 'login') {
 
 		$userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'");
 
-		if ($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
+		if($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
-			&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime'])
+		&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']))
-		) {
+		{
 			redirectTo('index.php', Array('showmessage' => '3'), true);
 			exit;
-		} elseif($userinfo['password'] == md5($password)) {
+		}
+		elseif($userinfo['password'] == md5($password))
+		{
 			// login correct
 			// reset loginfail_counter, set lastlogin_succ
+
 			$db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
 			$userinfo['userid'] = $userinfo[$uid];
 			$userinfo['adminsession'] = $adminsession;
-		} else {
+		}
+		else
+		{
 			// login incorrect
+
 			$db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
 			unset($userinfo);
 			redirectTo('index.php', Array('showmessage' => '2'), true);
 			exit;
 		}
 
-		if (isset($userinfo['userid'])
+		if(isset($userinfo['userid'])
-			&& $userinfo['userid'] != ''
+		&& $userinfo['userid'] != '')
-		) {
+		{
 			$s = md5(uniqid(microtime(), 1));
 
-			if (isset($_POST['language'])) {
+			if(isset($_POST['language']))
+			{
 				$language = validate($_POST['language'], 'language');
-				if ($language == 'profile') {
+
+				if($language == 'profile')
+				{
 					$language = $userinfo['def_language'];
-				} elseif(!isset($languages[$language])) {
+				}
+				elseif(!isset($languages[$language]))
+				{
 					$language = $settings['panel']['standardlanguage'];
 				}
-			} else {
+			}
+			else
+			{
 				$language = $settings['panel']['standardlanguage'];
 			}
 
-			if (isset($userinfo['theme']) && $userinfo['theme'] != '') {
+			if($settings['session']['allow_multiple_login'] != '1')
-				$theme = $userinfo['theme'];
+			{
-			} else {
-				$theme = $settings['panel']['default_theme'];
-			}
-
-			if ($settings['session']['allow_multiple_login'] != '1') {
 				$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'");
 			}
 
-			// check for field 'theme' in session-table, refs #607
+			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
-			$fields = mysql_list_fields($db->getDbName(), TABLE_PANEL_SESSIONS);
-			$columns = mysql_num_fields($fields);
-			$field_array = array();
-			for ($i = 0; $i < $columns; $i++) {
-				$field_array[] = mysql_field_name($fields, $i);
-			}
 
-			if (!in_array('theme', $field_array)) {
+			if($userinfo['adminsession'] == '1')
-				$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
+			{
-    			} else {
+				if(hasUpdates($version))
-    				$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "', '" . $db->escape($theme) . "')");
+				{
-    			}
-
-			if ($userinfo['adminsession'] == '1') {
-				if (hasUpdates($version)) {
 					redirectTo('admin_updates.php', Array('s' => $s), true);
-				} else {
+					exit;
-					redirectTo('admin_index.php', Array('s' => $s), true);
+				}
+				else
+				{
+					redirectTo('admin_index.php', Array('s' => $s), true);
+					exit;
 				}
-			} else {
-				redirectTo('customer_index.php', Array('s' => $s), true);
 			}
-		} else {
+			else
-			redirectTo('index.php', Array('showmessage' => '2'), true);
+			{
+				redirectTo('customer_index.php', Array('s' => $s), true);
+				exit;
+			}
 		}
-		exit;
+		else
-	} else {
+		{
+			redirectTo('index.php', Array('showmessage' => '2'), true);
+			exit;
+		}
+	}
+	else
+	{
 		$language_options = '';
-		$language_options .= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
+		$language_options.= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
 
-		while (list($language_file, $language_name) = each($languages)) {
+		while(list($language_file, $language_name) = each($languages))
-			$language_options .= makeoption($language_name, $language_file, 'profile', true);
+		{
+			$language_options.= makeoption($language_name, $language_file, 'profile', true);
 		}
 
 		$smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0;
 		$message = '';
-		$successmessage = '';
 
-		switch ($smessage) {
+		switch($smessage)
+		{
 			case 1:
-				$successmessage = $lng['pwdreminder']['success'];
+				$message = $lng['pwdreminder']['success'];
 				break;
 			case 2:
 				$message = $lng['error']['login'];
 				break;
 			case 3:
-				$message = sprintf($lng['error']['login_blocked'],$settings['login']['deactivatetime']);
+				$message = $lng['error']['login_blocked'];
 				break;
 			case 4:
-				$cmail = isset($_GET['customermail']) ? $_GET['customermail'] : 'unknown';
+				$message = $lng['error']['errorsendingmail'];
-				$message = str_replace('%s', $cmail, $lng['error']['errorsendingmail']);
-				break;
-			case 5:
-				$message = $lng['error']['user_banned'];
 				break;
 		}
 
 		$update_in_progress = '';
-		if (hasUpdates($version)) {
+		if(hasUpdates($version))
+		{
 			$update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin'];
 		}
 
-		eval("echo \"" . getTemplate('login') . "\";");
+		eval("echo \"" . getTemplate("login") . "\";");
 	}
 }
 
-if ($action == 'forgotpwd') {
+if($action == 'forgotpwd')
+{
 	$adminchecked = false;
 	$message = '';
 
-	if (isset($_POST['send'])
+	if(isset($_POST['send'])
-		&& $_POST['send'] == 'send'
+	&& $_POST['send'] == 'send')
-	) {
+	{
 		$loginname = validate($_POST['loginname'], 'loginname');
 		$email = validateEmail($_POST['loginemail'], 'email');
-		$sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_CUSTOMERS . "`
+		$sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_CUSTOMERS . "`
 				WHERE `loginname`='" . $db->escape($loginname) . "'
 				AND `email`='" . $db->escape($email) . "'";
 		$result = $db->query($sql);
 
-		if ($db->num_rows() == 0) {
+		if($db->num_rows() == 0)
+		{
 			$sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "`
 				WHERE `loginname`='" . $db->escape($loginname) . "'
 				AND `email`='" . $db->escape($email) . "'";
 			$result = $db->query($sql);
 				
-			if ($db->num_rows() > 0) {
+			if($db->num_rows() > 0)
+			{
 				$adminchecked = true;
-			} else {
+			}
+			else
+			{
 				$result = null;
 			}
 		}
 
-		if ($result !== null) {
+		if($result !== null)
+		{
 			$user = $db->fetch_array($result);
 
-			/* Check whether user is banned */
+			if(($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
-			if ($user['deactivated']) {
+			|| $adminchecked == false)
-				$message = $lng['pwdreminder']['notallowed'];
+			{
-				redirectTo('index.php', Array('showmessage' => '5'), true);
+				if($user !== false)
-			}
+				{
-
-			if (($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
-				|| $adminchecked == false
-			) {
-				if ($user !== false) {
 					if ($settings['panel']['password_min_length'] <= 6) {
 						$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
 					} else {
 						// make it two times larger than password_min_length
 						$rnd = '';
 						$minlength = $settings['panel']['password_min_length'];
-						while (strlen($rnd) < ($minlength * 2)) {
+						while (strlen($rnd) < ($minlength * 2))
+						{
 							$rnd .= md5(uniqid(microtime(), 1));
 						}
 						$password = substr($rnd, (int)($minlength / 2), $minlength);
 					}
 
-					$passwordTable = $adminchecked ? TABLE_PANEL_ADMINS : TABLE_PANEL_CUSTOMERS;
+					if($adminchecked)
-					$db->query("UPDATE `" . $passwordTable . "` SET `password`='" . md5($password) . "'
+					{
-							WHERE `loginname`='" . $user['loginname'] . "'
+						$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `password`='" . md5($password) . "'
-							AND `email`='" . $user['email'] . "'");
+								WHERE `loginname`='" . $user['loginname'] . "'
+								AND `email`='" . $user['email'] . "'");
+					}
+					else
+					{
+						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($password) . "'
+								WHERE `loginname`='" . $user['loginname'] . "'
+								AND `email`='" . $user['email'] . "'");
+					}
 
 					$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
 					$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
@@ -287,7 +336,7 @@ if ($action == 'forgotpwd') {
 					try {
 						$mail->Subject = $mail_subject;
 						$mail->AltBody = $mail_body;
-						$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
+						$mail->MsgHTML(str_replace("\\n", "<br />", $mail_body));
 						$mail->AddAddress($user['email'], $user['firstname'] . ' ' . $user['name']);
 						$mail->Send();
 					} catch(phpmailerException $e) {
@@ -301,36 +350,44 @@ if ($action == 'forgotpwd') {
 					if ($_mailerror) {
 						$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
 						$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
-						redirectTo('index.php', Array('showmessage' => '4', 'customermail' => $user['email']), true);
+						redirectTo('index.php', Array('showmessage' => '4'), true);
 						exit;
 					}
 
 					$mail->ClearAddresses();
 					redirectTo('index.php', Array('showmessage' => '1'), true);
 					exit;
-				} else {
+				}
+				else
+				{
 					$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
 					$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
-					$message = $lng['login']['combination_not_found'];
+					$message = $lng['login']['usernotfound'];
 				}
 
 				unset($user);
 			}
-		} else {
-			$message = $lng['login']['usernotfound'];
 		}
 	}
 
-	if ($adminchecked) {
+
-		if ($settings['panel']['allow_preset_admin'] != '1') {
+	if($adminchecked)
+	{
+		if($settings['panel']['allow_preset_admin'] != '1')
+		{
 			$message = $lng['pwdreminder']['notallowed'];
 			unset ($adminchecked);
 		}
-	} else {
+	}
-		if ($settings['panel']['allow_preset'] != '1') {
+	else
+	{
+		if($settings['panel']['allow_preset'] != '1')
+		{
 			$message = $lng['pwdreminder']['notallowed'];
 		}
 	}
 
-	eval("echo \"" . getTemplate('fpwd') . "\";");
+	eval("echo \"" . getTemplate("fpwd") . "\";");
 }
+
+?>

install/install.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Install
- *
+ * @version    $Id$
  */
 
 /**
@@ -37,10 +37,9 @@ if(file_exists('../lib/userdata.inc.php'))
 	require ('../lib/userdata.inc.php');
 
 	if(isset($sql)
-	   && is_array($sql)
+	   && is_array($sql))
-	) {
+	{
-		$installed_hint = file_get_contents('../templates/Froxlor/misc/alreadyinstalledhint.tpl');
+		die('Sorry, Froxlor is already configured...');
-		die($installed_hint);
 	}
 }
 
@@ -95,49 +94,58 @@ if(file_exists('./lng/' . $language . '.lng.php'))
  * BEGIN FUNCTIONS -----------------------------------------------
  */
 
-function page_header() {
+function page_header()
+{
+
 ?>
-<!DOCTYPE html>
+<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
-<html lang="en">
+<html xmlns="http://www.w3.org/1999/xhtml">
 <head>
-	<meta charset="utf-8" />
+	<meta content="text/html; charset=ISO-8859-1" http-equiv="content-type" />
-	<meta http-equiv="Default-Style" content="text/css" />
+	<link rel="stylesheet" href="../templates/main.css" type="text/css" />
-	<link rel="stylesheet" href="../templates/Froxlor/assets/css/main.css"  />
+	<title>Froxlor</title>
-	<!--[if IE]><link rel="stylesheet" href="../templates/Froxlor/assets/css/main_ie.css"  /><![endif]-->
-	<!--[if lt IE 9]><script src="http://html5shiv.googlecode.com/svn/trunk/html5.js"></script><![endif]-->
-	<script type="text/javascript" src="../js/jquery.min.js"></script>
-	<script type="text/javascript" src="../templates/Froxlor/assets/js/main.js"></script>
-	<link href="../templates/Froxlor/assets/img/favicon.ico" rel="icon" type="image/x-icon" />
-	<title>Froxlor Server Management Panel - Installation</title>
-	<style>
-	body {
-        font-family: Verdana, Geneva, sans-serif;
-	}
-	input {
-		background: #dae7ee url('../templates/Froxlor/assets/img/icons/text_align_left.png') no-repeat 5px 4px;
-	}
-	input[type="password"] {
-		background: #dae7ee url('../templates/Froxlor/assets/img/icons/password.png') no-repeat 4px 4px;
-	}
-	input[type="submit"] {
-		background: #ccc url('../templates/Froxlor/assets/img/icons/button_ok.png') no-repeat 4px 8px;
-	}
-	</style>
 </head>
-<body>
+	<body style="margin: 0; padding: 0;" onload="document.loginform.loginname.focus()">
-<div class="loginpage">
+		<!--
+			We request you retain the full copyright notice below including the link to www.froxlor.org.
+			This not only gives respect to the large amount of time given freely by the developers
+			but also helps build interest, traffic and use of Froxlor. If you refuse
+			to include even this then support on our forums may be affected.
+			The Froxlor Team : 2009-2010
+		// -->
+		<!--
+			Templates based on work by Luca Piona (info@havanastudio.ch) and Luca Longinotti (chtekk@gentoo.org)
+		// -->
+		<table cellspacing="0" cellpadding="0" border="0" width="100%">
+			<tr>
+				<td width="800"><img src="../images/header.gif" width="800" height="90" alt="" /></td>
+				<td class="header">&nbsp;</td>
+			</tr>
+		</table>
+		<table cellspacing="0" cellpadding="0" border="0" width="100%">
+			<tr>
+				<td valign="top" bgcolor="#FFFFFF">
+				<br />
+				<br />
 <?php
 }
 
-function page_footer() {
+function page_footer()
+{
+
 ?>
-</div>
+				</td>
-<footer>
+			</tr>
-	<span>
+		</table>
-		Froxlor &copy; 2009-<?php echo date('Y', time()); ?> by <a href="http://www.froxlor.org/" rel="external">the Froxlor Team</a>
+		<table cellspacing="0" cellpadding="0" border="0" width="100%">
-	</span>
+			<tr>
-</footer>
+				<td width="100%" class="footer">
-</body>
+					<br />Froxlor &copy; 2009-2010 by <a href="http://www.froxlor.org/" target="_blank">the Froxlor Team</a>
+					<br /><br/>
+				</td>
+			</tr>
+		</table>
+	</body>
 </html>
 <?php
 }
@@ -146,30 +154,24 @@ function status_message($case, $text)
 {
 	if($case == 'begin')
 	{
-		echo '<tr><td>'.$text;
+		echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\">$text";
 	}
 	else
 	{
-		echo '</td><td class="installstatus">
+		echo " <span style=\"color:$case;\">$text</span></td>\n\t\t</tr>\n";
-			<span style="color:'.$case.';">'.$text.'</span>
-		</td></tr>';
 	}
 }
 
-function requirement_checks() {
+function requirement_checks()
-
+{
-	global $lng, $theme;
+	global $lng;
 	page_header();
 
 ?>
-	<article class="install bradius">
+	<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
-		<header class="dark">
+		<tr>
-			<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" />
+			<td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
-		</header>
+		</tr>
-
-		<section class="installsec">
-			<h2>Requirements</h2>
-			<table class="noborder">
 <?php
 	$_die = false;
 	
@@ -199,10 +201,9 @@ function requirement_checks() {
 		status_message('green', 'OK');
 	}
 
-	// check for mysql-extension
 	status_message('begin', $lng['install']['phpmysql']);
 
-	if(!extension_loaded('mysql') && !extension_loaded('mysqlnd'))
+	if(!extension_loaded('mysql'))
 	{
 		status_message('red', $lng['install']['notinstalled']);
 		$_die = true;
@@ -212,20 +213,6 @@ function requirement_checks() {
 		status_message('green', 'OK');
 	}
 
-	// check for xml-extension
-	status_message('begin', $lng['install']['phpxml']);
-	
-	if(!extension_loaded('xml'))
-	{
-		status_message('red', $lng['install']['notinstalled']);
-		$_die = true;
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-
-	// check for filter-extension
 	status_message('begin', $lng['install']['phpfilter']);
 
 	if(!extension_loaded('filter'))
@@ -238,7 +225,6 @@ function requirement_checks() {
 		status_message('green', 'OK');
 	}
 
-	// check for posix-extension
 	status_message('begin', $lng['install']['phpposix']);	
 
 	if(!extension_loaded('posix'))
@@ -251,7 +237,6 @@ function requirement_checks() {
 		status_message('green', 'OK');
 	}
 	
-	// check for bcmath extension
 	status_message('begin', $lng['install']['phpbcmath']);
 
 	if(!extension_loaded('bcmath'))
@@ -263,7 +248,6 @@ function requirement_checks() {
 		status_message('green', 'OK');
 	}
 
-	// check for open_basedir
 	status_message('begin', $lng['install']['openbasedir']);
 	$php_ob = @ini_get("open_basedir");
 
@@ -277,32 +261,30 @@ function requirement_checks() {
 		status_message('green', 'OK');
 	}
 
-?>
-		</table>
-<?php
 	if($_die)
 	{
 ?>
-		<p style="padding-left:15px;">
+		<tr>
-			<strong><?php echo $lng['install']['diedbecauseofrequirements']; ?></strong>
+			<td class="main_field_display" align="center">
-		</p>
+				<?php echo $lng['install']['diedbecauseofrequirements']; ?><br />
-		<p class="submit">
+				<a href="install.php"><?php echo $lng['install']['click_here_to_refresh']; ?></a>
-			<a href="install.php"><?php echo $lng['install']['click_here_to_refresh']; ?></a>
+			</td>
-		</p>
+		</tr>
 <?php 
 	} else {
 ?>
-		<p style="padding-left:15px;">
+		<tr>
-			<strong><?php echo $lng['install']['froxlor_succ_checks']; ?></strong>
+			<td class="main_field_display" align="center">
-		</p>
+				<?php echo $lng['install']['froxlor_succ_checks']; ?><br />
-		<p class="submit">
+				<a href="install.php?check=1"><?php echo $lng['install']['click_here_to_continue']; ?></a>
-			<a href="install.php?check=1"><?php echo $lng['install']['click_here_to_continue']; ?></a>
+			</td>
-		</p>
+		</tr>
 <?php
 	}
 ?>
-		</section>
+	</table>
-	</article>
+	<br />
+	<br />
 <?php 
 	page_footer();
 }
@@ -522,14 +504,10 @@ if(isset($_POST['installstep'])
 	page_header();
 
 ?>
-	<article class="install bradius">
+	<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
-		<header class="dark">
+		<tr>
-			<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" />
+			<td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
-		</header>
+		</tr>
-
-		<section class="installsec">
-			<h2>Installation</h2>
-			<table class="noborder">
 <?php
 
 	//first test if we can access the database server with the given root user and password
@@ -677,6 +655,8 @@ if(isset($_POST['installstep'])
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($languages[$language]) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'standardlanguage'");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($mysql_access_host) . "' WHERE `settinggroup` = 'system' AND `varname` = 'mysql_access_host'");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
+	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
+
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpuser) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpuser'");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpgroup) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'");
 
@@ -694,16 +674,19 @@ if(isset($_POST['installstep'])
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/lighttpd reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/lighttpd.pem' WHERE `settinggroup` = 'system' AND `varname` = 'ssl_cert_file'");
+		$ssettings = '';
 	}
-	elseif($webserver == "nginx")
+        elseif($webserver == "nginx")
 	{
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/nginx reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
+		$ssettings = '';
 	}
 
 	// insert the lastcronrun to be the installation date
+
 	$query = 'UPDATE `%s` SET `value` = UNIX_TIMESTAMP() WHERE `settinggroup` = \'system\'  AND `varname` = \'lastcronrun\'';
 	$query = sprintf($query, TABLE_PANEL_SETTINGS);
 	$db->query($query);
@@ -716,6 +699,7 @@ if(isset($_POST['installstep'])
 	$db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_ticketarchive.php';");
 
 	// and lets insert the default ip and port
+
 	$query = "INSERT INTO `".TABLE_PANEL_IPSANDPORTS."` 
 			 SET `ip`= '".$db->escape($serverip)."', 
 			 `port` = '80',
@@ -726,12 +710,14 @@ if(isset($_POST['installstep'])
 	$defaultip = $db->insert_id();
 
 	// insert the defaultip
+
 	$query = 'UPDATE `%s` SET `value` = \'%s\' WHERE `settinggroup` = \'system\'  AND `varname` = \'defaultip\'';
 	$query = sprintf($query, TABLE_PANEL_SETTINGS, $db->escape($defaultip));
 	$db->query($query);
 	status_message('green', 'OK');
 
 	//last but not least create the main admin
+
 	status_message('begin', $lng['install']['adding_admin_user']);
 	$db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET
 		`loginname` = '" . $db->escape($admin_user) . "',
@@ -763,7 +749,6 @@ if(isset($_POST['installstep'])
 		`ftps_used` = 0,
 		`tickets` = -1,
 		`tickets_used` = 0,
-		`tickets_see_all` = 1,
 		`subdomains` = -1,
 		`subdomains_used` = 0,
 		`traffic` = -1048576,
@@ -776,6 +761,7 @@ if(isset($_POST['installstep'])
 	status_message('green', 'OK');
 
 	//now we create the userdata.inc.php with the mysql-accounts
+
 	status_message('begin', $lng['install']['creating_configfile']);
 	$userdata = "<?php\n";
 	$userdata.= "//automatically generated userdata.inc.php for Froxlor\n";
@@ -790,6 +776,7 @@ if(isset($_POST['installstep'])
 	$userdata.= "?>";
 
 	//we test now if we can store the userdata.inc.php in ../lib
+
 	if($fp = @fopen('../lib/userdata.inc.php', 'w'))
 	{
 		$result = @fputs($fp, $userdata, strlen($userdata));
@@ -811,15 +798,15 @@ if(isset($_POST['installstep'])
 	}
 
 ?>
-		</table>
+		<tr>
-		<p style="padding-left: 15px;">
+			<td class="main_field_display" align="center">
-			<strong><?php echo $lng['install']['froxlor_succ_installed']; ?></strong>
+				<?php echo $lng['install']['froxlor_succ_installed']; ?><br />
-		</p>
+				<a href="../index.php"><?php echo $lng['install']['click_here_to_login']; ?></a>
-		<p class="submit">
+			</td>
-			<a href="../index.php"><?php echo $lng['install']['click_here_to_login']; ?></a>
+		</tr>
-		</p>
+	</table>
-	</section>
+	<br />
-</article>
+	<br />
 <?php
 	page_footer();
 }
@@ -834,124 +821,116 @@ else
 	page_header();
 
 ?>
-	<article class="install bradius">
+	<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="get">
-		<header class="dark">
+		<input type="hidden" name="check" value="1" />
-			<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" />
+		<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
-		</header>
+			<tr>
-		<section class="installsec">
+				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['welcome']; ?></b></td>
-			<h2><?php echo $lng['install']['language']; ?></h2>
+			</tr>
-			<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="get">
+			<tr>
-				<fieldset>
+				<td class="main_field_name" colspan="2"><?php echo $lng['install']['welcometext']; ?></td>
-				<legend>Froxlor&nbsp;-&nbsp;Install</legend>
+			</tr>
-				<p>
+			<tr>
-					<label for="language"><?php echo $lng['install']['language']; ?>:</label>&nbsp;
+				<td class="main_field_name"><?php echo $lng['install']['language']; ?>: </td>
-					<select name="language" id="language">
+				<td class="main_field_display" nowrap="nowrap">
-					<?php
+					<select name="language" class="dropdown_noborder"><?php
-						$language_options = '';
+	$language_options = '';
-						while(list($language_file, $language_name) = each($languages)) {
+
-							$language_options.= makeoption($language_name, $language_file, $language, true, true);
+	while(list($language_file, $language_name) = each($languages))
-						}
+	{
-						echo $language_options;
+		$language_options.= "\n\t\t\t\t\t\t" . makeoption($language_name, $language_file, $language, true, true);
-					?>
+	}
+
+	echo $language_options;
+
+?>
+
 					</select>
-				</p>
+				</td>
-				<p class="submit">
+			</tr>
-					<input type="hidden" name="check" value="1" />
+			<tr>
-					<input type="submit" name="chooselang" value="Go" />
+				<td class="main_field_confirm" colspan="2">
-				</p>
+					<input class="bottom" type="submit" name="chooselang" value="Go" />
-				</fieldset>
+				</td>
-			</form>
+			</tr>
-			<aside>&nbsp;</aside>
+		</table>
-		</section>
+	</form>
-		<section class="installsec">
+	<br />
-			<h2><?php echo $lng['install']['installdata']; ?></h2>
+	<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="post">
-			<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="post">
+		<input type="hidden" name="check" value="1" />
-				<fieldset>
+		<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
-				<legend>Froxlor&nbsp;-&nbsp;Install</legend>
+			<tr>
-				<p>
+				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['database']; ?></b></td>
-					<strong><?php echo $lng['install']['database']; ?></strong>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"><?php echo $lng['install']['mysql_hostname']; ?>:</td>
-					<label for="mysql_host"><?php echo $lng['install']['mysql_hostname']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="mysql_host" value="<?php echo htmlspecialchars($mysql_host); ?>"/></td>
-					<input type="text" name="mysql_host" id="mysql_host" value="<?php echo htmlspecialchars($mysql_host); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"><?php echo $lng['install']['mysql_database']; ?>:</td>
-					<label for="mysql_database"><?php echo $lng['install']['mysql_database']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="mysql_database" value="<?php echo htmlspecialchars($mysql_database); ?>"/></td>
-					<input type="text" name="mysql_database" id="mysql_database" value="<?php echo htmlspecialchars($mysql_database); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_user']; ?>:</td>
-					<label for="mysql_unpriv_user"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_user']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="mysql_unpriv_user" value="<?php echo htmlspecialchars($mysql_unpriv_user); ?>"/></td>
-					<input type="text" name="mysql_unpriv_user" id="mysql_unpriv_user" value="<?php echo htmlspecialchars($mysql_unpriv_user); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_unpriv_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_pass']; ?>:</td>
-					<label for="mysql_unpriv_pass"<?php echo ((!empty($_POST['installstep']) && $mysql_unpriv_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_pass']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="password" name="mysql_unpriv_pass" value="<?php echo htmlspecialchars($mysql_unpriv_pass); ?>"/></td>
-					<input type="password" name="mysql_unpriv_pass" id="mysql_unpriv_pass" value="<?php echo htmlspecialchars($mysql_unpriv_pass); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_root_user']; ?>:</td>
-					<label for="mysql_root_user"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_root_user']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="mysql_root_user" value="<?php echo htmlspecialchars($mysql_root_user); ?>"/></td>
-					<input type="text" name="mysql_root_user" id="mysql_root_user" value="<?php echo htmlspecialchars($mysql_root_user); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_root_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_root_pass']; ?>:</td>
-					<label for="mysql_root_pass"<?php echo ((!empty($_POST['installstep']) && $mysql_root_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_root_pass']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="password" name="mysql_root_pass" value="<?php echo htmlspecialchars($mysql_root_pass); ?>"/></td>
-					<input type="password" name="mysql_root_pass" id="mysql_root_pass" value="<?php echo htmlspecialchars($mysql_root_pass); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['admin_account']; ?></b></td>
-					<strong><?php echo $lng['install']['admin_account']; ?></strong>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"><?php echo $lng['install']['admin_user']; ?>:</td>
-					<label for="admin_user"><?php echo $lng['install']['admin_user']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="admin_user" value="<?php echo htmlspecialchars($admin_user); ?>"/></td>
-					<input type="text" name="admin_user" id="admin_user" value="<?php echo htmlspecialchars($admin_user); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass1 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass']; ?>:</td>
-					<label for="admin_pass1"<?php echo ((!empty($_POST['installstep']) && ($admin_pass1 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="password" name="admin_pass1" value="<?php echo htmlspecialchars($admin_pass1); ?>"/></td>
-					<input type="password" name="admin_pass1" id="admin_pass1" value="<?php echo htmlspecialchars($admin_pass1); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass2 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass_confirm']; ?>:</td>
-					<label for="admin_pass2"<?php echo ((!empty($_POST['installstep']) && ($admin_pass2 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass_confirm']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="password" name="admin_pass2" value="<?php echo htmlspecialchars($admin_pass2); ?>"/></td>
-					<input type="password" name="admin_pass2" id="admin_pass2" value="<?php echo htmlspecialchars($admin_pass2); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['serversettings']; ?></b></td>
-					<strong><?php echo $lng['install']['serversettings']; ?></strong>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $servername == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['servername']; ?>:</td>
-					<label for="servername"<?php echo ((!empty($_POST['installstep']) && $servername == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['servername']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="servername" value="<?php echo htmlspecialchars($servername); ?>"/></td>
-					<input type="text" name="servername" id="servername" value="<?php echo htmlspecialchars($servername); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['serverip']; ?>:</td>
-					<label for="serverip"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['serverip']; ?>:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="serverip" value="<?php echo htmlspecialchars($serverip); ?>"/></td>
-					<input type="text" name="serverip" id="serverip" value="<?php echo htmlspecialchars($serverip); ?>" required/>
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?>:</td>
-					<label for="apache"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?> Apache:</label>&nbsp;
+				<td class="main_field_display"><input type="radio" name="webserver" value="apache2" <?php echo $webserver == "apache2" ? 'checked="checked"' : "" ?>/>Apache2&nbsp;<br /><input type="radio" name="webserver" value="lighttpd" <?php echo $webserver == "lighttpd" ? 'checked="checked"' : "" ?>/>Lighttpd2&nbsp;<br /><input type="radio" name="webserver" value="nginx" <?php echo $webserver == "nginx" ? 'checked="checked"' : "" ?>/>Nginx</td>
-					<input type="radio" name="webserver" id="apache" value="apache2" <?php echo $webserver == "apache2" ? 'checked="checked"' : "" ?>/>Apache2
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpuser']; ?>:</td>
-					<label for="lighty"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?> LigHTTPd:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="httpuser" value="<?php $posixusername = posix_getpwuid(posix_getuid()); echo $posixusername['name']; ?>"/></td>
-					<input type="radio" name="webserver" id="lighty" value="lighttpd" <?php echo $webserver == "lighttpd" ? 'checked="checked"' : "" ?>/>LigHTTPd
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpgroup']; ?>:</td>
-					<label for="nginx"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?> Nginx:</label>&nbsp;
+				<td class="main_field_display"><input type="text" name="httpgroup" value="<?php $posixgroup = posix_getgrgid(posix_getgid()); echo $posixgroup['name']; ?>"/></td>
-					<input type="radio" name="webserver" id="nginx" value="nginx" <?php echo $webserver == "nginx" ? 'checked="checked"' : "" ?>/>Nginx
+			</tr>
-				</p>
+			<tr>
-				<p>
+				<td class="main_field_confirm" colspan="2"><input type="hidden" name="language" value="<?php echo htmlspecialchars($language); ?>"/><input type="hidden" name="installstep" value="1"/><input class="bottom" type="submit" name="submitbutton" value="<?php echo $lng['install']['next']; ?>"/></td>
-					<label for="httpuser"<?php echo ((!empty($_POST['installstep']) && $httpuser == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpuser']; ?>:</label>&nbsp;
+			</tr>
-					<input type="text" name="httpuser" id="httpuser" value="<?php $posixusername = posix_getpwuid(posix_getuid()); echo $posixusername['name']; ?>" required/>
+		</table>
-				</p>
+	</form>
-				<p>
+	<br />
-					<label for="httpgroup"<?php echo ((!empty($_POST['installstep']) && $httpgroup == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpgroup']; ?>:</label>&nbsp;
+	<br />
-					<input type="text" name="httpgroup" id="httpgroup" value="<?php $posixgroup = posix_getgrgid(posix_getgid()); echo $posixgroup['name']; ?>" required/>
-				</p>
-				<p class="submit">
-					<input type="hidden" name="check" value="1" />
-					<input type="hidden" name="language" value="<?php echo htmlspecialchars($language); ?>"/>
-					<input type="hidden" name="installstep" value="1"/>
-					<input class="bottom" type="submit" name="submitbutton" value="<?php echo $lng['install']['next']; ?>"/>
-				</p>
-			</fieldset>
-		</form>
-		<aside>&nbsp;</aside>
-	</section>
-</article>
 <?php
 	page_footer();
 	}
@@ -964,3 +943,5 @@ else
 /**
  * END INSTALL ---------------------------------------------------
  */
+
+?>

install/lng/english.lng.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Language
- *
+ * @version    $Id$
  */
 
 /**
@@ -42,7 +42,6 @@ $lng['install']['httpuser'] = 'HTTP username';
 $lng['install']['httpgroup'] = 'HTTP groupname';
 $lng['install']['apacheversion'] = 'Apacheversion';
 $lng['install']['next'] = 'Next';
-$lng['install']['installdata'] = 'Installation - Data';
 
 /**
  * Progress
@@ -73,12 +72,6 @@ $lng['install']['bcmathdescription'] = 'Traffic-calculation related functions wi
 $lng['install']['openbasedir'] = 'Testing if open_basedir is enabled...';
 $lng['install']['openbasedirenabled'] = 'enabled. Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor';
 
-/**
- * ADDED IN 1.2.19-svn7
- */
-
-$lng['install']['servername_should_be_fqdn'] = 'The servername should be a FQDN and not an IP address';
-
 /**
  * Renamed in 1.2.19-svn40
  */
@@ -104,5 +97,5 @@ $lng['install']['froxlor_succ_checks'] = 'All requirements are satisfied';
 $lng['install']['phpmagic_quotes_runtime'] = 'Checking whether magic_quotes_runtime is off';
 $lng['install']['active'] = 'no';
 $lng['install']['phpmagic_quotes_runtime_description'] = 'PHP setting "magic_quotes_runtime" must be set to "Off" in order to avoid strange behavior of Froxlor. Disabling it for now (this is only temporary, please fix our php.ini).';
-$lng['install']['phpxml'] = 'Testing if PHP XML-extension is installed...';
+
 ?>

install/lng/french.lng.php

@@ -15,7 +15,7 @@
  * @author     Froxlor Team <team@froxlor.org>
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Language
- *
+ * @version    $Id$
  */
 
 /**
@@ -23,16 +23,16 @@
  */
 
 $lng['install']['language'] = 'Langue d\'installation';
-$lng['install']['welcome'] = 'Bienvenue <20> l\'installation de Froxlor';
+$lng['install']['welcome'] = 'Bienvenue <20> l\'installation de Froxlor';
-$lng['install']['welcometext'] = 'Merci beaucoup d\'avoir choisi Froxlor. Pour installer Froxlor remplissez les cases ci-dessous avec les informations demand<6E>es.<br /><b>Attention :</b> Si vous entrez le nom d\'une base de donn<6E>es existante, celle-ci sera effac<61>e !';
+$lng['install']['welcometext'] = 'Merci beaucoup d\'avoir choisi Froxlor. Pour installer Froxlor remplissez les cases ci-dessous avec les informations demand<6E>es.<br /><b>Attention :</b> Si vous entrez le nom d\'une base de donn<6E>es existante, celle-ci sera effac<61>e !';
-$lng['install']['database'] = 'Base de donn<6E>es';
+$lng['install']['database'] = 'Base de donn<6E>es';
-$lng['install']['mysql_hostname'] = 'Nom d\'h<>te du serveur MySQL';
+$lng['install']['mysql_hostname'] = 'Nom d\'h<>te du serveur MySQL';
-$lng['install']['mysql_database'] = 'Base de donn<6E>es MySQL';
+$lng['install']['mysql_database'] = 'Base de donn<6E>es MySQL';
-$lng['install']['mysql_unpriv_user'] = 'Utilisateur pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
+$lng['install']['mysql_unpriv_user'] = 'Utilisateur pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
-$lng['install']['mysql_unpriv_pass'] = 'Mot de passe pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
+$lng['install']['mysql_unpriv_pass'] = 'Mot de passe pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
-$lng['install']['mysql_root_user'] = 'Utilisateur pour l\'acc<63>s root <20> MySQL';
+$lng['install']['mysql_root_user'] = 'Utilisateur pour l\'acc<63>s root <20> MySQL';
-$lng['install']['mysql_root_pass'] = 'Mot de passe pour l\'acc<63>s root <20> MySQL';
+$lng['install']['mysql_root_pass'] = 'Mot de passe pour l\'acc<63>s root <20> MySQL';
-$lng['install']['admin_account'] = 'Acc<63>s administratif';
+$lng['install']['admin_account'] = 'Acc<63>s administratif';
 $lng['install']['admin_user'] = 'Login de l\'administrateur';
 $lng['install']['admin_pass'] = 'Mot de passe de l\'administrateur';
 $lng['install']['admin_pass_confirm'] = 'Mot de passe de l\'administrateur (confirmation)';
@@ -41,39 +41,31 @@ $lng['install']['servername'] = 'Nom du serveur (FQDN)';
 $lng['install']['serverip'] = 'Adresse IP du serveur';
 $lng['install']['apacheversion'] = 'Version du serveur Apache';
 $lng['install']['next'] = 'Continuer';
-$lng['install']['installdata'] = 'Installation - Data';
 
 /**
  * Progress
  */
 
-$lng['install']['testing_mysql'] = 'V<>rification du login root de MySQL ...';
+$lng['install']['testing_mysql'] = 'V<>rification du login root de MySQL ...';
-$lng['install']['erasing_old_db'] = 'Effacement de l\'ancienne base de donn<6E>es ...';
+$lng['install']['erasing_old_db'] = 'Effacement de l\'ancienne base de donn<6E>es ...';
-$lng['install']['create_mysqluser_and_db'] = 'Cr<43>ation de la base de donn<6E>es puis des utilisateurs ...';
+$lng['install']['create_mysqluser_and_db'] = 'Cr<43>ation de la base de donn<6E>es puis des utilisateurs ...';
-$lng['install']['testing_new_db'] = 'V<>rification de la base de donn<6E>es et des utilisateurs ...';
+$lng['install']['testing_new_db'] = 'V<>rification de la base de donn<6E>es et des utilisateurs ...';
-$lng['install']['importing_data'] = 'Importation des informations dans la base de donn<6E>es ...';
+$lng['install']['importing_data'] = 'Importation des informations dans la base de donn<6E>es ...';
-$lng['install']['changing_data'] = 'Modification des donn<6E>es import<72>s ...';
+$lng['install']['changing_data'] = 'Modification des donn<6E>es import<72>s ...';
 $lng['install']['adding_admin_user'] = 'Ajout de l\'utilisateur administrateur ...';
-$lng['install']['creating_configfile'] = 'Cr<43>ation du fichier de configuration ...';
+$lng['install']['creating_configfile'] = 'Cr<43>ation du fichier de configuration ...';
-$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php a <20>t<EFBFBD> sauvegard<72> dans le dossier lib/ de Froxlor.';
+$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php a <20>t<EFBFBD> sauvegard<72> dans le dossier lib/ de Froxlor.';
-$lng['install']['creating_configfile_temp'] = 'Le fichier a <20>t<EFBFBD> sauvegard<72> dans /tmp/userdata.inc.php, veuillez le d<>placer / copier dans le dossier lib/ de Froxlor.';
+$lng['install']['creating_configfile_temp'] = 'Le fichier a <20>t<EFBFBD> sauvegard<72> dans /tmp/userdata.inc.php, veuillez le d<>placer / copier dans le dossier lib/ de Froxlor.';
-$lng['install']['creating_configfile_failed'] = 'Erreur en cr<63>ant le fichier lib/userdata.inc.php, veuillez le cr<63>er avec le contenu ci-dessous :';
+$lng['install']['creating_configfile_failed'] = 'Erreur en cr<63>ant le fichier lib/userdata.inc.php, veuillez le cr<63>er avec le contenu ci-dessous :';
-$lng['install']['froxlor_succ_installed'] = 'Froxlor a <20>t<EFBFBD> install<6C> correctement.';
+$lng['install']['froxlor_succ_installed'] = 'Froxlor a <20>t<EFBFBD> install<6C> correctement.';
-$lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'invite de connexion.';
+$lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'invite de connexion.';
 $lng['install']['httpuser'] = 'Nom du utilisateur du HTTP';
 $lng['install']['httpgroup'] = 'Nom du la group du HTTP';
 
-/**
- * ADDED IN 1.2.19-svn7
- */
-
-$lng['install']['servername_should_be_fqdn'] = 'Le nom du serveur doit être un nom FQDN, pas une adresse IP';
-
 /**
  * Renamed in 1.2.19-svn40
  */
 
 $lng['install']['webserver'] = 'Version du serveur';
 
-$lng['install']['phpxml'] = 'Tester si PHP XML-extension est install<6C>e...';
 ?>

install/lng/german.lng.php

@@ -14,7 +14,7 @@
  * @author     Froxlor Team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Language
- *
+ * @version    $Id$
  */
 
 /**
@@ -40,7 +40,6 @@ $lng['install']['servername'] = 'Servername (FQDN)';
 $lng['install']['serverip'] = 'Server-IP';
 $lng['install']['apacheversion'] = 'Apacheversion';
 $lng['install']['next'] = 'Fortfahren';
-$lng['install']['installdata'] = 'Installation - Daten';
 
 /**
  * Progress
@@ -73,12 +72,6 @@ $lng['install']['openbasedirenabled'] = 'aktiviert. Froxlor wird mit aktiviertem
 $lng['install']['httpuser'] = 'HTTP Username';
 $lng['install']['httpgroup'] = 'HTTP Gruppenname';
 
-/**
- * ADDED IN 1.2.19-svn7
- */
-
-$lng['install']['servername_should_be_fqdn'] = 'Der Servername sollte eine FQDN sein und keine IP Adresse sein';
-
 /**
  * Renamed in 1.2.19-svn40
  */
@@ -104,5 +97,5 @@ $lng['install']['froxlor_succ_checks'] = 'Alle Vorraussetzungen sind erf&uuml;ll
 $lng['install']['phpmagic_quotes_runtime'] = 'Pr&uuml;fe ob magic_quotes_runtime ausgeschalten ist';
 $lng['install']['active'] = 'nein';
 $lng['install']['phpmagic_quotes_runtime_description'] = 'Die PHP Einstellung "magic_quotes_runtime" muss deaktiviert sein ("Off"), um merkw&uuml;rdige Verhalten von Froxlor zu umgehen. Sie wurde deaktiviert (nur tempor&auml;r, bitte php.ini anpassen).';
-$lng['install']['phpxml'] = 'Teste, ob die PHP XML-Erweiterung installiert ist...';
+
 ?>

install/scripts/htpasswd-htaccess-remover.php

@@ -12,7 +12,7 @@
  * @author     Michael Duergner <michael@duergner.com>
  * @license    GPLv2 http://files.syscp.org/misc/COPYING.txt
  * @package    System
- *
+ * @version    $Id$
  */
 
 if(@php_sapi_name() != 'cli'

install/scripts/language-check.php

@@ -12,7 +12,7 @@
  * @author     Martin Burchert <eremit@syscp.org>
  * @license    GPLv2 http://files.syscp.org/misc/COPYING.txt
  * @package    System
- *
+ * @version    $Id$
  */
 
 // some configs

install/tsmarty2c.php

@@ -1,124 +0,0 @@
-#!/usr/bin/php
-<?php
-/**
- * tsmarty2c.php - rips gettext strings from smarty template
- *
- * ------------------------------------------------------------------------- *
- * This library is free software; you can redistribute it and/or             *
- * modify it under the terms of the GNU Lesser General Public                *
- * License as published by the Free Software Foundation; either              *
- * version 2.1 of the License, or (at your option) any later version.        *
- *                                                                           *
- * This library is distributed in the hope that it will be useful,           *
- * but WITHOUT ANY WARRANTY; without even the implied warranty of            *
- * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU         *
- * Lesser General Public License for more details.                           *
- *                                                                           *
- * You should have received a copy of the GNU Lesser General Public          *
- * License along with this library; if not, write to the Free Software       *
- * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA  02111-1307  USA *
- * ------------------------------------------------------------------------- *
- *
- * This command line script rips gettext strings from smarty file, 
- * and prints them to stdout in C format, that can later be used with the 
- * standard gettext tools.
- *
- * Usage:
- * ./tsmarty2c.php <filename or directory> <file2> <..> > smarty.c
- *
- * If a parameter is a directory, the template files within will be parsed.
- *
- * @package	smarty-gettext
- * @version	$Id: tsmarty2c.php,v 1.3 2005/07/27 17:59:39 sagi Exp $
- * @link	http://smarty-gettext.sf.net/
- * @author	Sagi Bashari <sagi@boom.org.il>
- * @copyright 2004-2005 Sagi Bashari
- */
-
-// smarty open tag
-$ldq = preg_quote('{');
-
-// smarty close tag
-$rdq = preg_quote('}');
-
-// smarty command
-$cmd = preg_quote('t');
-
-// extensions of smarty files, used when going through a directory
-$extensions = array('tpl');
-
-// "fix" string - strip slashes, escape and convert new lines to \n
-function fs($str)
-{
-	$str = stripslashes($str);
-	$str = str_replace('"', '\"', $str);
-	$str = str_replace("\n", '\n', $str);
-	return $str;
-}
-
-// rips gettext strings from $file and prints them in C format
-function do_file($file)
-{
-	$content = @file_get_contents($file);
-
-	if (empty($content)) {
-		return;
-	}
-
-	global $ldq, $rdq, $cmd;
-
-	preg_match_all(
-			"/{$ldq}\s*({$cmd})\s*([^{$rdq}]*){$rdq}([^{$ldq}]*){$ldq}\/\\1{$rdq}/",
-			$content,
-			$matches
-	);
-	
-	for ($i=0; $i < count($matches[0]); $i++) {
-		// TODO: add line number
-		echo "/* $file */\n"; // credit: Mike van Lammeren 2005-02-14
-		
-		if (preg_match('/plural\s*=\s*["\']?\s*(.[^\"\']*)\s*["\']?/', $matches[2][$i], $match)) {
-			echo 'ngettext("'.fs($matches[3][$i]).'","'.fs($match[1]).'",x);'."\n";
-		} else {
-			echo 'gettext("'.fs($matches[3][$i]).'");'."\n";
-		}
-
-		echo "\n";
-	}
-}
-
-// go through a directory
-function do_dir($dir)
-{
-	$d = dir($dir);
-
-	while (false !== ($entry = $d->read())) {
-		if ($entry == '.' || $entry == '..') {
-			continue;
-		}
-
-		$entry = $dir.'/'.$entry;
-
-		if (is_dir($entry)) { // if a directory, go through it
-			do_dir($entry);
-		} else { // if file, parse only if extension is matched
-			$pi = pathinfo($entry);
-			
-			if (isset($pi['extension']) && in_array($pi['extension'], $GLOBALS['extensions'])) {
-				do_file($entry);
-			}
-		}
-	}
-
-	$d->close();
-}
-
-for ($ac=1; $ac < $_SERVER['argc']; $ac++) {
-	if (is_dir($_SERVER['argv'][$ac])) { // go through directory
-		do_dir($_SERVER['argv'][$ac]);
-	} else { // do file
-		do_file($_SERVER['argv'][$ac]);
-	}
-}
-
-?>

install/updates/froxlor/0.9/update_1.0.inc.php

@@ -0,0 +1,60 @@
+<?php
+
+/*
+if(isFroxlorVersion('0.9'))
+{
+	showUpdateStep("Updating from 0.9 to 1.0", false);
+	showUpdateStep("Converting database tables to UTF-8");
+
+	// Convert all data to UTF-8 to have a sane standard across all data
+	$result = $db->query("SHOW TABLES");
+	while($table = $db->fetch_array($result, 'num'))
+	{
+		$db->query("ALTER TABLE " . $table[0] . " CONVERT TO CHARACTER SET utf8 COLLATE utf8_general_ci;");
+		$db->query("ALTER TABLE " . $table[0] . " DEFAULT CHARACTER SET utf8 COLLATE utf8_general_ci");
+
+		$affected_columns = array();
+
+		$primarykey = "";
+		$columns = $db->query("SHOW COLUMNS FROM ".$table[0]);
+		while ($column = $db->fetch_array($columns))
+		{
+			if (!(strpos($column['Type'], "char") === false) || !(strpos($column['Type'], "text") === false))
+			{
+				$affected_columns[] = $column['Field'];
+			}
+
+			if ($column['Key'] == 'PRI') {
+				$primarykey = $column['Field'];
+			}
+		}
+
+		$count_cols = count($affected_columns);
+		if ($count_cols > 0)
+		{
+			$load = "";
+			foreach($affected_columns as $col)
+			{
+				$load .= ", `" . $col . "`";
+			}
+
+			$rows = $db->query("SELECT $primarykey" . $load . " FROM `" . $table[0] . "`");
+			while ($row = $db->fetch_array($rows))
+			{
+				$changes = "";
+				for ($i = 0; $i < $count_cols; $i++)
+				{
+					$base = "`" . $affected_columns[$i] . "` = '" . convertUtf8($row[$affected_columns[$i]]) . "'";
+					$changes .= ($i == ($count_cols-1)) ? $base : $base . ", ";
+				}
+
+				$db->query("UPDATE `" . $table[0] . "` SET " . $changes . " WHERE `$primarykey` = '" . $db->escape($row[$primarykey]) . "';");
+			}
+		}
+	}
+	
+	lastStepStatus(0);
+}
+*/
+
+?>

install/updates/froxlor/upgrade_syscp.inc.php

@@ -12,7 +12,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Install
- *
+ * @version    $Id$
  */
 
 $updateto = '0.9-r0';

install/updates/preconfig.php

@@ -12,7 +12,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Language
- *
+ * @version    $Id$
  */
 
 /**
@@ -49,6 +49,14 @@ function versionInUpdate($current_version, $version_to_check)
 	if (!isFroxlor()) {
 		return true;
 	}
+	$pos_a = strpos($current_version, '-svn');
+	$pos_b = strpos($version_to_check, '-svn');
+	// if we compare svn-versions, we have to add -svn0 to the version
+	// to compare it correctly	
+	if($pos_a === false && $pos_b !== false)
+	{
+		$current_version.= '-svn9999';
+	}
 	
-	return (version_compare2($current_version, $version_to_check) == -1 ? true : false);
+	return version_compare($current_version, $version_to_check, '<');
 }

install/updates/preconfig/0.9/preconfig_0.9.inc.php

@@ -12,7 +12,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Language
- *
+ * @version    $Id$
  */
 
 /**
@@ -26,7 +26,7 @@
  */
 function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 {
-	global $settings, $lng, $db, $theme;
+	global $settings, $lng, $db;
 
 	if(versionInUpdate($current_version, '0.9.4-svn2'))
 	{
@@ -73,9 +73,9 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 		$description = 'You can define a default support-ticket priority level which is pre-selected for new support-tickets.';
 		$question = '<strong>Which should be the default ticket-priority?:</strong>&nbsp;';
 		$question .= '<select name="update_deftic_priority">';
-		$priorities = makeoption($lng['ticket']['high'], '1', '2');
+		$priorities = makeoption($lng['ticket']['unf_high'], '1', '2');
-		$priorities.= makeoption($lng['ticket']['normal'], '2', '2');
+		$priorities.= makeoption($lng['ticket']['unf_normal'], '2', '2');
-		$priorities.= makeoption($lng['ticket']['low'], '3', '2');
+		$priorities.= makeoption($lng['ticket']['unf_low'], '3', '2');
 		$question .= $priorities.'</select>';
 		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
 	}
@@ -171,7 +171,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 			$has_nouser = true;
 			$guessed_user = 'www-data';
 			if(function_exists('posix_getuid')
-					&& function_exists('posix_getpwuid')
+				&& function_exists('posix_getpwuid')
 			) {
 				$_httpuser = posix_getpwuid(posix_getuid());
 				$guessed_user = $_httpuser['name'];
@@ -185,7 +185,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 			$has_nogroup = true;
 			$guessed_group = 'www-data';
 			if(function_exists('posix_getgid')
-					&& function_exists('posix_getgrgid')
+				&& function_exists('posix_getgrgid')
 			) {
 				$_httpgroup = posix_getgrgid(posix_getgid());
 				$guessed_group = $_httpgroup['name'];
@@ -251,7 +251,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 			$question.= 'Local user:&nbsp;';
 			$question.= '<input type="text" class="text" name="update_fcgid_httpuser" value="froxlorlocal" /><br /><br />';
 			$question.= 'Local group:&nbsp;';
-			$question.= '<input type="text" class="text" name="update_fcgid_httpgroup" value="froxlorlocal" /><br />';
+			$question.= '<input type="text" class="text" name="update_fcgid_ownvhost" value="froxlorlocal" /><br />';
 			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
 		}
 	}
@@ -351,194 +351,4 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 		$question = '';
 		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
 	}
-
-	if(versionInUpdate($current_version, '0.9.16-svn1'))
-	{
-		$has_preconfig = true;
-		$description = 'Froxlor now features support for php-fpm.';
-		$question = '<strong>Do you want to enable php-fpm?:</strong>&nbsp;';
-		$question.= makeyesno('update_phpfpm_enabled', '1', '0', '0').'<br /><br />';
-		$question.= 'If \'yes\', please specify the configuration directory:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_configdir" value="/etc/php-fpm.d/" /><br /><br />';
-		$question.= 'Please specify the temporary files directory:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_tmpdir" value="/var/customers/tmp/" /><br /><br />';
-		$question.= 'Please specify the PEAR directory:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_peardir" value="/usr/share/php/:/usr/share/php5/" /><br /><br />';
-		$question.= 'Please specify the php-fpm restart-command:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_reload" value="/etc/init.d/php-fpm restart" /><br /><br />';
-		$question.= 'Please specify the php-fpm rocess manager control:&nbsp;';
-		$question.= '<select name="update_phpfpm_pm">';
-		$redirects = makeoption('static', 'static', 'static');
-		$redirects.= makeoption('dynamic', 'dynamic', 'static');
-		$question .= $redirects.'</select><br /><br />';
-		$question.= 'Please specify the number of child processes:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_max_children" value="1" /><br /><br />';
-		$question.= 'Please specify the number of requests per child before respawning:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_max_requests" value="0" /><br /><br />';
-		$question.= '<em>The following settings are only required if you chose process manager = dynamic</em><br /><br />';
-		$question.= 'Please specify the number of child processes created on startup:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_start_servers" value="20" /><br /><br />';
-		$question.= 'Please specify the desired minimum number of idle server processes:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_min_spare_servers" value="5" /><br /><br />';
-		$question.= 'Please specify the desired maximum number of idle server processes:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_phpfpm_max_spare_servers" value="35" /><br />';
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if(versionInUpdate($current_version, '0.9.16-svn2'))
-	{
-		if((int)$settings['phpfpm']['enabled'] == 1)
-		{
-			$has_preconfig = true;
-			$description = 'You can chose whether you want Froxlor to use PHP-FPM itself too now.';
-			$question = '<strong>Use PHP-FPM for the Froxlor Panel?:</strong>&nbsp;';
-			$question.= makeyesno('update_phpfpm_enabled_ownvhost', '1', '0', '0').'<br /><br />';
-			$question.= '<strong>If \'yes\', please specify local user/group (have to exist, Froxlor does not add them automatically):</strong><br /><br />';
-			$question.= 'Local user:&nbsp;';
-			$question.= '<input type="text" class="text" name="update_phpfpm_httpuser" value="'.$settings['system']['mod_fcgid_httpuser'].'" /><br /><br />';
-			$question.= 'Local group:&nbsp;';
-			$question.= '<input type="text" class="text" name="update_phpfpm_httpgroup" value="'.$settings['system']['mod_fcgid_httpgroup'].'" /><br />';
-			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-		}
-	}
-
-	if(versionInUpdate($current_version, '0.9.17-svn1'))
-	{
-		$has_preconfig = true;
-		$description = 'Select if you want to enable the web- and traffic-reports';
-		$question = '<strong>Enable?:</strong>&nbsp;';
-		$question.= makeyesno('update_system_report_enable', '1', '0', '1').'<br /><br />';
-		$question.= '<strong>If \'yes\', please specify a percentage value for web- and traffic when reports are to be sent:</strong><br /><br />';
-		$question.= 'Webusage warning level:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_system_report_webmax" value="90" /><br /><br />';
-		$question.= 'Traffic warning level:&nbsp;';
-		$question.= '<input type="text" class="text" name="update_system_report_trafficmax" value="90" /><br />';
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if(versionInUpdate($current_version, '0.9.18-svn2'))
-	{
-		$has_preconfig = true;
-		$description = 'As you can (obviously) see, Froxlor now comes with a new theme. You also have the possibility to switch back to "Classic" if you want to.';
-		$question = '<strong>Select default panel theme:</strong>&nbsp;';
-		$question.= '<select name="update_default_theme">';
-		$themes = getThemes();
-		foreach($themes as $cur_theme) // $theme is already in use
-		{
-			$question.= makeoption($cur_theme, $cur_theme, 'Froxlor');
-		}
-		$question.= '</select>';
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if(versionInUpdate($current_version, '0.9.28-svn4'))
-	{
-		$has_preconfig = true;
-		$description = 'This version introduces a lot of profound changes:';
-		$description .= '<br /><ul><li>Improving the whole template system</li><li>Full UTF-8 support</li><li><strong>Removing support for the former default theme \'Classic\'</strong></li></ul>';
-		$description .= '<br /><br />Notice: This update will <strong>alter your Froxlor database to use UTF-8</strong> as default charset. ';
-		$description .= 'Even though this is already tested, we <span style="color:#ff0000;font-weight:bold;">strongly recommend</span> to ';
-		$description .= 'test this update in a testing environment using your existing data.<br /><br />';
-
-		$question = '<strong>Select your preferred Classic Theme replacement:</strong>&nbsp;';
-		$question.= '<select name="classic_theme_replacement">';
-		$themes = getThemes();
-		foreach($themes as $cur_theme)
-		{
-			$question.= makeoption($cur_theme, $cur_theme, 'Froxlor');
-		}
-		$question.= '</select>';
-
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if (versionInUpdate($current_version, '0.9.28-svn6')) {
-
-		if ($settings['system']['webserver'] == 'apache2') {
-			$has_preconfig = true;
-			$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in ordner to use it.<br />';
-			$description.= '<pre>LoadModule authz_core_module modules/mod_authz_core.so
-					LoadModule authz_host_module modules/mod_authz_host.so</pre><br />';
-			$question = '<strong>Do you want to enable the Apache-2.4 modification?:</strong>&nbsp;';
-			$question.= makeyesno('update_system_apache24', '1', '0', '0');
-			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-		} elseif ($settings['system']['webserver'] == 'nginx') {
-			$has_preconfig = true;
-			$description = 'The path to nginx\'s fastcgi_params file is now customizable.<br /><br />';
-			$question = '<strong>Please enter full path to you nginx/fastcgi_params file (including filename):</strong>&nbsp;';
-			$question.= '<input type="text" class="text" name="nginx_fastcgi_params" value="/etc/nginx/fastcgi_params" />';
-			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-		}
-	}
-
-	if (versionInUpdate($current_version, '0.9.28-rc2')) {
-
-		$has_preconfig = true;
-
-		$description  = 'This version adds an option to append the domain-name to the document-root for domains and subdomains.<br />';
-		$description .= 'You can enable or disable this feature anytime from settings -> system settings.<br />';
-
-		$question = '<strong>Do you want to automatically append the domain-name to the documentroot of newly created domains?:</strong>&nbsp;';
-		$question.= makeyesno('update_system_documentroot_use_default_value', '1', '0', '0');
-
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if (versionInUpdate($current_version, '0.9.28')) {
-
-		$has_preconfig = true;
-		// just an information about the new sendmail parameter (#1134)
-		$description  = 'Froxlor changed the default parameter-set of sendmail (php.ini)<br />';
-		$description .= 'sendmail_path = "/usr/sbin/sendmail -t <strong>-i</strong> -f {CUSTOMER_EMAIL}"<br /><br />';
-		$description .= 'If you don\'t have any problems with sending mails, you don\'t need to change this';
-		if ($settings['system']['mod_fcgid'] == '1'
-				|| $settings['phpfpm']['enabled'] == '1'
-		) {
-			// information about removal of php's safe_mode
-			$description .= '<br /><br />The php safe_mode flag has been removed as current versions of PHP<br />';
-			$description .= 'do not support it anymore.<br /><br />';
-			$description .= 'Please check your php-configurations and remove safe_mode-directives to avoid php notices/warnings.';
-		}
-		$question = '';
-
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if (versionInUpdate($current_version, '0.9.29-dev1')) {
-		// we only need to ask if fcgid|php-fpm is enabled
-		if ($settings['system']['mod_fcgid'] == '1'
-				|| $settings['phpfpm']['enabled'] == '1'
-		) {
-			$has_preconfig = true;
-			$description  = 'Standard-subdomains can now be hidden from the php-configuration overview.<br />';
-			$question = '<strong>Do you want to hide the standard-subdomains (this can be changed in the settings any time)?:</strong>&nbsp;';
-			$question.= makeyesno('hide_stdsubdomains', '1', '0', '0');
-			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-		}
-	}
-
-	if (versionInUpdate($current_version, '0.9.29-dev2')) {
-		$has_preconfig = true;
-		$description  = 'You can now decide whether admins/customers are able to change the theme<br />';
-		$question = '<strong>If you want to disallow theme-changing, select "no" from the dropdowns:</strong>&nbsp;';
-		$question.= "Admins: ". makeyesno('allow_themechange_a', '1', '0', '1').'&nbsp;&nbsp;';
-		$question.= "Customers: ".makeyesno('allow_themechange_c', '1', '0', '1');
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if (versionInUpdate($current_version, '0.9.29-dev3')) {
-		$has_preconfig = true;
-		$description  = 'There is now a possibility to specify AFXR servers for your bind zone-configuration<br />';
-		$question = '<strong>Enter a comma-separated list of AFXR servers or leave empty (default):</strong>&nbsp;';
-		$question.= '<input type="text" class="text" name="system_afxrservers" value="" />';
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
-
-	if (versionInUpdate($current_version, '0.9.29-dev4')) {
-		$has_preconfig = true;
-		$description  = 'As customers can now specify ssl-certificate data for their domains, you need to specify where the generated files are stored<br />';
-		$question = '<strong>Specify the directory for customer ssl-certificates:</strong>&nbsp;';
-		$question.= '<input type="text" class="text" name="system_customersslpath" value="/etc/apache2/ssl/" />';
-		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
-	}
 }

install/updates/syscp/1.0/update_1.0.10_1.2-beta1.inc.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Install
- *
+ * @version    $Id$
  */
 
 /**
@@ -31,7 +31,7 @@ if($settings['panel']['version'] == '1.0.10')
 {
 	// Drop/Rename postfix_ tables
 
-	$db->query("DROP TABLE IF EXISTS `" . TABLE_POSTFIX_TRANSPORT . "`");
+	$db->query("DROP TABLE `" . TABLE_POSTFIX_TRANSPORT . "`");
 	$db->query("ALTER TABLE `" . TABLE_POSTFIX_USERS . "` RENAME `" . TABLE_MAIL_USERS . "` ");
 	$db->query("ALTER TABLE `" . TABLE_POSTFIX_VIRTUAL . "` RENAME `" . TABLE_MAIL_VIRTUAL . "` ");
 
@@ -43,9 +43,9 @@ if($settings['panel']['version'] == '1.0.10')
 	// Adding tables
 
 	$db->query("DROP TABLE IF EXISTS `" . TABLE_PANEL_HTACCESS . "`;");
-	$db->query("CREATE TABLE `" . TABLE_PANEL_HTACCESS . "` (" . "  `id` int(11) unsigned NOT NULL auto_increment," . "  `customerid` int(11) unsigned NOT NULL default '0'," . "  `path` varchar(255) NOT NULL default ''," . "  `options_indexes` tinyint(1) NOT NULL default '0'," . "  PRIMARY KEY  (`id`)" . ") ENGINE=MyISAM ;");
+	$db->query("CREATE TABLE `" . TABLE_PANEL_HTACCESS . "` (" . "  `id` int(11) unsigned NOT NULL auto_increment," . "  `customerid` int(11) unsigned NOT NULL default '0'," . "  `path` varchar(255) NOT NULL default ''," . "  `options_indexes` tinyint(1) NOT NULL default '0'," . "  PRIMARY KEY  (`id`)" . ") TYPE=MyISAM ;");
 	$db->query("DROP TABLE IF EXISTS `" . TABLE_PANEL_ADMINS . "`;");
-	$db->query("CREATE TABLE `" . TABLE_PANEL_ADMINS . "` (" . "  `adminid` int(11) unsigned NOT NULL auto_increment," . "  `loginname` varchar(50) NOT NULL default ''," . "  `password` varchar(50) NOT NULL default ''," . "  `name` varchar(255) NOT NULL default ''," . "  `email` varchar(255) NOT NULL default ''," . "  `customers` int(15) NOT NULL default '0'," . "  `customers_used` int(15) NOT NULL default '0'," . "  `customers_see_all` tinyint(1) NOT NULL default '0'," . "  `domains` int(15) NOT NULL default '0'," . "  `domains_used` int(15) NOT NULL default '0'," . "  `domains_see_all` tinyint(1) NOT NULL default '0'," . "  `change_serversettings` tinyint(1) NOT NULL default '0'," . "  `diskspace` int(15) NOT NULL default '0'," . "  `diskspace_used` int(15) NOT NULL default '0'," . "  `mysqls` int(15) NOT NULL default '0'," . "  `mysqls_used` int(15) NOT NULL default '0'," . "  `emails` int(15) NOT NULL default '0'," . "  `emails_used` int(15) NOT NULL default '0'," . "  `email_forwarders` int(15) NOT NULL default '0'," . "  `email_forwarders_used` int(15) NOT NULL default '0'," . "  `ftps` int(15) NOT NULL default '0'," . "  `ftps_used` int(15) NOT NULL default '0'," . "  `subdomains` int(15) NOT NULL default '0'," . "  `subdomains_used` int(15) NOT NULL default '0'," . "  `traffic` int(15) NOT NULL default '0'," . "  `traffic_used` int(15) NOT NULL default '0'," . "  `deactivated` tinyint(1) NOT NULL default '0'," . "  `lastlogin_succ` int(11) unsigned NOT NULL default '0'," . "  `lastlogin_fail` int(11) unsigned NOT NULL default '0'," . "  `loginfail_count` int(11) unsigned NOT NULL default '0'," . "   PRIMARY KEY  (`adminid`)" . ") ENGINE=MyISAM ;");
+	$db->query("CREATE TABLE `" . TABLE_PANEL_ADMINS . "` (" . "  `adminid` int(11) unsigned NOT NULL auto_increment," . "  `loginname` varchar(50) NOT NULL default ''," . "  `password` varchar(50) NOT NULL default ''," . "  `name` varchar(255) NOT NULL default ''," . "  `email` varchar(255) NOT NULL default ''," . "  `customers` int(15) NOT NULL default '0'," . "  `customers_used` int(15) NOT NULL default '0'," . "  `customers_see_all` tinyint(1) NOT NULL default '0'," . "  `domains` int(15) NOT NULL default '0'," . "  `domains_used` int(15) NOT NULL default '0'," . "  `domains_see_all` tinyint(1) NOT NULL default '0'," . "  `change_serversettings` tinyint(1) NOT NULL default '0'," . "  `diskspace` int(15) NOT NULL default '0'," . "  `diskspace_used` int(15) NOT NULL default '0'," . "  `mysqls` int(15) NOT NULL default '0'," . "  `mysqls_used` int(15) NOT NULL default '0'," . "  `emails` int(15) NOT NULL default '0'," . "  `emails_used` int(15) NOT NULL default '0'," . "  `email_forwarders` int(15) NOT NULL default '0'," . "  `email_forwarders_used` int(15) NOT NULL default '0'," . "  `ftps` int(15) NOT NULL default '0'," . "  `ftps_used` int(15) NOT NULL default '0'," . "  `subdomains` int(15) NOT NULL default '0'," . "  `subdomains_used` int(15) NOT NULL default '0'," . "  `traffic` int(15) NOT NULL default '0'," . "  `traffic_used` int(15) NOT NULL default '0'," . "  `deactivated` tinyint(1) NOT NULL default '0'," . "  `lastlogin_succ` int(11) unsigned NOT NULL default '0'," . "  `lastlogin_fail` int(11) unsigned NOT NULL default '0'," . "  `loginfail_count` int(11) unsigned NOT NULL default '0'," . "   PRIMARY KEY  (`adminid`)" . ") TYPE=MyISAM ;");
 
 	// Insert Admin user
 

install/updates/syscp/1.0/update_1.0_1.0.10.inc.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Install
- *
+ * @version    $Id$
  */
 
 define('TABLE_POSTFIX_TRANSPORT', 'postfix_transport');

install/updates/syscp/1.2/update_1.2-beta1_1.2.19.inc.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Install
- *
+ * @version    $Id$
  */
 
 if($settings['panel']['version'] == '1.2-beta1'
@@ -51,7 +51,7 @@ if($settings['panel']['version'] == '1.2.2-cvs1')
   				`language` varchar(30)           NOT NULL default '',
   				`file`     varchar(255)          NOT NULL default '',
   			PRIMARY KEY  (`id`)
-			) ENGINE=MyISAM
+			) TYPE=MyISAM
 		");
 	$db->query("INSERT INTO `" . TABLE_PANEL_LANGUAGE . "` (`id`, `language`, `file`) VALUES (1, 'Deutsch', 'lng/german.lng.php');");
 	$db->query("INSERT INTO `" . TABLE_PANEL_LANGUAGE . "` (`id`, `language`, `file`) VALUES (2, 'English', 'lng/english.lng.php');");
@@ -88,7 +88,7 @@ if($settings['panel']['version'] == '1.2.2-cvs3')
 			  `id` int(11) unsigned NOT NULL auto_increment,
 			  `file` varchar(255) NOT NULL default '',
 			  PRIMARY KEY  (`id`)
-			) ENGINE=MyISAM
+			) TYPE=MyISAM
 		");
 	$db->query("INSERT INTO `" . TABLE_PANEL_CRONSCRIPT . "` (`id`, `file`) VALUES (1, 'cron_traffic.php');");
 	$db->query("INSERT INTO `" . TABLE_PANEL_CRONSCRIPT . "` (`id`, `file`) VALUES (2, 'cron_tasks.php');");
@@ -146,7 +146,7 @@ if($settings['panel']['version'] == '1.2.3-cvs4')
 			  PRIMARY KEY  (`id`),
 			  KEY `adminid` (`adminid`),
 			  UNIQUE `date` (`adminid` , `year` , `month` , `day`)
-			) ENGINE=MyISAM
+			) TYPE=MyISAM
 		");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value`='1.2.3-cvs5' WHERE `settinggroup`='panel' AND `varname`='version'");
 	$settings['panel']['version'] = '1.2.3-cvs5';
@@ -267,7 +267,7 @@ if($settings['panel']['version'] == '1.2.6')
   			`value` longtext NOT NULL,
   			PRIMARY KEY  (`id`),
   			KEY `adminid` (`adminid`)
-			) ENGINE=MyISAM
+			) TYPE=MyISAM
 		');
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value`='1.2.6-cvs1' WHERE `settinggroup`='panel' AND `varname`='version'");
 	$settings['panel']['version'] = '1.2.6-cvs1';
@@ -458,7 +458,7 @@ if($settings['panel']['version'] == '1.2.12-svn1')
 			`port` int(5) NOT NULL default \'80\',
 			`default` int(1) NOT NULL default \'0\',
 			PRIMARY KEY  (`id`)
-			) ENGINE=MyISAM');
+			) TYPE=MyISAM');
 	$db->query('INSERT INTO `' . TABLE_PANEL_IPSANDPORTS . '` (`ip`, `port`, `default`) VALUES (\'' . $settings['system']['ipaddress'] . '\', \'80\', \'1\')');
 	$db->query('UPDATE `' . TABLE_PANEL_SETTINGS . '` SET `value` = \'1.2.12-svn2\' WHERE `settinggroup` = \'panel\' AND `varname` = \'version\'');
 	$settings['panel']['version'] = '1.2.12-svn2';

install/updates/syscp/1.2/update_1.2.19_1.4.inc.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Install
- *
+ * @version    $Id$
  */
 
 if($settings['panel']['version'] == '1.2.19')
@@ -620,7 +620,7 @@ else
 		  `mysql` bigint(30) unsigned NOT NULL default '0',
 		  PRIMARY KEY  (`id`),
 		  KEY `customerid` (`customerid`)
-		) ENGINE=MyISAM ;");
+		) TYPE=MyISAM ;");
 		$db->query("CREATE TABLE `" . TABLE_PANEL_DISKSPACE_ADMINS . "` (
 		  `id` int(11) unsigned NOT NULL auto_increment,
 		  `adminid` int(11) unsigned NOT NULL default '0',
@@ -633,7 +633,7 @@ else
 		  `mysql` bigint(30) unsigned NOT NULL default '0',
 		  PRIMARY KEY  (`id`),
 		  KEY `adminid` (`adminid`)
-		) ENGINE=MyISAM ;");
+		) TYPE=MyISAM ;");
 		$db->query("INSERT INTO `" . TABLE_BILLING_SERVICE_CATEGORIES . "` (`id`, `category_name`, `category_order`, `category_classname`, `category_classfile`, `category_cachefield`, `category_caption`, `category_rowcaption_setup`, `category_rowcaption_interval`) VALUES (1, 'hosting', 10, 'hosting', 'lib/billing_class_hosting.php', 'invoice_fee_hosting', 'hosting_caption', 'hosting_rowcaption_setup', 'hosting_rowcaption_interval');");
 		$db->query("INSERT INTO `" . TABLE_BILLING_SERVICE_CATEGORIES . "` (`id`, `category_name`, `category_order`, `category_classname`, `category_classfile`, `category_cachefield`, `category_caption`, `category_rowcaption_setup`, `category_rowcaption_interval`) VALUES (2, 'domains', 20, 'domains', 'lib/billing_class_domains.php', 'invoice_fee_domains', 'domains_caption', 'domains_rowcaption_setup', 'domains_rowcaption_interval');");
 		$db->query("INSERT INTO `" . TABLE_BILLING_SERVICE_CATEGORIES . "` (`id`, `category_name`, `category_order`, `category_classname`, `category_classfile`, `category_cachefield`, `category_caption`, `category_rowcaption_setup`, `category_rowcaption_interval`) VALUES (3, 'traffic', 30, 'traffic', 'lib/billing_class_traffic.php', 'invoice_fee_traffic', 'traffic_caption', 'traffic_rowcaption_setup', 'traffic_rowcaption_interval');");
@@ -803,7 +803,7 @@ else
 					`description` varchar(50) NOT NULL,
 					PRIMARY KEY  (`id`)
 					) ENGINE=MyISAM");
-		$db->query("INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` (`id`, `phpsettings`, `description`) VALUES(1, 'short_open_tag = On\r\nasp_tags = Off\r\nprecision = 14\r\noutput_buffering = 4096\r\nallow_call_time_pass_reference = Off\r\nsafe_mode = {SAFE_MODE}\r\nsafe_mode_gid = Off\r\nsafe_mode_include_dir = \"{PEAR_DIR}\"\r\nsafe_mode_allowed_env_vars = PHP_\r\nsafe_mode_protected_env_vars = LD_LIBRARY_PATH\r\n{OPEN_BASEDIR_C}open_basedir = \"{OPEN_BASEDIR}\"\r\ndisable_functions = exec,passthru,shell_exec,system,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate\r\ndisable_classes =\r\nexpose_php = Off\r\nmax_execution_time = 30\r\nmax_input_time = 60\r\nmemory_limit = 16M\r\npost_max_size = 16M\r\nerror_reporting = E_ALL & ~E_NOTICE\r\ndisplay_errors = On\r\ndisplay_startup_errors = Off\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\nreport_memleaks = On\r\ntrack_errors = Off\r\nhtml_errors = Off\r\nvariables_order = \"GPCS\"\r\nregister_globals = Off\r\nregister_argc_argv = Off\r\ngpc_order = \"GPC\"\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\ninclude_path = \".:{PEAR_DIR}\"\r\nenable_dl = Off\r\nfile_uploads = On\r\nupload_tmp_dir = \"{TMP_DIR}\"\r\nupload_max_filesize = 32M\r\nallow_url_fopen = Off\r\nsendmail_path = \"/usr/sbin/sendmail -t -f {CUSTOMER_EMAIL}\"\r\nsession.save_handler = files\r\nsession.save_path = \"{TMP_DIR}\"\r\nsession.use_cookies = 1\r\nsession.name = PHPSESSID\r\nsession.auto_start = 0\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.cookie_domain =\r\nsession.serialize_handler = php\r\nsession.gc_probability = 1\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.referer_check =\r\nsession.entropy_length = 16\r\nsession.entropy_file = /dev/urandom\r\nsession.cache_limiter = nocache\r\nsession.cache_expire = 180\r\nsession.use_trans_sid = 0\r\nsuhosin.simulation = Off\r\nsuhosin.mail.protect = 1\r\n', 'Default Config')");
+		$db->query("INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` (`id`, `phpsettings`, `description`) VALUES(1, 'short_open_tag = On\r\nasp_tags = Off\r\nprecision = 14\r\noutput_buffering = 4096\r\nallow_call_time_pass_reference = Off\r\nsafe_mode = {SAFE_MODE}\r\nsafe_mode_gid = Off\r\nsafe_mode_include_dir = \"{PEAR_DIR}\"\r\nsafe_mode_allowed_env_vars = PHP_\r\nsafe_mode_protected_env_vars = LD_LIBRARY_PATH\r\nopen_basedir = \"{OPEN_BASEDIR}\"\r\ndisable_functions = exec,passthru,shell_exec,system,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate\r\ndisable_classes =\r\nexpose_php = Off\r\nmax_execution_time = 30\r\nmax_input_time = 60\r\nmemory_limit = 16M\r\npost_max_size = 16M\r\nerror_reporting = E_ALL & ~E_NOTICE\r\ndisplay_errors = On\r\ndisplay_startup_errors = Off\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\nreport_memleaks = On\r\ntrack_errors = Off\r\nhtml_errors = Off\r\nvariables_order = \"GPCS\"\r\nregister_globals = Off\r\nregister_argc_argv = Off\r\ngpc_order = \"GPC\"\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\ninclude_path = \".:{PEAR_DIR}\"\r\nenable_dl = Off\r\nfile_uploads = On\r\nupload_tmp_dir = \"{TMP_DIR}\"\r\nupload_max_filesize = 32M\r\nallow_url_fopen = Off\r\nsendmail_path = \"/usr/sbin/sendmail -t -f {CUSTOMER_EMAIL}\"\r\nsession.save_handler = files\r\nsession.save_path = \"{TMP_DIR}\"\r\nsession.use_cookies = 1\r\nsession.name = PHPSESSID\r\nsession.auto_start = 0\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.cookie_domain =\r\nsession.serialize_handler = php\r\nsession.gc_probability = 1\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.referer_check =\r\nsession.entropy_length = 16\r\nsession.entropy_file = /dev/urandom\r\nsession.cache_limiter = nocache\r\nsession.cache_expire = 180\r\nsession.use_trans_sid = 0\r\nsuhosin.simulation = Off\r\nsuhosin.mail.protect = 1\r\n', 'Default Config')");
 		$db->query("ALTER TABLE `" . TABLE_PANEL_DOMAINS . "` ADD `phpsettingid` INT( 11 ) UNSIGNED NOT NULL DEFAULT '1'");
 		$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES('system', 'mod_fcgid_wrapper', '0')");
 		$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES('system', 'mod_fcgid_starter', '0')");

install/updates/syscp/1.4/update_1.4.inc.php

@@ -14,7 +14,7 @@
  * @author     Froxlor team <team@froxlor.org> (2010-)
  * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
  * @package    Install
- *
+ * @version    $Id$
  */
 
 if($settings['panel']['version'] == '1.4')