Compare commits

..

1 Commits

Author SHA1 Message Date
Michael Kaufmann (d00p)
3b8b973926 Tagging version 0.9.17 2011-01-26 07:24:50 +00:00
1319 changed files with 19281 additions and 73210 deletions

10
.gitignore vendored
View File

@@ -1,10 +0,0 @@
packages/*
lib/classes/htmlpurifier/library/HTMLPurifier/DefinitionCache/Serializer/*/
temp/*
templates/*
install/update.log
.buildpath
.project
.settings/
*.diff
*~

11
COPYING
View File

@@ -2,7 +2,7 @@
Version 2, June 1991 Version 2, June 1991
Copyright (C) 1989, 1991 Free Software Foundation, Inc. Copyright (C) 1989, 1991 Free Software Foundation, Inc.
51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA 675 Mass Ave, Cambridge, MA 02139, USA
Everyone is permitted to copy and distribute verbatim copies Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed. of this license document, but changing it is not allowed.
@@ -55,7 +55,7 @@ patent must be licensed for everyone's free use or not licensed at all.
The precise terms and conditions for copying, distribution and The precise terms and conditions for copying, distribution and
modification follow. modification follow.
GNU GENERAL PUBLIC LICENSE GNU GENERAL PUBLIC LICENSE
TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
@@ -110,7 +110,7 @@ above, provided that you also meet all of these conditions:
License. (Exception: if the Program itself is interactive but License. (Exception: if the Program itself is interactive but
does not normally print such an announcement, your work based on does not normally print such an announcement, your work based on
the Program is not required to print an announcement.) the Program is not required to print an announcement.)
These requirements apply to the modified work as a whole. If These requirements apply to the modified work as a whole. If
identifiable sections of that work are not derived from the Program, identifiable sections of that work are not derived from the Program,
and can be reasonably considered independent and separate works in and can be reasonably considered independent and separate works in
@@ -168,7 +168,7 @@ access to copy from a designated place, then offering equivalent
access to copy the source code from the same place counts as access to copy the source code from the same place counts as
distribution of the source code, even though third parties are not distribution of the source code, even though third parties are not
compelled to copy the source along with the object code. compelled to copy the source along with the object code.
4. You may not copy, modify, sublicense, or distribute the Program 4. You may not copy, modify, sublicense, or distribute the Program
except as expressly provided under this License. Any attempt except as expressly provided under this License. Any attempt
otherwise to copy, modify, sublicense or distribute the Program is otherwise to copy, modify, sublicense or distribute the Program is
@@ -225,7 +225,7 @@ impose that choice.
This section is intended to make thoroughly clear what is believed to This section is intended to make thoroughly clear what is believed to
be a consequence of the rest of this License. be a consequence of the rest of this License.
8. If the distribution and/or use of the Program is restricted in 8. If the distribution and/or use of the Program is restricted in
certain countries either by patents or by copyrighted interfaces, the certain countries either by patents or by copyrighted interfaces, the
original copyright holder who places the Program under this License original copyright holder who places the Program under this License
@@ -278,3 +278,4 @@ PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
POSSIBILITY OF SUCH DAMAGES. POSSIBILITY OF SUCH DAMAGES.
END OF TERMS AND CONDITIONS END OF TERMS AND CONDITIONS

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
return array( return array(
@@ -32,32 +32,6 @@ return array(
'option_options_method' => 'getLanguages', 'option_options_method' => 'getLanguages',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_default_theme' => array(
'label' => array('title' => $lng['panel']['theme'], 'description' => $lng['serversettings']['default_theme']),
'settinggroup' => 'panel',
'varname' => 'default_theme',
'type' => 'option',
'default' => 'Froxlor',
'option_mode' => 'one',
'option_options_method' => 'getThemes',
'save_method' => 'storeSettingField',
),
'panel_allow_theme_change_customer' => array(
'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_customer',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'panel_allow_theme_change_admin' => array(
'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_admin',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField'
),
'panel_natsorting' => array( 'panel_natsorting' => array(
'label' => $lng['serversettings']['natsorting'], 'label' => $lng['serversettings']['natsorting'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -93,23 +67,6 @@ return array(
'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']), 'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'use_webfonts' => array(
'label' => $lng['serversettings']['enablewebfonts'],
'settinggroup' => 'panel',
'varname' => 'use_webfonts',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'webfont' => array(
'label' => $lng['serversettings']['definewebfont']['title'],
'settinggroup' => 'panel',
'varname' => 'webfont',
'type' => 'string',
'default' => 'Numans',
'string_emptyallowed' => false,
'save_method' => 'storeSettingField',
),
'panel_adminmail' => array( 'panel_adminmail' => array(
'label' => $lng['serversettings']['adminmail'], 'label' => $lng['serversettings']['adminmail'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -194,6 +151,14 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'admin_froxlor_graphic' => array(
'label' => $lng['admin']['froxlor_graphic'],
'settinggroup' => 'admin',
'varname' => 'froxlor_graphic',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'panel_allow_domain_change_admin' => array( 'panel_allow_domain_change_admin' => array(
'label' => $lng['serversettings']['panel_allow_domain_change_admin'], 'label' => $lng['serversettings']['panel_allow_domain_change_admin'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -210,14 +175,6 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_phpconfigs_hidestdsubdomain' => array(
'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
'settinggroup' => 'panel',
'varname' => 'phpconfigs_hidestdsubdomain',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
), ),
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -27,19 +27,10 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'documentroot_prefix', 'varname' => 'documentroot_prefix',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/webs/', 'default' => '/var/customers/webs/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'plausibility_check_method' => 'checkPathConflicts' 'plausibility_check_method' => 'checkPathConflicts'
), ),
'system_documentroot_use_default_value' => array(
'label' => $lng['serversettings']['documentroot_use_default_value'],
'settinggroup' => 'system',
'varname' => 'documentroot_use_default_value',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
'system_ipaddress' => array( 'system_ipaddress' => array(
'label' => $lng['serversettings']['ipaddress'], 'label' => $lng['serversettings']['ipaddress'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -67,7 +58,6 @@ return array(
'type' => 'string', 'type' => 'string',
'default' => '', 'default' => '',
'save_method' => 'storeSettingHostname', 'save_method' => 'storeSettingHostname',
'plausibility_check_method' => 'checkHostname',
), ),
'system_froxlordirectlyviahostname' => array( 'system_froxlordirectlyviahostname' => array(
'label' => $lng['serversettings']['froxlordirectlyviahostname'], 'label' => $lng['serversettings']['froxlordirectlyviahostname'],
@@ -77,14 +67,6 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_validatedomain' => array(
'label' => $lng['serversettings']['validate_domain'],
'settinggroup' => 'system',
'varname' => 'validate_domain',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'system_stdsubdomain' => array( 'system_stdsubdomain' => array(
'label' => $lng['serversettings']['stdsubdomainhost'], 'label' => $lng['serversettings']['stdsubdomainhost'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -146,7 +128,7 @@ return array(
'varname' => 'report_webmax', 'varname' => 'report_webmax',
'type' => 'int', 'type' => 'int',
'int_min' => 1, 'int_min' => 1,
'int_max' => 150, 'int_max' => 99,
'default' => 90, 'default' => 90,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
@@ -156,7 +138,7 @@ return array(
'varname' => 'report_trafficmax', 'varname' => 'report_trafficmax',
'type' => 'int', 'type' => 'int',
'int_min' => 1, 'int_min' => 1,
'int_max' => 150, 'int_max' => 99,
'default' => 90, 'default' => 90,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -33,15 +33,6 @@ return array(
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'overview_option' => true 'overview_option' => true
), ),
'system_apache_24' => array(
'label' => $lng['serversettings']['apache_24'],
'settinggroup' => 'system',
'varname' => 'apache24',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_httpuser' => array( 'system_httpuser' => array(
'label' => $lng['admin']['webserver_user'], 'label' => $lng['admin']['webserver_user'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -94,15 +85,6 @@ return array(
'default' => '/var/customers/logs/', 'default' => '/var/customers/logs/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_customersslpath' => array(
'label' => $lng['serversettings']['customerssl_directory'],
'settinggroup' => 'system',
'varname' => 'customer_ssl_path',
'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/apache2/ssl/',
'save_method' => 'storeSettingField',
),
'system_phpappendopenbasedir' => array( 'system_phpappendopenbasedir' => array(
'label' => $lng['serversettings']['phpappendopenbasedir'], 'label' => $lng['serversettings']['phpappendopenbasedir'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -142,7 +124,7 @@ return array(
'label' => $lng['serversettings']['phpreload_command'], 'label' => $lng['serversettings']['phpreload_command'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'phpreload_command', 'varname' => 'phpreload_command',
'type' => 'string', 'type' => (getSetting('phpfpm', 'enabled') == '1') ? 'hidden' : 'string',
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx') 'websrv_avail' => array('nginx')
@@ -151,20 +133,19 @@ return array(
'label' => $lng['serversettings']['nginx_php_backend'], 'label' => $lng['serversettings']['nginx_php_backend'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'nginx_php_backend', 'varname' => 'nginx_php_backend',
'type' => 'string', 'type' => (getSetting('phpfpm', 'enabled') == '1') ? 'hidden' : 'string',
'default' => '127.0.0.1:8888', 'default' => '127.0.0.1:8888',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx') 'websrv_avail' => array('nginx')
), ),
'nginx_fastcgiparams' => array( 'system_mod_log_sql' => array(
'label' => $lng['serversettings']['nginx_fastcgiparams'], 'label' => $lng['serversettings']['mod_log_sql'],
'settinggroup' => 'nginx', 'settinggroup' => 'system',
'varname' => 'fastcgiparams', 'varname' => 'mod_log_sql',
'type' => 'string', 'type' => 'bool',
'string_type' => 'file', 'default' => false,
'default' => '/etc/nginx/fastcgi_params',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx') 'websrv_avail' => array('apache2')
), ),
'defaultwebsrverrhandler_enabled' => array( 'defaultwebsrverrhandler_enabled' => array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'], 'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
@@ -228,8 +209,72 @@ return array(
'option_options_method' => 'getRedirectCodes', 'option_options_method' => 'getRedirectCodes',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2', 'lighttpd') 'websrv_avail' => array('apache2', 'lighttpd')
) ),
) ),
) ),
) 'ssl' => array(
'title' => $lng['admin']['sslsettings'],
'fields' => array(
'system_ssl_enabled' => array(
'label' => $lng['serversettings']['ssl']['use_ssl'],
'settinggroup' => 'system',
'varname' => 'use_ssl',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_ssl_cert_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.pem',
'save_method' => 'storeSettingField',
),
'system_ssl_key_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_key_file'],
'settinggroup' => 'system',
'varname' => 'ssl_key_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.key',
'save_method' => 'storeSettingField',
),
'system_ssl_ca_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
'settinggroup' => 'system',
'varname' => 'ssl_ca_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_ssl_cert_chainfile' => array(
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_chainfile',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_ssl_openssl_cnf' => array(
'label' => $lng['serversettings']['ssl']['openssl_cnf'],
'settinggroup' => 'system',
'varname' => 'openssl_cnf',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
),
),
),
),
); );
?>

View File

@@ -1,77 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'ssl' => array(
'title' => $lng['admin']['sslsettings'],
'fields' => array(
'system_ssl_enabled' => array(
'label' => $lng['serversettings']['ssl']['use_ssl'],
'settinggroup' => 'system',
'varname' => 'use_ssl',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_ssl_cert_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.pem',
'save_method' => 'storeSettingField',
),
'system_ssl_key_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_key_file'],
'settinggroup' => 'system',
'varname' => 'ssl_key_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.key',
'save_method' => 'storeSettingField',
),
'system_ssl_ca_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
'settinggroup' => 'system',
'varname' => 'ssl_ca_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_ssl_cert_chainfile' => array(
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_chainfile',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
)
)
)
)
);

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -66,7 +66,7 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'mod_fcgid_wrapper', 'varname' => 'mod_fcgid_wrapper',
'type' => 'option', 'type' => 'option',
'option_options' => array(0 => 'ScriptAlias', 1=> 'FcgidWrapper'), 'option_options' => array(0 => 'ScriptAlias', 1=> 'FCGIWrapper'),
'default' => 1, 'default' => 1,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2') 'websrv_avail' => array('apache2')
@@ -135,14 +135,6 @@ return array(
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2') 'websrv_avail' => array('apache2')
), ),
'system_mod_fcgid_idle_timeout' => array(
'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_idle_timeout',
'type' => 'int',
'default' => 30,
'save_method' => 'storeSettingField'
),
) )
) )
) )

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -54,16 +54,9 @@ return array(
'default' => 'froxlorlocal', 'default' => 'froxlorlocal',
'save_method' => 'storeSettingField' 'save_method' => 'storeSettingField'
), ),
'system_phpfpm_defaultini' => array( /*
'label' => $lng['serversettings']['mod_fcgid']['defaultini'], * @TODO implement if phpfpm knows custom php.ini files
'settinggroup' => 'phpfpm', *
'varname' => 'defaultini',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField',
),
'system_phpfpm_defaultini_ownvhost' => array( 'system_phpfpm_defaultini_ownvhost' => array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'], 'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
'settinggroup' => 'phpfpm', 'settinggroup' => 'phpfpm',
@@ -74,6 +67,7 @@ return array(
'option_options_method' => 'getPhpConfigs', 'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
*/
'system_phpfpm_configdir' => array( 'system_phpfpm_configdir' => array(
'label' => $lng['serversettings']['phpfpm_settings']['configdir'], 'label' => $lng['serversettings']['phpfpm_settings']['configdir'],
'settinggroup' => 'phpfpm', 'settinggroup' => 'phpfpm',
@@ -83,15 +77,6 @@ return array(
'default' => '/etc/php-fpm.d/', 'default' => '/etc/php-fpm.d/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_phpfpm_aliasconfigdir' => array(
'label' => $lng['serversettings']['phpfpm_settings']['aliasconfigdir'],
'settinggroup' => 'phpfpm',
'varname' => 'aliasconfigdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/www/php-fpm/',
'save_method' => 'storeSettingField',
),
'system_phpfpm_tmpdir' => array( 'system_phpfpm_tmpdir' => array(
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'], 'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
'settinggroup' => 'phpfpm', 'settinggroup' => 'phpfpm',
@@ -125,7 +110,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => 'static', 'default' => 'static',
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array('static' => 'static', 'dynamic' => 'dynamic', 'ondemand' => 'ondemand'), 'option_options' => array('static' => 'static', 'dynamic' => 'dynamic'),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_phpfpm_max_children' => array( 'system_phpfpm_max_children' => array(
@@ -168,14 +153,6 @@ return array(
'default' => 0, 'default' => 0,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_phpfpm_idle_timeout' => array(
'label' => $lng['serversettings']['phpfpm_settings']['idle_timeout'],
'settinggroup' => 'phpfpm',
'varname' => 'idle_timeout',
'type' => 'int',
'default' => 30,
'save_method' => 'storeSettingField'
),
), ),
), ),
), ),

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -43,7 +43,6 @@ return array(
'settinggroup' => 'perl', 'settinggroup' => 'perl',
'varname' => 'suexecpath', 'varname' => 'suexecpath',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/var/www/cgi-bin/', 'default' => '/var/www/cgi-bin/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2') 'websrv_avail' => array('apache2')

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -51,16 +51,6 @@ return array(
'default' => '/var/customers/mail/', 'default' => '/var/customers/mail/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_vmail_maildirname' => array(
'label' => $lng['serversettings']['vmail_maildirname'],
'settinggroup' => 'system',
'varname' => 'vmail_maildirname',
'type' => 'string',
'string_type' => 'dir',
'default' => 'Maildir',
'string_emptyallowed' => true,
'save_method' => 'storeSettingField',
),
'panel_sendalternativemail' => array( 'panel_sendalternativemail' => array(
'label' => $lng['serversettings']['sendalternativemail'], 'label' => $lng['serversettings']['sendalternativemail'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -100,14 +90,6 @@ return array(
'type' => 'hidden', 'type' => 'hidden',
'default' => 0, 'default' => 0,
), ),
'system_catchall_enabled' => array(
'label' => $lng['serversettings']['catchall_enabled'],
'settinggroup' => 'catchall',
'varname' => 'catchall_enabled',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingResetCatchall',
),
), ),
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id: 220.ftpserver.php 1 2010-04-07 10:00:00Z monotek $
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -22,15 +22,6 @@ return array(
'nameserver' => array( 'nameserver' => array(
'title' => $lng['admin']['nameserversettings'], 'title' => $lng['admin']['nameserversettings'],
'fields' => array( 'fields' => array(
'nameserver_enable' => array(
'label' => $lng['serversettings']['bindenable'],
'settinggroup' => 'system',
'varname' => 'bind_enable',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_bindconf_directory' => array( 'system_bindconf_directory' => array(
'label' => $lng['serversettings']['bindconf_directory'], 'label' => $lng['serversettings']['bindconf_directory'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -68,16 +59,6 @@ return array(
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_axfrservers' => array(
'label' => $lng['serversettings']['axfrservers'],
'settinggroup' => 'system',
'varname' => 'axfrservers',
'type' => 'string',
'string_type' => 'validate_ip',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_dns_createmailentry' => array( 'system_dns_createmailentry' => array(
'label' => $lng['serversettings']['mail_also_with_mxservers'], 'label' => $lng['serversettings']['mail_also_with_mxservers'],
'settinggroup' => 'system', 'settinggroup' => 'system',

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,11 +14,9 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
global $settings;
return array( return array(
'groups' => array( 'groups' => array(
'dkim' => array( 'dkim' => array(
@@ -38,7 +36,6 @@ return array(
'settinggroup' => 'dkim', 'settinggroup' => 'dkim',
'varname' => 'dkim_prefix', 'varname' => 'dkim_prefix',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/postfix/dkim/', 'default' => '/etc/postfix/dkim/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
@@ -81,10 +78,7 @@ return array(
'save_method' => 'storeSettingFieldInsertBindTask', 'save_method' => 'storeSettingFieldInsertBindTask',
), ),
'dkim_keylength' => array( 'dkim_keylength' => array(
'label' => array( 'label' => $lng['dkim']['dkim_keylength'],
'title' => $lng['dkim']['dkim_keylength']['title'],
'description' => sprintf($lng['dkim']['dkim_keylength']['description'],$settings['dkim']['dkim_prefix'])
),
'settinggroup' => 'dkim', 'settinggroup' => 'dkim',
'varname' => 'dkim_keylength', 'varname' => 'dkim_keylength',
'type' => 'option', 'type' => 'option',

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -133,7 +133,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => 2, 'default' => 2,
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array(1 => $lng['ticket']['high'], 2 => $lng['ticket']['normal'], 3 => $lng['ticket']['low']), 'option_options' => array(1 => $lng['ticket']['unf_high'], 2 => $lng['ticket']['unf_normal'], 3 => $lng['ticket']['unf_low']),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -59,7 +59,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => '', 'default' => '',
'option_mode' => 'multiple', 'option_mode' => 'multiple',
'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring', 'Zend Optimizer' => 'Zend Guard'), 'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring'),
'save_method' => 'storeSettingApsPhpExtensions', 'save_method' => 'storeSettingApsPhpExtensions',
), ),
'aps_php-function' => array( 'aps_php-function' => array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -38,17 +38,9 @@ return array(
'default' => true, 'default' => true,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_passwordcryptfunc' => array( ),
'label' => $lng['serversettings']['passwordcryptfunc'], ),
'settinggroup' => 'system', ),
'varname' => 'passwordcryptfunc',
'type' => 'option',
'default' => 0,
'option_mode' => 'one',
'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
'save_method' => 'storeSettingField',
)
)
)
)
); );
?>

View File

@@ -1,118 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'backup' => array(
'title' => $lng['backup'],
'fields' => array(
'backup_enabled' => array(
'label' => $lng['serversettings']['backup_enabled'],
'settinggroup' => 'system',
'varname' => 'backup_enabled',
'type' => 'bool',
'default' => false,
'cronmodule' => 'froxlor/backup',
'save_method' => 'storeSettingField',
'overview_option' => true
),
'backup_dir' => array(
'label' => $lng['serversettings']['backupdir']['description'],
'settinggroup' => 'system',
'varname' => 'backup_dir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/backups/',
'string_regexp' => '#^/.*/$#',
'save_method' => 'storeSettingField',
),
'backup_mysqldump_path' => array(
'label' => $lng['serversettings']['mysqldump_path']['description'],
'settinggroup' => 'system',
'varname' => 'backup_mysqldump_path',
'type' => 'string',
'default' => '/usr/bin/mysqldump',
'save_method' => 'storeSettingField',
),
'backup_count' => array(
'label' => $lng['serversettings']['backup_count'],
'settinggroup' => 'system',
'varname' => 'backup_count',
'type' => 'bool',
'default' => 'true',
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_bigfile' => array(
'label' => $lng['serversettings']['backup_bigfile'],
'settinggroup' => 'system',
'varname' => 'backup_bigfile',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_ftp_enabled_' => array(
'label' => $lng['serversettings']['backup_ftp_enabled'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_server' => array(
'label' => $lng['serversettings']['backup_ftp_server'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_server',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_user' => array(
'label' => $lng['serversettings']['backup_ftp_user'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_user',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_pass' => array(
'label' => $lng['serversettings']['backup_ftp_pass'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_pass',
'type' => 'hiddenstring',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_passive_mode' => array(
'label' => $lng['serversettings']['backup_ftp_passive_mode'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_passive',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
'overview_option' => false,
),
),
),
),
);
?>

View File

@@ -1,60 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2011- the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2011-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'diskquota' => array(
'title' => $lng['diskquota'],
'fields' => array(
'diskquota_enabled' => array(
'label' => $lng['serversettings']['diskquota_enabled'],
'settinggroup' => 'system',
'varname' => 'diskquota_enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'diskquota_repquota_path' => array(
'label' => $lng['serversettings']['diskquota_repquota_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_repquota_path',
'type' => 'string',
'default' => '/usr/sbin/repquota',
'save_method' => 'storeSettingField',
),
'diskquota_quotatool_path' => array(
'label' => $lng['serversettings']['diskquota_quotatool_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_quotatool_path',
'type' => 'string',
'default' => '/usr/bin/quotatool',
'save_method' => 'storeSettingField',
),
'diskquota_customer_partition' => array(
'label' => $lng['serversettings']['diskquota_customer_partition']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_customer_partition',
'type' => 'string',
'default' => '/dev/root',
'save_method' => 'storeSettingField',
),
),
),
),
);
?>

View File

@@ -1,67 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'logrotate' => array(
'title' => $lng['logrotate'],
'fields' => array(
'logrotate_enabled' => array(
'label' => $lng['logrotate_enabled'],
'settinggroup' => 'system',
'varname' => 'logrotate_enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'logrotate_binary' => array(
'label' => $lng['logrotate_binary'],
'settinggroup' => 'system',
'varname' => 'logrotate_binary',
'type' => 'string',
'default' => '/usr/sbin/logrotate',
'save_method' => 'storeSettingField',
'overview_option' => false
),
'logrotate_interval' => array(
'label' => $lng['logrotate_interval'],
'settinggroup' => 'system',
'varname' => 'logrotate_interval',
'type' => 'option',
'default' => 'weekly',
'option_mode' => 'one',
'option_options' => array('daily' => 'Daily', 'weekly' => 'Weekly', 'monthly' => 'Monthly'),
'save_method' => 'storeSettingField',
'overview_option' => false
),
'logrotate_keep' => array(
'label' => $lng['logrotate_keep'],
'settinggroup' => 'system',
'varname' => 'logrotate_keep',
'type' => 'string',
'default' => '4',
'save_method' => 'storeSettingField',
'overview_option' => false
),
),
),
),
);
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -47,6 +47,24 @@ if($page == 'admins'
'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')', 'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
'traffic' => $lng['customer']['traffic'], 'traffic' => $lng['customer']['traffic'],
'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')', 'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
'mysqls' => $lng['customer']['mysqls'],
'mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
'ftps' => $lng['customer']['ftps'],
'ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
'tickets' => $lng['customer']['tickets'],
'tickets_used' => $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')',
'subdomains' => $lng['customer']['subdomains'],
'subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
'emails' => $lng['customer']['emails'],
'emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
'email_accounts' => $lng['customer']['accounts'],
'email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
'email_forwarders' => $lng['customer']['forwarders'],
'email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
'email_quota' => $lng['customer']['email_quota'],
'email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
'email_autoresponder' => $lng['customer']['autoresponder'],
'email_autoresponder_used' => $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')',
'deactivated' => $lng['admin']['deactivated'] 'deactivated' => $lng['admin']['deactivated']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
@@ -68,29 +86,6 @@ if($page == 'admins'
$row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']); $row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
$row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']); $row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']); $row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
/**
* percent-values for progressbar
*/
//For Disk usage
if ($row['diskspace'] > 0) {
$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
$disk_doublepercent = round($disk_percent*2, 2);
} else {
$disk_percent = 0;
$disk_doublepercent = 0;
}
//For Traffic usage
if ($row['traffic'] > 0) {
$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
$traffic_doublepercent = round($traffic_percent*2, 2);
} else {
$traffic_percent = 0;
$traffic_doublepercent = 0;
}
/* */
$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets'); $row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets');
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";"); eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";");
@@ -271,7 +266,7 @@ if($page == 'admins'
$number_of_aps_packages = - 1; $number_of_aps_packages = - 1;
} }
$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0; $can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
} }
else else
{ {
@@ -279,21 +274,10 @@ if($page == 'admins'
$can_manage_aps_packages = 0; $can_manage_aps_packages = 0;
} }
$customers_see_all = 0; $customers_see_all = intval($_POST['customers_see_all']);
if(isset($_POST['customers_see_all'])) $domains_see_all = intval($_POST['domains_see_all']);
$customers_see_all = intval($_POST['customers_see_all']); $caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = intval($_POST['change_serversettings']);
$domains_see_all = 0;
if(isset($_POST['domains_see_all']))
$domains_see_all = intval($_POST['domains_see_all']);
$caneditphpsettings = 0;
if(isset($_POST['caneditphpsettings']))
$caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = 0;
if(isset($_POST['change_serversettings']))
$change_serversettings = intval($_POST['change_serversettings']);
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
@@ -309,10 +293,6 @@ if($page == 'admins'
$traffic = - 1; $traffic = - 1;
} }
$tickets_see_all = 0;
if(isset($_POST['tickets_see_all']))
$tickets_see_all = intval($_POST['tickets_see_all']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
$ipaddress = intval_ressource($_POST['ipaddress']); $ipaddress = intval_ressource($_POST['ipaddress']);
@@ -380,43 +360,8 @@ if($page == 'admins'
$change_serversettings = '0'; $change_serversettings = '0';
} }
if ($tickets_see_all != '1') { $result = $db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` (`loginname`, `password`, `name`, `email`, `def_language`, `change_serversettings`, `customers`, `customers_see_all`, `domains`, `domains_see_all`, `caneditphpsettings`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `ip`, `can_manage_aps_packages`, `aps_packages`, `email_autoresponder`)
$tickets_see_all = '0'; VALUES ('" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($email) . "','" . $db->escape($def_language) . "', '" . $db->escape($change_serversettings) . "', '" . $db->escape($customers) . "', '" . $db->escape($customers_see_all) . "', '" . $db->escape($domains) . "', '" . $db->escape($domains_see_all) . "', '" . (int)$caneditphpsettings . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '" . (int)$ipaddress . "', " . (int)$can_manage_aps_packages . ", " . (int)$number_of_aps_packages . ", " . $db->escape($email_autoresponder) . ")");
}
$_theme = $settings['panel']['default_theme'];
$result = $db->query("INSERT INTO
`" . TABLE_PANEL_ADMINS . "`
SET
`loginname` = '" . $db->escape($loginname) . "',
`password` = '" . md5($password) . "',
`name` = '" . $db->escape($name) . "',
`email` = '" . $db->escape($email) . "',
`def_language` = '" . $db->escape($def_language) . "',
`change_serversettings` = '" . $db->escape($change_serversettings) . "',
`customers` = '" . $db->escape($customers) . "',
`customers_see_all` = '" . $db->escape($customers_see_all) . "',
`domains` = '" . $db->escape($domains) . "',
`domains_see_all` = '" . $db->escape($domains_see_all) . "',
`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
`diskspace` = '" . $db->escape($diskspace) . "',
`traffic` = '" . $db->escape($traffic) . "',
`subdomains` = '" . $db->escape($subdomains) . "',
`emails` = '" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders` = '" . $db->escape($email_forwarders) . "',
`email_quota` = '" . $db->escape($email_quota) . "',
`ftps` = '" . $db->escape($ftps) . "',
`tickets` = '" . $db->escape($tickets) . "',
`tickets_see_all` = '" . $db->escape($tickets_see_all) . "',
`mysqls` = '" . $db->escape($mysqls) . "',
`ip` = '" . (int)$ipaddress . "',
`can_manage_aps_packages` = '" . (int)$can_manage_aps_packages . "',
`aps_packages` = '" . (int)$number_of_aps_packages . "',
`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
`theme` = '".$db->escape($_theme)."';
");
$adminid = $db->insert_id(); $adminid = $db->insert_id();
$log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -462,21 +407,13 @@ if($page == 'admins'
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
/*
$change_serversettings = makeyesno('change_serversettings', '1', '0', '0'); $change_serversettings = makeyesno('change_serversettings', '1', '0', '0');
$customers_see_all = makeyesno('customers_see_all', '1', '0', '0'); $customers_see_all = makeyesno('customers_see_all', '1', '0', '0');
$domains_see_all = makeyesno('domains_see_all', '1', '0', '0'); $domains_see_all = makeyesno('domains_see_all', '1', '0', '0');
$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0'); $caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0');
$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0'); $can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0');
*/
$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$admin_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_add.php';
$admin_add_form = htmlform::genHTMLForm($admin_add_data);
$title = $admin_add_data['admin_add']['title'];
$image = $admin_add_data['admin_add']['image'];
eval("echo \"" . getTemplate("admins/admins_add") . "\";"); eval("echo \"" . getTemplate("admins/admins_add") . "\";");
} }
} }
@@ -509,7 +446,6 @@ if($page == 'admins'
$ftps = $result['ftps']; $ftps = $result['ftps'];
$tickets = $result['tickets']; $tickets = $result['tickets'];
$mysqls = $result['mysqls']; $mysqls = $result['mysqls'];
$tickets_see_all = $result['tickets_see_all'];
$customers_see_all = $result['customers_see_all']; $customers_see_all = $result['customers_see_all'];
$domains_see_all = $result['domains_see_all']; $domains_see_all = $result['domains_see_all'];
$caneditphpsettings = $result['caneditphpsettings']; $caneditphpsettings = $result['caneditphpsettings'];
@@ -524,113 +460,130 @@ if($page == 'admins'
{ {
$password = validate($_POST['admin_password'], 'new password'); $password = validate($_POST['admin_password'], 'new password');
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$deactivated = isset($_POST['deactivated']) ? 1 : 0; $deactivated = intval($_POST['deactivated']);
$customers = intval_ressource($_POST['customers']); $customers = intval_ressource($_POST['customers']);
if (isset($_POST['customers_ul'])) {
$customers = -1; if(isset($_POST['customers_ul']))
{
$customers = - 1;
} }
$domains = intval_ressource($_POST['domains']); $domains = intval_ressource($_POST['domains']);
if (isset($_POST['domains_ul'])) {
$domains = -1; if(isset($_POST['domains_ul']))
{
$domains = - 1;
} }
$subdomains = intval_ressource($_POST['subdomains']); $subdomains = intval_ressource($_POST['subdomains']);
if (isset($_POST['subdomains_ul'])) {
$subdomains = -1; if(isset($_POST['subdomains_ul']))
{
$subdomains = - 1;
} }
$emails = intval_ressource($_POST['emails']); $emails = intval_ressource($_POST['emails']);
if (isset($_POST['emails_ul'])) {
$emails = -1; if(isset($_POST['emails_ul']))
{
$emails = - 1;
} }
$email_accounts = intval_ressource($_POST['email_accounts']); $email_accounts = intval_ressource($_POST['email_accounts']);
if (isset($_POST['email_accounts_ul'])) {
$email_accounts = -1; if(isset($_POST['email_accounts_ul']))
{
$email_accounts = - 1;
} }
$email_forwarders = intval_ressource($_POST['email_forwarders']); $email_forwarders = intval_ressource($_POST['email_forwarders']);
if (isset($_POST['email_forwarders_ul'])) {
$email_forwarders = -1; if(isset($_POST['email_forwarders_ul']))
{
$email_forwarders = - 1;
} }
if ($settings['system']['mail_quota_enabled'] == '1') { if($settings['system']['mail_quota_enabled'] == '1')
{
$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', '')); $email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
if (isset($_POST['email_quota_ul'])) {
$email_quota = -1; if(isset($_POST['email_quota_ul']))
{
$email_quota = - 1;
} }
} else { }
$email_quota = -1; else
{
$email_quota = - 1;
} }
if ($settings['autoresponder']['autoresponder_active'] == '1') { if($settings['autoresponder']['autoresponder_active'] == '1')
{
$email_autoresponder = intval_ressource($_POST['email_autoresponder']); $email_autoresponder = intval_ressource($_POST['email_autoresponder']);
if (isset($_POST['email_autoresponder_ul'])) {
$email_autoresponder = -1; if(isset($_POST['email_autoresponder_ul']))
{
$email_autoresponder = - 1;
} }
} else { }
else
{
$email_autoresponder = 0; $email_autoresponder = 0;
} }
$ftps = intval_ressource($_POST['ftps']); $ftps = intval_ressource($_POST['ftps']);
if (isset($_POST['ftps_ul'])) {
$ftps = -1; if(isset($_POST['ftps_ul']))
{
$ftps = - 1;
} }
if ($settings['ticket']['enabled'] == 1) { if($settings['ticket']['enabled'] == 1)
{
$tickets = intval_ressource($_POST['tickets']); $tickets = intval_ressource($_POST['tickets']);
if (isset($_POST['tickets_ul'])) {
$tickets = -1; if(isset($_POST['tickets_ul']))
{
$tickets = - 1;
} }
} else { }
else
{
$tickets = 0; $tickets = 0;
} }
$mysqls = intval_ressource($_POST['mysqls']); $mysqls = intval_ressource($_POST['mysqls']);
if (isset($_POST['mysqls_ul'])) {
if(isset($_POST['mysqls_ul']))
{
$mysqls = - 1; $mysqls = - 1;
} }
if ($settings['aps']['aps_active'] == '1') { $number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
if (isset($_POST['number_of_aps_packages_ul'])) { if(isset($_POST['number_of_aps_packages_ul']))
$number_of_aps_packages = -1; {
} $number_of_aps_packages = - 1;
$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
} else {
$number_of_aps_packages = 0;
} }
$customers_see_all = 0; $customers_see_all = intval($_POST['customers_see_all']);
if(isset($_POST['customers_see_all'])) $domains_see_all = intval($_POST['domains_see_all']);
$customers_see_all = intval($_POST['customers_see_all']); $caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = intval($_POST['change_serversettings']);
$domains_see_all = 0; $can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
if(isset($_POST['domains_see_all']))
$domains_see_all = intval($_POST['domains_see_all']);
$caneditphpsettings = 0;
if(isset($_POST['caneditphpsettings']))
$caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = 0;
if(isset($_POST['change_serversettings']))
$change_serversettings = isset($_POST['change_serversettings']) ? 1 : 0;
$tickets_see_all = 0;
if (isset($_POST['tickets_see_all']))
$tickets_see_all = intval($_POST['tickets_see_all']);
$diskspace = intval($_POST['diskspace']); $diskspace = intval($_POST['diskspace']);
if (isset($_POST['diskspace_ul'])) {
$diskspace = -1; if(isset($_POST['diskspace_ul']))
{
$diskspace = - 1;
} }
$traffic = doubleval_ressource($_POST['traffic']); $traffic = doubleval_ressource($_POST['traffic']);
if (isset($_POST['traffic_ul'])) {
$traffic = -1; if(isset($_POST['traffic_ul']))
{
$traffic = - 1;
} }
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
@@ -687,88 +640,7 @@ if($page == 'admins'
$change_serversettings = '0'; $change_serversettings = '0';
} }
if ($tickets_see_all != '1') { $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `name`='" . $db->escape($name) . "', `email`='" . $db->escape($email) . "', `def_language`='" . $db->escape($def_language) . "', `change_serversettings` = '" . $db->escape($change_serversettings) . "', `customers` = '" . $db->escape($customers) . "', `customers_see_all` = '" . $db->escape($customers_see_all) . "', `domains` = '" . $db->escape($domains) . "', `domains_see_all` = '" . $db->escape($domains_see_all) . "', `caneditphpsettings` = '" . (int)$caneditphpsettings . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `email_quota`='" . $db->escape($email_quota) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `ip`='" . (int)$ipaddress . "', `deactivated`='" . $db->escape($deactivated) . "', `can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ", `aps_packages`=" . (int)$number_of_aps_packages . " WHERE `adminid`='" . $db->escape($id) . "'");
$tickets_see_all = '0';
}
// check if a resource was set to something lower
// than actually used by the admin/reseller
$res_warning = "";
if ($customers != $result['customers'] && $customers < $result['customers_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'customers');
}
if ($domains != $result['domains'] && $domains < $result['domains_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'domains');
}
if ($diskspace != $result['diskspace'] && ($diskspace / 1024) != -1 && $diskspace < $result['diskspace_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'diskspace');
}
if ($traffic != $result['traffic'] && ($traffic / 1024 / 1024) != -1 && $traffic < $result['traffic_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'traffic');
}
if ($emails != $result['emails'] && $emails < $result['emails_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'emails');
}
if ($email_accounts != $result['email_accounts'] && $email_accounts < $result['email_accounts_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email accounts');
}
if ($email_forwarders != $result['email_forwarders'] && $email_forwarders < $result['email_forwarders_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email forwarders');
}
if ($email_quota != $result['email_quota'] && $email_quota < $result['email_quota_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email quota');
}
if ($email_autoresponder != $result['email_autoresponder'] && $email_autoresponder < $result['email_autoresponder_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email autoresponder');
}
if ($ftps != $result['ftps'] && $ftps < $result['ftps_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'ftps');
}
if ($tickets != $result['tickets'] && $tickets < $result['tickets_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'tickets');
}
if ($mysqls != $result['mysqls'] && $mysqls < $result['mysqls_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'mysqls');
}
if ($number_of_aps_packages != $result['aps_packages'] && $number_of_aps_packages < $result['aps_packages_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'aps packages');
}
if ($res_warning != "") {
$link = '';
$error = $res_warning;
eval("echo \"" . getTemplate('misc/error', '1') . "\";");
exit;
}
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET
`name`='" . $db->escape($name) . "',
`email`='" . $db->escape($email) . "',
`def_language`='" . $db->escape($def_language) . "',
`change_serversettings` = '" . $db->escape($change_serversettings) . "',
`customers` = '" . $db->escape($customers) . "',
`customers_see_all` = '" . $db->escape($customers_see_all) . "',
`domains` = '" . $db->escape($domains) . "',
`domains_see_all` = '" . $db->escape($domains_see_all) . "',
`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
`password` = '" . $password . "',
`diskspace`='" . $db->escape($diskspace) . "',
`traffic`='" . $db->escape($traffic) . "',
`subdomains`='" . $db->escape($subdomains) . "',
`emails`='" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders`='" . $db->escape($email_forwarders) . "',
`email_quota`='" . $db->escape($email_quota) . "',
`email_autoresponder`='" . $db->escape($email_autoresponder) . "',
`ftps`='" . $db->escape($ftps) . "',
`tickets`='" . $db->escape($tickets) . "',
`tickets_see_all`='".$db->escape($tickets_see_all) . "',
`mysqls`='" . $db->escape($mysqls) . "',
`ip`='" . (int)$ipaddress . "',
`deactivated`='" . $db->escape($deactivated) . "',
`can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ",
`aps_packages`=" . (int)$number_of_aps_packages . "
WHERE `adminid`='" . $db->escape($id) . "'");
$log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'");
$redirect_props = Array( $redirect_props = Array(
'page' => $page, 'page' => $page,
@@ -906,22 +778,14 @@ if($page == 'admins'
} }
} }
/*
$change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']); $change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']);
$customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']); $customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']);
$domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']); $domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']);
$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']); $caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']);
$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']); $deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']); $can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']);
*/
$result = htmlentities_array($result); $result = htmlentities_array($result);
$admin_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_edit.php';
$admin_edit_form = htmlform::genHTMLForm($admin_edit_data);
$title = $admin_edit_data['admin_edit']['title'];
$image = $admin_edit_data['admin_edit']['image'];
eval("echo \"" . getTemplate("admins/admins_edit") . "\";"); eval("echo \"" . getTemplate("admins/admins_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
// Required code // Required code

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -97,8 +97,7 @@ if($userinfo['change_serversettings'] == '1')
'<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'], '<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'],
'<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '', '<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '',
'<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? makeCorrectDir($settings['system']['mod_fcgid_tmpdir']) : '/tmp/', '<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? makeCorrectDir($settings['system']['mod_fcgid_tmpdir']) : '/tmp/',
'<BASE_PATH>' => makeCorrectDir(dirname(__FILE__)), '<BASE_PATH>' => makeCorrectDir(dirname(__FILE__))
'<BIND_CONFIG_PATH>' => makeCorrectDir($settings['system']['bindconf_directory'])
); );
$files = ''; $files = '';
$configpage = ''; $configpage = '';

View File

@@ -12,21 +12,28 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
require_once('./lib/init.php');
if (isset($_POST['id'])) { require_once("./lib/init.php");
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'cronjobs' || $page == 'overview') { if($page == 'cronjobs'
if ($action == '') { || $page == 'overview')
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs'); {
if($action == '')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_cronjobs");
$fields = array( $fields = array(
'c.lastrun' => $lng['cron']['lastrun'], 'c.lastrun' => $lng['cron']['lastrun'],
@@ -49,41 +56,61 @@ if ($page == 'cronjobs' || $page == 'overview') {
$i = 0; $i = 0;
$count = 0; $count = 0;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($paging->checkDisplay($i)) { {
if($paging->checkDisplay($i))
{
$row = htmlentities_array($row); $row = htmlentities_array($row);
$row['lastrun'] = date('d.m.Y H:i', $row['lastrun']); $row['lastrun'] = date('d.m.Y H:i', $row['lastrun']);
$row['isactive'] = ((int)$row['isactive'] == 1) ? $lng['panel']['yes'] : $lng['panel']['no'];
if((int)$row['isactive'] == 1)
{
$row['isactive'] = $lng['panel']['yes'];
}
else
{
$row['isactive'] = $lng['panel']['no'];
}
$description = $lng['crondesc'][$row['desc_lng_key']]; $description = $lng['crondesc'][$row['desc_lng_key']];
eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjob') . "\";"); eval("\$crons.=\"" . getTemplate("cronjobs/cronjobs_cronjob") . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate('cronjobs/cronjobs') . "\";"); eval("echo \"" . getTemplate("cronjobs/cronjobs") . "\";");
} elseif ($action == 'new') { }
elseif($action == 'new')
{
/* /*
* @TODO later * @TODO later
*/ */
} elseif ($action == 'edit' && $id != 0) { }
elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'");
if ($result['cronfile'] != '') {
if (isset($_POST['send']) && $_POST['send'] == 'send') { if ($result['cronfile'] != '')
$isactive = isset($_POST['isactive']) ? 1 : 0; {
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$isactive = intval($_POST['isactive']);
$interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty'); $interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty');
$interval_interval = validate($_POST['interval_interval'], 'interval_interval'); $interval_interval = validate($_POST['interval_interval'], 'interval_interval');
if ($isactive != 1) { if($isactive != 1)
{
$isactive = 0; $isactive = 0;
} }
$interval = $interval_value . ' ' . strtoupper($interval_interval); $interval = $interval_value.' '.strtoupper($interval_interval);
$db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "` $db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "`
SET `isactive` = '".(int)$isactive."', SET `isactive` = '".(int)$isactive."',
@@ -91,39 +118,40 @@ if ($page == 'cronjobs' || $page == 'overview') {
WHERE `id` = '" . (int)$id . "'"); WHERE `id` = '" . (int)$id . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
//$isactive = makeyesno('isactive', '1', '0', $result['isactive']); else
{
$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
// interval // interval
$interval_nfo = explode(' ', $result['interval']); $interval_nfo = explode(' ', $result['interval']);
$interval_value = $interval_nfo[0]; $interval_value = $interval_nfo[0];
$interval_interval = ''; $interval_interval = '';
$interval_interval .= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
// end of interval // end of interval
$change_cronfile = false; $change_cronfile = false;
if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor') { if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor')
{
$change_cronfile = true; $change_cronfile = true;
} }
$cronjobs_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/cronjobs/formfield.cronjobs_edit.php'; eval("echo \"" . getTemplate("cronjobs/cronjob_edit") . "\";");
$cronjobs_edit_form = htmlform::genHTMLForm($cronjobs_edit_data);
$title = $cronjobs_edit_data['cronjobs_edit']['title'];
$image = $cronjobs_edit_data['cronjobs_edit']['image'];
eval("echo \"" . getTemplate('cronjobs/cronjob_edit') . "\";");
} }
} }
} }
elseif ($action == 'delete' && $id != 0) { elseif($action == 'delete'
&& $id != 0)
{
/* /*
* @TODO later * @TODO later
*/ */
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -40,30 +40,52 @@ if($page == 'customers'
{ {
if($action == '') if($action == '')
{ {
// clear request data
unset($_SESSION['requestData']);
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers"); $log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers");
$fields = array( $fields = array(
'c.loginname' => $lng['login']['username'], 'c.loginname' => $lng['login']['username'],
'a.loginname' => $lng['admin']['admin'], 'a.loginname' => $lng['admin']['admin'],
'c.name' => $lng['customer']['name'], 'c.name' => $lng['customer']['name'],
'c.email' => $lng['customer']['email'],
'c.firstname' => $lng['customer']['firstname'], 'c.firstname' => $lng['customer']['firstname'],
'c.company' => $lng['customer']['company'], 'c.company' => $lng['customer']['company'],
'c.diskspace' => $lng['customer']['diskspace'], 'c.diskspace' => $lng['customer']['diskspace'],
'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')', 'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
'c.traffic' => $lng['customer']['traffic'], 'c.traffic' => $lng['customer']['traffic'],
'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')' 'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
'c.mysqls' => $lng['customer']['mysqls'],
'c.mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
'c.ftps' => $lng['customer']['ftps'],
'c.ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
'c.subdomains' => $lng['customer']['subdomains'],
'c.subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
'c.emails' => $lng['customer']['emails'],
'c.emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
'c.email_accounts' => $lng['customer']['accounts'],
'c.email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
'c.email_forwarders' => $lng['customer']['forwarders'],
'c.email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
'c.email_quota' => $lng['customer']['email_quota'],
'c.email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
'c.deactivated' => $lng['admin']['deactivated'],
'c.lastlogin_succ' => $lng['admin']['lastlogin_succ'],
'c.phpenabled' => $lng['admin']['phpenabled'],
'c.perlenabled' => $lng['admin']['perlenabled']
); );
if ($settings['system']['backup_enabled'] == '1') { if($settings['ticket']['enabled'] == 1)
$field['c.backup_allowed'] = $lng['backup_allowed']; {
$fields['c.tickets'] = $lng['customer']['tickets'];
$fields['c.tickets_used'] = $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')';
}
if($settings['autoresponder']['autoresponder_active'] == 1)
{
$fields['c.email_autoresponder'] = $lng['customer']['autoresponder'];
$fields['c.email_autoresponder_used'] = $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')';
} }
$paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$customers = ''; $customers = '';
$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy($settings['panel']['natsorting']) . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng, true); $sortcode = $paging->getHtmlSortCode($lng, true);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -84,26 +106,6 @@ if($page == 'customers'
$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']); $row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
$last_login = ((int)$row['lastlogin_succ'] == 0) ? $lng['panel']['neverloggedin'] : date('d.m.Y', $row['lastlogin_succ']); $last_login = ((int)$row['lastlogin_succ'] == 0) ? $lng['panel']['neverloggedin'] : date('d.m.Y', $row['lastlogin_succ']);
/**
* percent-values for progressbar
*/
//For Disk usage
if ($row['diskspace'] > 0) {
$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
$disk_doublepercent = round($disk_percent*2, 2);
} else {
$disk_percent = 0;
$disk_doublepercent = 0;
}
if ($row['traffic'] > 0) {
$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
$traffic_doublepercent = round($traffic_percent*2, 2);
} else {
$traffic_percent = 0;
$traffic_doublepercent = 0;
}
$column_style = ''; $column_style = '';
$unlock_link = ''; $unlock_link = '';
if($row['loginfail_count'] >= $settings['login']['maxloginattempts'] if($row['loginfail_count'] >= $settings['login']['maxloginattempts']
@@ -133,14 +135,11 @@ if($page == 'customers'
if($destination_user != '') if($destination_user != '')
{ {
if ($result['deactivated'] == '1') {
standard_error("usercurrentlydeactivated", $destination_user);
}
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'");
$s = md5(uniqid(microtime(), 1)); $s = md5(uniqid(microtime(), 1));
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')"); $db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
$log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'");
redirectTo('customer_index.php', Array('s' => $s), true); redirectTo('customer_index.php', Array('s' => $s));
} }
else else
{ {
@@ -184,6 +183,7 @@ if($page == 'customers'
{ {
$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`"); $databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], ''); $db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
unset($db_root->password);
$last_dbserver = 0; $last_dbserver = 0;
while($row_database = $db->fetch_array($databases)) while($row_database = $db->fetch_array($databases))
@@ -193,20 +193,16 @@ if($page == 'customers'
$db_root->query('FLUSH PRIVILEGES;'); $db_root->query('FLUSH PRIVILEGES;');
$db_root->close(); $db_root->close();
$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], ''); $db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
unset($db_root->password);
$last_dbserver = $row_database['dbserver']; $last_dbserver = $row_database['dbserver'];
} }
if(mysql_get_server_info() < '5.0.2') { foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
}
$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($row_database['databasename']) . "'");
while($host = $db_root->fetch_array($host_res))
{ {
// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+) $mysql_access_host = trim($mysql_access_host);
$db_root->query('DROP USER \'' . $db_root->escape($row_database['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true); $db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($row_database['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
} }
$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`'); $db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`');
@@ -282,7 +278,7 @@ if($page == 'customers'
if($result['email_autoresponder'] != '-1') if($result['email_autoresponder'] != '-1')
{ {
$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` - 0" . (int)$result['email_autoresponder']; $admin_update_query.= ", `email_autoresponder` = `email_autoresponder` - 0" . (int)$result['email_autoresponder'];
} }
if($result['subdomains'] != '-1') if($result['subdomains'] != '-1')
@@ -302,7 +298,7 @@ if($page == 'customers'
if($result['aps_packages'] != '-1') if($result['aps_packages'] != '-1')
{ {
$admin_update_query.= ", `aps_packages_used` = `aps_packages_used` - 0" . (int)$result['aps_packages']; $admin_update_query.= ", `aps_packages` = `aps_packages` - 0" . (int)$result['aps_packages'];
} }
if(($result['diskspace'] / 1024) != '-1') if(($result['diskspace'] / 1024) != '-1')
@@ -314,19 +310,14 @@ if($page == 'customers'
$db->query($admin_update_query); $db->query($admin_update_query);
$log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
if (isset($_POST['delete_userfiles']) if(isset($_POST['delete_userfiles'])
&& (int)$_POST['delete_userfiles'] == 1 && (int)$_POST['delete_userfiles'] == 1)
) { {
inserttask('6', $result['loginname']); inserttask('6', $result['loginname']);
} }
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
/* /*
* move old tickets to archive * move old tickets to archive
*/ */
@@ -374,7 +365,6 @@ if($page == 'customers'
$customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di'); $customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di');
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
$gender = intval_ressource($_POST['gender']);
if(isset($_POST['diskspace_ul'])) if(isset($_POST['diskspace_ul']))
{ {
@@ -444,17 +434,9 @@ if($page == 'customers'
$email_autoresponder = 0; $email_autoresponder = 0;
} }
$email_imap = 0; $email_imap = intval_ressource($_POST['email_imap']);
if(isset($_POST['email_imap'])) $email_pop3 = intval_ressource($_POST['email_pop3']);
$email_imap = intval_ressource($_POST['email_imap']); $ftps = intval_ressource($_POST['ftps']);
$email_pop3 = 0;
if(isset($_POST['email_pop3']))
$email_pop3 = intval_ressource($_POST['email_pop3']);
$ftps = 0;
if(isset($_POST['ftps']))
$ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['ftps_ul'])) if(isset($_POST['ftps_ul']))
{ {
@@ -490,9 +472,7 @@ if($page == 'customers'
$number_of_aps_packages = 0; $number_of_aps_packages = 0;
} }
$createstdsubdomain = 0; $createstdsubdomain = intval($_POST['createstdsubdomain']);
if(isset($_POST['createstdsubdomain']))
$createstdsubdomain = intval($_POST['createstdsubdomain']);
$password = validate($_POST['new_customer_password'], 'password'); $password = validate($_POST['new_customer_password'], 'password');
// only check if not empty, // only check if not empty,
// cause empty == generate password automatically // cause empty == generate password automatically
@@ -500,37 +480,10 @@ if($page == 'customers'
{ {
$password = validatePassword($password); $password = validatePassword($password);
} }
$sendpassword = intval($_POST['sendpassword']);
$backup_allowed = 0; $phpenabled = intval($_POST['phpenabled']);
if(isset($_POST['backup_allowed'])) $perlenabled = intval($_POST['perlenabled']);
$backup_allowed = intval($_POST['backup_allowed']); $store_defaultindex = intval($_POST['store_defaultindex']);
if ($backup_allowed != 0)
{
$backup_allowed = 1;
}
// gender out of range? [0,2]
if ($gender < 0 || $gender > 2) {
$gender = 0;
}
$sendpassword = 0;
if(isset($_POST['sendpassword']))
$sendpassword = intval($_POST['sendpassword']);
$phpenabled = 0;
if(isset($_POST['phpenabled']))
$phpenabled = intval($_POST['phpenabled']);
$perlenabled = 0;
if(isset($_POST['perlenabled']))
$perlenabled = intval($_POST['perlenabled']);
$store_defaultindex = 0;
if(isset($_POST['store_defaultindex']))
$store_defaultindex = intval($_POST['store_defaultindex']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
@@ -595,11 +548,6 @@ if($page == 'customers'
{ {
standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']); standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
} }
//Additional filtering for Bug #962
if(function_exists('posix_getpwnam') && !in_array("posix_getpwnam",explode(",",ini_get('disable_functions'))) && posix_getpwnam($loginname)) {
standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
}
} }
else else
{ {
@@ -650,47 +598,7 @@ if($page == 'customers'
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} }
$_theme = $settings['panel']['default_theme']; $result = $db->query("INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` (`adminid`, `loginname`, `password`, `name`, `firstname`, `company`, `street`, `zipcode`, `city`, `phone`, `fax`, `email`, `customernumber`, `def_language`, `documentroot`, `guid`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `standardsubdomain`, `phpenabled`, `imap`, `pop3`, `aps_packages`, `perlenabled`, `email_autoresponder`) VALUES ('" . (int)$userinfo['adminid'] . "', '" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($firstname) . "', '" . $db->escape($company) . "', '" . $db->escape($street) . "', '" . $db->escape($zipcode) . "', '" . $db->escape($city) . "', '" . $db->escape($phone) . "', '" . $db->escape($fax) . "', '" . $db->escape($email) . "', '" . $db->escape($customernumber) . "','" . $db->escape($def_language) . "', '" . $db->escape($documentroot) . "', '" . $db->escape($guid) . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '0', '" . $db->escape($phpenabled) . "', '" . $db->escape($email_imap) . "', '" . $db->escape($email_pop3) . "', '" . (int)$number_of_aps_packages . "', '" . $db->escape($perlenabled) . "', '" . $db->escape($email_autoresponder) . "')");
$result = $db->query(
"INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` SET
`adminid` = '" . (int)$userinfo['adminid'] . "',
`loginname` = '" . $db->escape($loginname) . "',
`password` = '" . md5($password) . "',
`name` = '" . $db->escape($name) . "',
`firstname` = '" . $db->escape($firstname) . "',
`gender` = '" . (int)$gender . "',
`company` = '" . $db->escape($company) . "',
`street` = '" . $db->escape($street) . "',
`zipcode` = '" . $db->escape($zipcode) . "',
`city` = '" . $db->escape($city) . "',
`phone` = '" . $db->escape($phone) . "',
`fax` = '" . $db->escape($fax) . "',
`email` = '" . $db->escape($email) . "',
`customernumber` = '" . $db->escape($customernumber) . "',
`def_language` = '" . $db->escape($def_language) . "',
`documentroot` = '" . $db->escape($documentroot) . "',
`guid` = '" . $db->escape($guid) . "',
`diskspace` = '" . $db->escape($diskspace) . "',
`traffic` = '" . $db->escape($traffic) . "',
`subdomains` = '" . $db->escape($subdomains) . "',
`emails` = '" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders` = '" . $db->escape($email_forwarders) . "',
`email_quota` = '" . $db->escape($email_quota) . "',
`ftps` = '" . $db->escape($ftps) . "',
`tickets` = '" . $db->escape($tickets) . "',
`mysqls` = '" . $db->escape($mysqls) . "',
`standardsubdomain` = '0',
`phpenabled` = '" . $db->escape($phpenabled) . "',
`imap` = '" . $db->escape($email_imap) . "',
`pop3` = '" . $db->escape($email_pop3) . "',
`aps_packages` = '" . (int)$number_of_aps_packages . "',
`perlenabled` = '" . $db->escape($perlenabled) . "',
`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
`backup_allowed` = '" . $db->escape($backup_allowed) . "',
`theme` = '" . $db->escape($_theme) . "'"
);
$customerid = $db->insert_id(); $customerid = $db->insert_id();
$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1"; $admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1";
@@ -763,10 +671,8 @@ if($page == 'customers'
$log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'");
inserttask('2', $loginname, $guid, $guid, $store_defaultindex); inserttask('2', $loginname, $guid, $guid, $store_defaultindex);
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
// Add htpasswd for the webalizer stats // Add htpasswd for the webalizer stats
if(CRYPT_STD_DES == 1) if(CRYPT_STD_DES == 1)
{ {
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2); $saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
@@ -789,8 +695,7 @@ if($page == 'customers'
} }
inserttask('1'); inserttask('1');
$cryptPassword = makeCryptPassword($password); $result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')"); $result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')"); $result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'");
@@ -818,6 +723,7 @@ if($page == 'customers'
"`isemaildomain` = '0', " . "`isemaildomain` = '0', " .
"`caneditdomain` = '0', " . "`caneditdomain` = '0', " .
"`openbasedir` = '1', " . "`openbasedir` = '1', " .
"`safemode` = '1', " .
"`speciallogfile` = '0', " . "`speciallogfile` = '0', " .
"`specialsettings` = '', " . "`specialsettings` = '', " .
"`add_date` = '".date('Y-m-d')."'"); "`add_date` = '".date('Y-m-d')."'");
@@ -893,17 +799,13 @@ if($page == 'customers'
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', '1');
$gender_options = makeoption($lng['gender']['undef'], 0, true, true, true); $email_imap = makeyesno('email_imap', '1', '0', '1');
$gender_options .= makeoption($lng['gender']['male'], 1, null, true, true); $email_pop3 = makeyesno('email_pop3', '1', '0', '1');
$gender_options .= makeoption($lng['gender']['female'], 2, null, true, true); $sendpassword = makeyesno('sendpassword', '1', '0', '1');
$phpenabled = makeyesno('phpenabled', '1', '0', '1');
$customer_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_add.php'; $perlenabled = makeyesno('perlenabled', '1', '0', '0');
$customer_add_form = htmlform::genHTMLForm($customer_add_data); $store_defaultindex = makeyesno('store_defaultindex', '1', '0', '1');
$title = $customer_add_data['customer_add']['title'];
$image = $customer_add_data['customer_add']['image'];
eval("echo \"" . getTemplate("customers/customers_add") . "\";"); eval("echo \"" . getTemplate("customers/customers_add") . "\";");
} }
} }
@@ -931,7 +833,6 @@ if($page == 'customers'
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$password = validate($_POST['new_customer_password'], 'new password'); $password = validate($_POST['new_customer_password'], 'new password');
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
$gender = intval_ressource($_POST['gender']);
if(isset($_POST['diskspace_ul'])) if(isset($_POST['diskspace_ul']))
{ {
@@ -1001,17 +902,9 @@ if($page == 'customers'
$email_autoresponder = 0; $email_autoresponder = 0;
} }
$email_imap = 0; $email_imap = intval_ressource($_POST['email_imap']);
if(isset($_POST['email_imap'])) $email_pop3 = intval_ressource($_POST['email_pop3']);
$email_imap = intval_ressource($_POST['email_imap']); $ftps = intval_ressource($_POST['ftps']);
$email_pop3 = 0;
if(isset($_POST['email_pop3']))
$email_pop3 = intval_ressource($_POST['email_pop3']);
$ftps = 0;
if(isset($_POST['ftps']))
$ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['ftps_ul'])) if(isset($_POST['ftps_ul']))
{ {
@@ -1026,22 +919,7 @@ if($page == 'customers'
$tickets = - 1; $tickets = - 1;
} }
$backup_allowed = 0; $mysqls = intval_ressource($_POST['mysqls']);
if (isset($_POST['backup_allowed']))
$backup_allowed = intval($_POST['backup_allowed']);
if($backup_allowed != '0'){
$backup_allowed = 1;
}
// gender out of range? [0,2]
if ($gender < 0 || $gender > 2) {
$gender = 0;
}
$mysqls = 0;
if(isset($_POST['mysqls']))
$mysqls = intval_ressource($_POST['mysqls']);
if(isset($_POST['mysqls_ul'])) if(isset($_POST['mysqls_ul']))
{ {
@@ -1062,21 +940,10 @@ if($page == 'customers'
$number_of_aps_packages = 0; $number_of_aps_packages = 0;
} }
$createstdsubdomain = 0; $createstdsubdomain = intval($_POST['createstdsubdomain']);
if(isset($_POST['createstdsubdomain'])) $deactivated = intval($_POST['deactivated']);
$createstdsubdomain = intval($_POST['createstdsubdomain']); $phpenabled = intval($_POST['phpenabled']);
$perlenabled = intval($_POST['perlenabled']);
$deactivated = 0;
if(isset($_POST['deactivated']))
$deactivated = intval($_POST['deactivated']);
$phpenabled = 0;
if(isset($_POST['phpenabled']))
$phpenabled = intval($_POST['phpenabled']);
$perlenabled = 0;
if(isset($_POST['perlenabled']))
$perlenabled = intval($_POST['perlenabled']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
@@ -1157,7 +1024,7 @@ if($page == 'customers'
$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname']; $_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname'];
} }
$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `speciallogfile`, `specialsettings`, `add_date`) " . "VALUES ('" . $db->escape($_stdsubdomain) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '0', '', '".date('Y-m-d')."')"); $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `safemode`, `speciallogfile`, `specialsettings`, `add_date`) " . "VALUES ('" . $db->escape($_stdsubdomain) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '1', '0', '', '".date('Y-m-d')."')");
$domainid = $db->insert_id(); $domainid = $db->insert_id();
$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\''); $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'");
@@ -1196,48 +1063,9 @@ if($page == 'customers'
if($deactivated != $result['deactivated']) if($deactivated != $result['deactivated'])
{ {
$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : (int)$result['pop3']) . "', `imap`='" . (($deactivated) ? '0' : (int)$result['imap']) . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : '1') . "', `imap`='" . (($deactivated) ? '0' : '1') . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'");
/* Retrieve customer's databases */
$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
$last_dbserver = 0;
/* For each of them */
while($row_database = $db->fetch_array($databases))
{
if($last_dbserver != $row_database['dbserver'])
{
$db_root->query('FLUSH PRIVILEGES;');
$db_root->close();
$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
$last_dbserver = $row_database['dbserver'];
}
foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$mysql_access_host = trim($mysql_access_host);
/* Prevent access, if deactivated */
if($deactivated)
{
// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
}
else /* Otherwise grant access */
{
$db_root->query('GRANT ALL PRIVILEGES ON `' . $db_root->escape($row_database['databasename']) .'`.* TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
}
}
}
/* At last flush the new privileges */
$db_root->query('FLUSH PRIVILEGES;');
$db_root->close();
$log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
} }
@@ -1256,13 +1084,9 @@ if($page == 'customers'
$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'");
} }
// $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `gender`='" . $db->escape($gender) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `backup_allowed`='" . $db->escape($backup_allowed) . "' WHERE `customerid`='" . (int)$id . "'");
$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` "; $admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` ";
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
if($mysqls != '-1' if($mysqls != '-1'
|| $result['mysqls'] != '-1') || $result['mysqls'] != '-1')
{ {
@@ -1546,18 +1370,14 @@ if($page == 'customers'
$result['aps_packages'] = ''; $result['aps_packages'] = '';
} }
$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', (($result['standardsubdomain'] != '0') ? '1' : '0'));
$phpenabled = makeyesno('phpenabled', '1', '0', $result['phpenabled']);
$perlenabled = makeyesno('perlenabled', '1', '0', $result['perlenabled']);
$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
$email_imap = makeyesno('email_imap', '1', '0', $result['imap']);
$email_pop3 = makeyesno('email_pop3', '1', '0', $result['pop3']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$gender_options = makeoption($lng['gender']['undef'], 0, ($result['gender'] == '0' ? true : false), true, true);
$gender_options .= makeoption($lng['gender']['male'], 1, ($result['gender'] == '1' ? true : false), true, true);
$gender_options .= makeoption($lng['gender']['female'], 2, ($result['gender'] == '2' ? true : false), true, true);
$customer_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_edit.php';
$customer_edit_form = htmlform::genHTMLForm($customer_edit_data);
$title = $customer_edit_data['customer_edit']['title'];
$image = $customer_edit_data['customer_edit']['image'];
eval("echo \"" . getTemplate("customers/customers_edit") . "\";"); eval("echo \"" . getTemplate("customers/customers_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -144,8 +144,8 @@ if($page == 'domains'
$alias_check = $db->query_first('SELECT COUNT(`id`) AS `count` FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$id . '\''); $alias_check = $db->query_first('SELECT COUNT(`id`) AS `count` FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$id . '\'');
if($result['domain'] != '' if($result['domain'] != ''
&& $alias_check['count'] == 0 && $alias_check['count'] == 0)
) { {
if(isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
@@ -194,15 +194,9 @@ if($page == 'domains'
$log->logAction(ADM_ACTION, LOG_INFO, "deleted domain/subdomains (#" . $result['id'] . ")"); $log->logAction(ADM_ACTION, LOG_INFO, "deleted domain/subdomains (#" . $result['id'] . ")");
updateCounters(); updateCounters();
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
elseif ($alias_check['count'] > 0) {
standard_error('domains_cantdeletedomainwithaliases');
}
else else
{ {
$showcheck = false; $showcheck = false;
@@ -230,23 +224,10 @@ if($page == 'domains'
$domain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['domain'], 'domain'))); $domain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['domain'], 'domain')));
$subcanemaildomain = intval($_POST['subcanemaildomain']); $subcanemaildomain = intval($_POST['subcanemaildomain']);
$isemaildomain = 0;
if(isset($_POST['isemaildomain']))
$isemaildomain = intval($_POST['isemaildomain']); $isemaildomain = intval($_POST['isemaildomain']);
$email_only = intval($_POST['email_only']);
$email_only = 0; $wwwserveralias = intval($_POST['wwwserveralias']);
if(isset($_POST['email_only'])) $speciallogfile = intval($_POST['speciallogfile']);
$email_only = intval($_POST['email_only']);
$wwwserveralias = 0;
if(isset($_POST['wwwserveralias']))
$wwwserveralias = intval($_POST['wwwserveralias']);
$speciallogfile = 0;
if(isset($_POST['speciallogfile']))
$speciallogfile = intval($_POST['speciallogfile']);
$aliasdomain = intval($_POST['alias']); $aliasdomain = intval($_POST['alias']);
$issubof = intval($_POST['issubof']); $issubof = intval($_POST['issubof']);
$customerid = intval($_POST['customerid']); $customerid = intval($_POST['customerid']);
@@ -276,21 +257,13 @@ if($page == 'domains'
} }
$documentroot = $customer['documentroot']; $documentroot = $customer['documentroot'];
$registration_date = trim($_POST['registration_date']); $registration_date = validate($_POST['registration_date'], 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
$registration_date = validate($registration_date, 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
if($userinfo['change_serversettings'] == '1') if($userinfo['change_serversettings'] == '1')
{ {
$caneditdomain = isset($_POST['caneditdomain']) ? intval($_POST['caneditdomain']) : 0; $isbinddomain = intval($_POST['isbinddomain']);
$caneditdomain = intval($_POST['caneditdomain']);
$isbinddomain = '0'; $zonefile = validate($_POST['zonefile'], 'zonefile');
$zonefile = '';
if ($settings['system']['bind_enable'] == '1') {
if (isset($_POST['isbinddomain'])) {
$isbinddomain = intval($_POST['isbinddomain']);
}
$zonefile = validate($_POST['zonefile'], 'zonefile');
}
if(isset($_POST['dkim'])) if(isset($_POST['dkim']))
{ {
@@ -304,13 +277,11 @@ if($page == 'domains'
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/'); $specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
validate($_POST['documentroot'], 'documentroot'); validate($_POST['documentroot'], 'documentroot');
// If path is empty and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
// set default path to subdomain or domain name
if(isset($_POST['documentroot']) if(isset($_POST['documentroot'])
&& ($_POST['documentroot'] != '')) && $_POST['documentroot'] != '')
{ {
if(substr($_POST['documentroot'], 0, 1) != '/' if(substr($_POST['documentroot'], 0, 1) != '/'
&& !preg_match('/^https?\:\/\//', $_POST['documentroot'])) && !preg_match('/^https?\:\/\//', $_POST['documentroot']))
{ {
$documentroot.= '/' . $_POST['documentroot']; $documentroot.= '/' . $_POST['documentroot'];
} }
@@ -319,19 +290,10 @@ if($page == 'domains'
$documentroot = $_POST['documentroot']; $documentroot = $_POST['documentroot'];
} }
} }
elseif (isset($_POST['documentroot'])
&& ($_POST['documentroot'] == '')
&& ($settings['system']['documentroot_use_default_value'] == 1))
{
$documentroot = makeCorrectDir($customer['documentroot'] . '/' . $domain);
}
} }
else else
{ {
$isbinddomain = '0'; $isbinddomain = '1';
if ($settings['system']['bind_enable'] == '1') {
$isbinddomain = '1';
}
$caneditdomain = '1'; $caneditdomain = '1';
$zonefile = ''; $zonefile = '';
$dkim = '1'; $dkim = '1';
@@ -341,9 +303,10 @@ if($page == 'domains'
if($userinfo['caneditphpsettings'] == '1' if($userinfo['caneditphpsettings'] == '1'
|| $userinfo['change_serversettings'] == '1') || $userinfo['change_serversettings'] == '1')
{ {
$openbasedir = isset($_POST['openbasedir']) ? intval($_POST['openbasedir']) : 0; $openbasedir = intval($_POST['openbasedir']);
$safemode = intval($_POST['safemode']);
if((int)$settings['system']['mod_fcgid'] == 1 || (int)$settings['phpfpm']['enabled'] == 1) if((int)$settings['system']['mod_fcgid'] == 1)
{ {
$phpsettingid = (int)$_POST['phpsettingid']; $phpsettingid = (int)$_POST['phpsettingid'];
$phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid); $phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid);
@@ -355,21 +318,12 @@ if($page == 'domains'
standard_error('phpsettingidwrong'); standard_error('phpsettingidwrong');
} }
if( (int)$settings['system']['mod_fcgid'] == 1) { $mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', '')); $mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
} else {
$mod_fcgid_starter = '-1';
$mod_fcgid_maxrequests = '-1';
}
} }
else else
{ {
if ((int)$settings['phpfpm']['enabled'] == 1) { $phpsettingid = $settings['system']['mod_fcgid_defaultini'];
$phpsettingid = $settings['phpfpm']['defaultini'];
} else {
$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
}
$mod_fcgid_starter = '-1'; $mod_fcgid_starter = '-1';
$mod_fcgid_maxrequests = '-1'; $mod_fcgid_maxrequests = '-1';
} }
@@ -377,11 +331,8 @@ if($page == 'domains'
else else
{ {
$openbasedir = '1'; $openbasedir = '1';
if ((int)$settings['phpfpm']['enabled'] == 1) { $safemode = '1';
$phpsettingid = $settings['phpfpm']['defaultini']; $phpsettingid = $settings['system']['mod_fcgid_defaultini'];
} else {
$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
}
$mod_fcgid_starter = '-1'; $mod_fcgid_starter = '-1';
$mod_fcgid_maxrequests = '-1'; $mod_fcgid_maxrequests = '-1';
} }
@@ -408,15 +359,12 @@ if($page == 'domains'
if($settings['system']['use_ssl'] == "1" if($settings['system']['use_ssl'] == "1"
&& isset($_POST['ssl']) && isset($_POST['ssl'])
/*&& isset($_POST['ssl_redirect'])*/ && isset($_POST['ssl_redirect'])
&& isset($_POST['ssl_ipandport']) && isset($_POST['ssl_ipandport'])
&& $_POST['ssl'] != '0') && $_POST['ssl'] != '0')
{ {
$ssl = 1; // if ssl is set and != 0 it can only be 1 $ssl = (int)$_POST['ssl'];
$ssl_redirect = 0; $ssl_redirect = (int)$_POST['ssl_redirect'];
if (isset($_POST['ssl_redirect'])) {
$ssl_redirect = (int)$_POST['ssl_redirect'];
}
$ssl_ipandport = (int)$_POST['ssl_ipandport']; $ssl_ipandport = (int)$_POST['ssl_ipandport'];
$ssl_ipandport_check = $db->query_first("SELECT `id`, `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = '" . $db->escape($ssl_ipandport) . "' AND `ssl` = '1'" . $additional_ip_condition); $ssl_ipandport_check = $db->query_first("SELECT `id`, `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = '" . $db->escape($ssl_ipandport) . "' AND `ssl` = '1'" . $additional_ip_condition);
@@ -462,6 +410,11 @@ if($page == 'domains'
$openbasedir = '0'; $openbasedir = '0';
} }
if($safemode != '1')
{
$safemode = '0';
}
if($speciallogfile != '1') if($speciallogfile != '1')
{ {
$speciallogfile = '0'; $speciallogfile = '0';
@@ -517,8 +470,7 @@ if($page == 'domains'
{ {
standard_error(array('stringisempty', 'mydomain')); standard_error(array('stringisempty', 'mydomain'));
} }
/* Check whether domain validation is enabled and if, validate the domain */ elseif(!validateDomain($domain))
elseif($settings['system']['validate_domain'] && !validateDomain($domain))
{ {
standard_error(array('stringiswrong', 'mydomain')); standard_error(array('stringiswrong', 'mydomain'));
} }
@@ -562,6 +514,7 @@ if($page == 'domains'
'ssl_redirect' => $ssl_redirect, 'ssl_redirect' => $ssl_redirect,
'ssl_ipandport' => $ssl_ipandport, 'ssl_ipandport' => $ssl_ipandport,
'openbasedir' => $openbasedir, 'openbasedir' => $openbasedir,
'safemode' => $safemode,
'phpsettingid' => $phpsettingid, 'phpsettingid' => $phpsettingid,
'mod_fcgid_starter' => $mod_fcgid_starter, 'mod_fcgid_starter' => $mod_fcgid_starter,
'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests, 'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests,
@@ -571,7 +524,7 @@ if($page == 'domains'
); );
$security_questions = array( $security_questions = array(
'reallydisablesecuritysetting' => ($openbasedir == '0' && $userinfo['change_serversettings'] == '1'), 'reallydisablesecuritysetting' => (($openbasedir == '0' || $safemode == '0') && $userinfo['change_serversettings'] == '1'),
'reallydocrootoutofcustomerroot' => (substr($documentroot, 0, strlen($customer['documentroot'])) != $customer['documentroot'] && !preg_match('/^https?\:\/\//', $documentroot)) 'reallydocrootoutofcustomerroot' => (substr($documentroot, 0, strlen($customer['documentroot'])) != $customer['documentroot'] && !preg_match('/^https?\:\/\//', $documentroot))
); );
$question_nr = 1; $question_nr = 1;
@@ -591,15 +544,12 @@ if($page == 'domains'
$question_nr++; $question_nr++;
} }
$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`domain`, `customerid`, `adminid`, `documentroot`, `ipandport`,`aliasdomain`, `zonefile`, `dkim`, `wwwserveralias`, `isbinddomain`, `isemaildomain`, `email_only`, `subcanemaildomain`, `caneditdomain`, `openbasedir`, `speciallogfile`, `specialsettings`, `ssl`, `ssl_redirect`, `ssl_ipandport`, `add_date`, `registration_date`, `phpsettingid`, `mod_fcgid_starter`, `mod_fcgid_maxrequests`, `ismainbutsubto`) VALUES ('" . $db->escape($domain) . "', '" . (int)$customerid . "', '" . (int)$adminid . "', '" . $db->escape($documentroot) . "', '" . $db->escape($ipandport) . "', " . (($aliasdomain != 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", '" . $db->escape($zonefile) . "', '" . $db->escape($dkim) . "', '" . $db->escape($wwwserveralias) . "', '" . $db->escape($isbinddomain) . "', '" . $db->escape($isemaildomain) . "', '" . $db->escape($email_only) . "', '" . $db->escape($subcanemaildomain) . "', '" . $db->escape($caneditdomain) . "', '" . $db->escape($openbasedir) . "', '" . $db->escape($speciallogfile) . "', '" . $db->escape($specialsettings) . "', '" . $ssl . "', '" . $ssl_redirect . "' , '" . $ssl_ipandport . "', '" . $db->escape(time()) . "', '" . $db->escape($registration_date) . "', '" . (int)$phpsettingid . "', '" . (int)$mod_fcgid_starter . "', '" . (int)$mod_fcgid_maxrequests . "', '".(int)$issubof."')"); $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`domain`, `customerid`, `adminid`, `documentroot`, `ipandport`,`aliasdomain`, `zonefile`, `dkim`, `wwwserveralias`, `isbinddomain`, `isemaildomain`, `email_only`, `subcanemaildomain`, `caneditdomain`, `openbasedir`, `safemode`,`speciallogfile`, `specialsettings`, `ssl`, `ssl_redirect`, `ssl_ipandport`, `add_date`, `registration_date`, `phpsettingid`, `mod_fcgid_starter`, `mod_fcgid_maxrequests`, `ismainbutsubto`) VALUES ('" . $db->escape($domain) . "', '" . (int)$customerid . "', '" . (int)$adminid . "', '" . $db->escape($documentroot) . "', '" . $db->escape($ipandport) . "', " . (($aliasdomain != 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", '" . $db->escape($zonefile) . "', '" . $db->escape($dkim) . "', '" . $db->escape($wwwserveralias) . "', '" . $db->escape($isbinddomain) . "', '" . $db->escape($isemaildomain) . "', '" . $db->escape($email_only) . "', '" . $db->escape($subcanemaildomain) . "', '" . $db->escape($caneditdomain) . "', '" . $db->escape($openbasedir) . "', '" . $db->escape($safemode) . "', '" . $db->escape($speciallogfile) . "', '" . $db->escape($specialsettings) . "', '" . $ssl . "', '" . $ssl_redirect . "' , '" . $ssl_ipandport . "', '" . $db->escape(time()) . "', '" . $db->escape($registration_date) . "', '" . (int)$phpsettingid . "', '" . (int)$mod_fcgid_starter . "', '" . (int)$mod_fcgid_maxrequests . "', '".(int)$issubof."')");
$domainid = $db->insert_id(); $domainid = $db->insert_id();
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` + 1 WHERE `adminid` = '" . (int)$adminid . "'"); $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` + 1 WHERE `adminid` = '" . (int)$adminid . "'");
$log->logAction(ADM_ACTION, LOG_INFO, "added domain '" . $domain . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added domain '" . $domain . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
@@ -699,22 +649,23 @@ if($page == 'domains'
while($row = $db->fetch_array($configs)) while($row = $db->fetch_array($configs))
{ {
if ((int)$settings['phpfpm']['enabled'] == 1) { $phpconfigs.= makeoption($row['description'], $row['id'], $settings['system']['mod_fcgid_defaultini'], true, true);
$phpconfigs.= makeoption($row['description'], $row['id'], $settings['phpfpm']['defaultini'], true, true);
} else {
$phpconfigs.= makeoption($row['description'], $row['id'], $settings['system']['mod_fcgid_defaultini'], true, true);
}
} }
$isbinddomain = makeyesno('isbinddomain', '1', '0', '1');
$isemaildomain = makeyesno('isemaildomain', '1', '0', '1');
$email_only = makeyesno('email_only', '1', '0', '0');
$subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['always'], '3', '0', true, true); $subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['always'], '3', '0', true, true);
$dkim = makeyesno('dkim', '1', '0', '1');
$wwwserveralias = makeyesno('wwwserveralias', '1', '0', '1');
$caneditdomain = makeyesno('caneditdomain', '1', '0', '1');
$openbasedir = makeyesno('openbasedir', '1', '0', '1');
$safemode = makeyesno('safemode', '1', '0', '1');
$speciallogfile = makeyesno('speciallogfile', '1', '0', '0');
$ssl = makeyesno('ssl', '1', '0', '0');
$ssl_redirect = makeyesno('ssl_redirect', '1', '0', '0');
$add_date = date('Y-m-d'); $add_date = date('Y-m-d');
$domain_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/domains/formfield.domains_add.php';
$domain_add_form = htmlform::genHTMLForm($domain_add_data);
$title = $domain_add_data['domain_add']['title'];
$image = $domain_add_data['domain_add']['image'];
eval("echo \"" . getTemplate("domains/domains_add") . "\";"); eval("echo \"" . getTemplate("domains/domains_add") . "\";");
} }
} }
@@ -804,42 +755,21 @@ if($page == 'domains'
$aliasdomain = intval($_POST['alias']); $aliasdomain = intval($_POST['alias']);
$issubof = intval($_POST['issubof']); $issubof = intval($_POST['issubof']);
$subcanemaildomain = intval($_POST['subcanemaildomain']);
$caneditdomain = isset($_POST['caneditdomain']) ? intval($_POST['caneditdomain']) : 0;
$registration_date = trim($_POST['registration_date']);
$registration_date = validate($registration_date, 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
$isemaildomain = 0;
if(isset($_POST['isemaildomain']))
$isemaildomain = intval($_POST['isemaildomain']); $isemaildomain = intval($_POST['isemaildomain']);
$email_only = intval($_POST['email_only']);
$email_only = 0; $subcanemaildomain = intval($_POST['subcanemaildomain']);
if(isset($_POST['email_only'])) $caneditdomain = intval($_POST['caneditdomain']);
$email_only = intval($_POST['email_only']); $wwwserveralias = intval($_POST['wwwserveralias']);
$registration_date = validate($_POST['registration_date'], 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
$wwwserveralias = 0;
if(isset($_POST['wwwserveralias']))
$wwwserveralias = intval($_POST['wwwserveralias']);
$speciallogfile = 0;
if(isset($_POST['speciallogfile']))
$speciallogfile = intval($_POST['speciallogfile']);
if($userinfo['change_serversettings'] == '1') if($userinfo['change_serversettings'] == '1')
{ {
$isbinddomain = $result['isbinddomain']; $isbinddomain = intval($_POST['isbinddomain']);
$zonefile = $result['zonefile']; $zonefile = validate($_POST['zonefile'], 'zonefile');
if ($settings['system']['bind_enable'] == '1') {
if (isset($_POST['isbinddomain'])) {
$isbinddomain = (int)$_POST['isbinddomain'];
}
$zonefile = validate($_POST['zonefile'], 'zonefile');
}
if($settings['dkim']['use_dkim'] == '1') if($settings['dkim']['use_dkim'] == '1')
{ {
$dkim = isset($_POST['dkim']) ? 1 : 0; $dkim = intval($_POST['dkim']);
} }
else else
{ {
@@ -851,16 +781,7 @@ if($page == 'domains'
if($documentroot == '') if($documentroot == '')
{ {
// If path is empty and 'Use domain name as default value for DocumentRoot path' is enabled in settings, $documentroot = $customer['documentroot'];
// set default path to subdomain or domain name
if ($settings['system']['documentroot_use_default_value'] == 1)
{
$documentroot = makeCorrectDir($customer['documentroot'] . '/' . $result['domain']);
}
else
{
$documentroot = $customer['documentroot'];
}
} }
if(!preg_match('/^https?\:\/\//', $documentroot) if(!preg_match('/^https?\:\/\//', $documentroot)
@@ -881,9 +802,10 @@ if($page == 'domains'
if($userinfo['caneditphpsettings'] == '1' if($userinfo['caneditphpsettings'] == '1'
|| $userinfo['change_serversettings'] == '1') || $userinfo['change_serversettings'] == '1')
{ {
$openbasedir = isset($_POST['openbasedir']) ? intval($_POST['openbasedir']) : 0; $openbasedir = intval($_POST['openbasedir']);
$safemode = intval($_POST['safemode']);
if((int)$settings['system']['mod_fcgid'] == 1 || (int)$settings['phpfpm']['enabled'] == 1) if((int)$settings['system']['mod_fcgid'] == 1)
{ {
$phpsettingid = (int)$_POST['phpsettingid']; $phpsettingid = (int)$_POST['phpsettingid'];
$phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid); $phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid);
@@ -895,13 +817,8 @@ if($page == 'domains'
standard_error('phpsettingidwrong'); standard_error('phpsettingidwrong');
} }
if ((int)$settings['system']['mod_fcgid'] == 1) { $mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', '')); $mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
} else {
$mod_fcgid_starter = $result['mod_fcgid_starter'];
$mod_fcgid_maxrequests = $result['mod_fcgid_maxrequests'];
}
} }
else else
{ {
@@ -913,6 +830,7 @@ if($page == 'domains'
else else
{ {
$openbasedir = $result['openbasedir']; $openbasedir = $result['openbasedir'];
$safemode = $result['safemode'];
$phpsettingid = $result['phpsettingid']; $phpsettingid = $result['phpsettingid'];
$mod_fcgid_starter = $result['mod_fcgid_starter']; $mod_fcgid_starter = $result['mod_fcgid_starter'];
$mod_fcgid_maxrequests = $result['mod_fcgid_maxrequests']; $mod_fcgid_maxrequests = $result['mod_fcgid_maxrequests'];
@@ -940,15 +858,12 @@ if($page == 'domains'
if($settings['system']['use_ssl'] == "1" if($settings['system']['use_ssl'] == "1"
&& isset($_POST['ssl']) && isset($_POST['ssl'])
/*&& isset($_POST['ssl_redirect'])*/ && isset($_POST['ssl_redirect'])
&& isset($_POST['ssl_ipandport']) && isset($_POST['ssl_ipandport'])
&& $_POST['ssl'] != '0') && $_POST['ssl'] != '0')
{ {
$ssl = 1; // if ssl is set and != 0, it can only be 1 $ssl = (int)$_POST['ssl'];
$ssl_redirect = 0; $ssl_redirect = (int)$_POST['ssl_redirect'];
if (isset($_POST['ssl_redirect'])) {
$ssl_redirect = (int)$_POST['ssl_redirect'];
}
$ssl_ipandport = (int)$_POST['ssl_ipandport']; $ssl_ipandport = (int)$_POST['ssl_ipandport'];
$ssl_ipandport_check = $db->query_first("SELECT `id`, `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = '" . $db->escape($ssl_ipandport) . "' AND `ssl` = '1'" . $additional_ip_condition); $ssl_ipandport_check = $db->query_first("SELECT `id`, `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = '" . $db->escape($ssl_ipandport) . "' AND `ssl` = '1'" . $additional_ip_condition);
@@ -976,6 +891,11 @@ if($page == 'domains'
$openbasedir = '0'; $openbasedir = '0';
} }
if($safemode != '1')
{
$safemode = '0';
}
if($isbinddomain != '1') if($isbinddomain != '1')
{ {
$isbinddomain = '0'; $isbinddomain = '0';
@@ -1053,17 +973,17 @@ if($page == 'domains'
'ssl_redirect' => $ssl_redirect, 'ssl_redirect' => $ssl_redirect,
'ssl_ipandport' => $ssl_ipandport, 'ssl_ipandport' => $ssl_ipandport,
'openbasedir' => $openbasedir, 'openbasedir' => $openbasedir,
'safemode' => $safemode,
'phpsettingid' => $phpsettingid, 'phpsettingid' => $phpsettingid,
'mod_fcgid_starter' => $mod_fcgid_starter, 'mod_fcgid_starter' => $mod_fcgid_starter,
'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests, 'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests,
'specialsettings' => $specialsettings, 'specialsettings' => $specialsettings,
'registration_date' => $registration_date, 'registration_date' => $registration_date,
'issubof' => $issubof, 'issubof' => $issubof
'speciallogfile' => $speciallogfile
); );
$security_questions = array( $security_questions = array(
'reallydisablesecuritysetting' => ($openbasedir == '0' && $userinfo['change_serversettings'] == '1'), 'reallydisablesecuritysetting' => (($openbasedir == '0' || $safemode == '0') && $userinfo['change_serversettings'] == '1'),
'reallydocrootoutofcustomerroot' => (substr($documentroot, 0, strlen($customer['documentroot'])) != $customer['documentroot'] && !preg_match('/^https?\:\/\//', $documentroot)) 'reallydocrootoutofcustomerroot' => (substr($documentroot, 0, strlen($customer['documentroot'])) != $customer['documentroot'] && !preg_match('/^https?\:\/\//', $documentroot))
); );
foreach($security_questions as $question_name => $question_launch) foreach($security_questions as $question_name => $question_launch)
@@ -1088,20 +1008,17 @@ if($page == 'domains'
|| $ssl_ipandport != $result['ssl_ipandport'] || $ssl_ipandport != $result['ssl_ipandport']
|| $wwwserveralias != $result['wwwserveralias'] || $wwwserveralias != $result['wwwserveralias']
|| $openbasedir != $result['openbasedir'] || $openbasedir != $result['openbasedir']
|| $safemode != $result['safemode']
|| $phpsettingid != $result['phpsettingid'] || $phpsettingid != $result['phpsettingid']
|| $mod_fcgid_starter != $result['mod_fcgid_starter'] || $mod_fcgid_starter != $result['mod_fcgid_starter']
|| $mod_fcgid_maxrequests != $result['mod_fcgid_maxrequests'] || $mod_fcgid_maxrequests != $result['mod_fcgid_maxrequests']
|| $specialsettings != $result['specialsettings'] || $specialsettings != $result['specialsettings']
|| $aliasdomain != $result['aliasdomain'] || $aliasdomain != $result['aliasdomain']
|| $issubof != $result['ismainbutsubto'] || $issubof != $result['ismainbutsubto'])
|| $email_only != $result['email_only']
|| ($speciallogfile != $result['speciallogfile'] && $_POST['speciallogverified'] == '1'))
{ {
inserttask('1'); inserttask('1');
} }
if($speciallogfile != $result['speciallogfile'] && $_POST['speciallogverified'] != '1') $speciallogfile = $result['speciallogfile'];
if($isbinddomain != $result['isbinddomain'] if($isbinddomain != $result['isbinddomain']
|| $zonefile != $result['zonefile'] || $zonefile != $result['zonefile']
|| $dkim != $result['dkim'] || $dkim != $result['dkim']
@@ -1147,7 +1064,7 @@ if($page == 'domains'
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` - 1 WHERE `adminid` = '" . (int)$result['adminid'] . "' "); $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` - 1 WHERE `adminid` = '" . (int)$result['adminid'] . "' ");
} }
$ssfs = isset($_POST['specialsettingsforsubdomains']) ? 1 : 0; $ssfs = isset($_POST['specialsettingsforsubdomains']) ? intval($_POST['specialsettingsforsubdomains']) : 1;
if($ssfs == 1) if($ssfs == 1)
{ {
$upd_specialsettings = ", `specialsettings`='" . $db->escape($specialsettings) . "' "; $upd_specialsettings = ", `specialsettings`='" . $db->escape($specialsettings) . "' ";
@@ -1159,8 +1076,8 @@ if($page == 'domains'
$log->logAction(ADM_ACTION, LOG_INFO, "removed specialsettings on all subdomains of domain #" . $id); $log->logAction(ADM_ACTION, LOG_INFO, "removed specialsettings on all subdomains of domain #" . $id);
} }
$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `documentroot`='" . $db->escape($documentroot) . "', `ipandport`='" . $db->escape($ipandport) . "', `ssl`='" . (int)$ssl . "', `ssl_redirect`='" . (int)$ssl_redirect . "', `ssl_ipandport`='" . (int)$ssl_ipandport . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", `isbinddomain`='" . $db->escape($isbinddomain) . "', `isemaildomain`='" . $db->escape($isemaildomain) . "', `email_only`='" . $db->escape($email_only) . "', `subcanemaildomain`='" . $db->escape($subcanemaildomain) . "', `dkim`='" . $db->escape($dkim) . "', `caneditdomain`='" . $db->escape($caneditdomain) . "', `zonefile`='" . $db->escape($zonefile) . "', `wwwserveralias`='" . $db->escape($wwwserveralias) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `speciallogfile`='" . $db->escape($speciallogfile) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "', `specialsettings`='" . $db->escape($specialsettings) . "', `registration_date`='" . $db->escape($registration_date) . "', `ismainbutsubto`='" . (int)$issubof . "' WHERE `id`='" . (int)$id . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `documentroot`='" . $db->escape($documentroot) . "', `ipandport`='" . $db->escape($ipandport) . "', `ssl`='" . (int)$ssl . "', `ssl_redirect`='" . (int)$ssl_redirect . "', `ssl_ipandport`='" . (int)$ssl_ipandport . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", `isbinddomain`='" . $db->escape($isbinddomain) . "', `isemaildomain`='" . $db->escape($isemaildomain) . "', `email_only`='" . $db->escape($email_only) . "', `subcanemaildomain`='" . $db->escape($subcanemaildomain) . "', `dkim`='" . $db->escape($dkim) . "', `caneditdomain`='" . $db->escape($caneditdomain) . "', `zonefile`='" . $db->escape($zonefile) . "', `wwwserveralias`='" . $db->escape($wwwserveralias) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `safemode`='" . $db->escape($safemode) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "', `specialsettings`='" . $db->escape($specialsettings) . "', `registration_date`='" . $db->escape($registration_date) . "', `ismainbutsubto`='" . (int)$issubof . "' WHERE `id`='" . (int)$id . "'");
$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `ipandport`='" . $db->escape($ipandport) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `speciallogfile`='" . $db->escape($speciallogfile) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "'" . $upd_specialsettings . $updatechildren . " WHERE `parentdomainid`='" . (int)$id . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `ipandport`='" . $db->escape($ipandport) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `safemode`='" . $db->escape($safemode) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "'" . $upd_specialsettings . $updatechildren . " WHERE `parentdomainid`='" . (int)$id . "'");
$log->logAction(ADM_ACTION, LOG_INFO, "edited domain #" . $id); $log->logAction(ADM_ACTION, LOG_INFO, "edited domain #" . $id);
$redirect_props = Array( $redirect_props = Array(
'page' => $page, 'page' => $page,
@@ -1260,11 +1177,20 @@ if($page == 'domains'
} }
$result['specialsettings'] = $result['specialsettings']; $result['specialsettings'] = $result['specialsettings'];
$isbinddomain = makeyesno('isbinddomain', '1', '0', $result['isbinddomain']);
$wwwserveralias = makeyesno('wwwserveralias', '1', '0', $result['wwwserveralias']);
$isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
$email_only = makeyesno('email_only', '1', '0', $result['email_only']);
$ssl = makeyesno('ssl', '1', '0', $result['ssl']);
$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
$subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', $result['subcanemaildomain'], true, true); $subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', $result['subcanemaildomain'], true, true);
$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', $result['subcanemaildomain'], true, true); $subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', $result['subcanemaildomain'], true, true);
$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', $result['subcanemaildomain'], true, true); $subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', $result['subcanemaildomain'], true, true);
$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['always'], '3', $result['subcanemaildomain'], true, true); $subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['always'], '3', $result['subcanemaildomain'], true, true);
$dkim = makeyesno('dkim', '1', '0', $result['dkim']);
$caneditdomain = makeyesno('caneditdomain', '1', '0', $result['caneditdomain']);
$openbasedir = makeyesno('openbasedir', '1', '0', $result['openbasedir']);
$safemode = makeyesno('safemode', '1', '0', $result['safemode']);
$speciallogfile = ($result['speciallogfile'] == 1 ? $lng['panel']['yes'] : $lng['panel']['no']); $speciallogfile = ($result['speciallogfile'] == 1 ? $lng['panel']['yes'] : $lng['panel']['no']);
$result['add_date'] = date('Y-m-d', $result['add_date']); $result['add_date'] = date('Y-m-d', $result['add_date']);
@@ -1276,16 +1202,9 @@ if($page == 'domains'
$phpconfigs.= makeoption($phpconfigs_row['description'], $phpconfigs_row['id'], $result['phpsettingid'], true, true); $phpconfigs.= makeoption($phpconfigs_row['description'], $phpconfigs_row['id'], $result['phpsettingid'], true, true);
} }
$specialsettingsforsubdomains = makeyesno('specialsettingsforsubdomains', '1', '0', '1');
$result = htmlentities_array($result); $result = htmlentities_array($result);
$domain_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/domains/formfield.domains_edit.php';
$domain_edit_form = htmlform::genHTMLForm($domain_edit_data);
$title = $domain_edit_data['domain_edit']['title'];
$image = $domain_edit_data['domain_edit']['image'];
$speciallogwarning = sprintf($lng['admin']['speciallogwarning'], $lng['admin']['delete_statistics']);
eval("echo \"" . getTemplate("domains/domains_edit") . "\";"); eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -104,13 +104,11 @@ if($page == 'overview')
$_message = isset($latestversion[1]) ? $latestversion[1] : ''; $_message = isset($latestversion[1]) ? $latestversion[1] : '';
$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes'); $_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
// add the branding so debian guys are not gettings confused $lookfornewversion_lable = $_version;
// about their version-number
$lookfornewversion_lable = $_version.$branding;
$lookfornewversion_link = $_link; $lookfornewversion_link = $_link;
$lookfornewversion_addinfo = $_message; $lookfornewversion_addinfo = $_message;
if (version_compare2($version, $_version) == -1) { if (version_compare($version, $_version) == -1) {
$isnewerversion = 1; $isnewerversion = 1;
} else { } else {
$isnewerversion = 0; $isnewerversion = 0;
@@ -297,34 +295,5 @@ elseif($page == 'change_language')
eval("echo \"" . getTemplate("index/change_language") . "\";"); eval("echo \"" . getTemplate("index/change_language") . "\";");
} }
} }
elseif($page == 'change_theme')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send'
) {
$theme = validate($_POST['theme'], 'theme');
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `adminid`='" . (int)$userinfo['adminid'] . "'"); ?>
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(ADM_ACTION, LOG_NOTICE, "changed his/her theme to '" . $theme . "'");
redirectTo($filename, Array('s' => $s));
}
else
{
$theme_options = '';
$default_theme = $settings['panel']['default_theme'];
if($userinfo['theme'] != '') {
$default_theme = $userinfo['theme'];
}
$themes_avail = getThemes();
foreach($themes_avail as $t)
{
$theme_options.= makeoption($t, $t, $default_theme, true);
}
eval("echo \"" . getTemplate("index/change_theme") . "\";");
}
}

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -104,10 +104,7 @@ if($page == 'ipsandports'
$db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'");
$log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
else else
@@ -139,11 +136,11 @@ if($page == 'ipsandports'
{ {
$ip = validate_ip($_POST['ip']); $ip = validate_ip($_POST['ip']);
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport')); $port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0; $listen_statement = intval($_POST['listen_statement']);
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0; $namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0; $vhostcontainer = intval($_POST['vhostcontainer']);
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/'); $specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0; $vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/'); $default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
$docroot = validate($_POST['docroot'], 'docroot'); $docroot = validate($_POST['docroot'], 'docroot');
if((int)$settings['system']['use_ssl'] == 1) if((int)$settings['system']['use_ssl'] == 1)
@@ -248,29 +245,17 @@ if($page == 'ipsandports'
$log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
/*
$enable_ssl = makeyesno('ssl', '1', '0', '0'); $enable_ssl = makeyesno('ssl', '1', '0', '0');
$listen_statement = makeyesno('listen_statement', '1', '0', '1'); $listen_statement = makeyesno('listen_statement', '1', '0', '1');
$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1'); $namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1');
$vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1'); $vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1');
$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1'); $vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1');
*/
$ipsandports_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_add.php';
$ipsandports_add_form = htmlform::genHTMLForm($ipsandports_add_data);
$title = $ipsandports_add_data['ipsandports_add']['title'];
$image = $ipsandports_add_data['ipsandports_add']['image'];
eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";"); eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";");
} }
} }
@@ -288,23 +273,16 @@ if($page == 'ipsandports'
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport')); $port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'"); $result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");
$result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'"); $result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'");
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0; $listen_statement = intval($_POST['listen_statement']);
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0; $namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0; $vhostcontainer = intval($_POST['vhostcontainer']);
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/'); $specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0; $vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/'); $default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
$docroot = validate($_POST['docroot'], 'docroot'); $docroot = validate($_POST['docroot'], 'docroot');
if((int)$settings['system']['use_ssl'] == 1)
if((int)$settings['system']['use_ssl'] == 1 {
/* $ssl = intval($_POST['ssl']);
* check here if ssl is even checked, cause if not, we don't need
* to validate and set all the $ssl_*_file vars
*/
&& isset($_POST['ssl'])
&& $_POST['ssl'] != 0
) {
$ssl = 1;
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file'); $ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file'); $ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file'); $ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
@@ -406,30 +384,18 @@ if($page == 'ipsandports'
$log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
$result = htmlentities_array($result);
/*
$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']); $enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
$result = htmlentities_array($result);
$listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']); $listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']);
$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']); $namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']);
$vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']); $vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']);
$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']); $vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']);
*/
$ipsandports_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_edit.php';
$ipsandports_edit_form = htmlform::genHTMLForm($ipsandports_edit_data);
$title = $ipsandports_edit_data['ipsandports_edit']['title'];
$image = $ipsandports_edit_data['ipsandports_edit']['image'];
eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";"); eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -22,17 +22,19 @@ define('AREA', 'admin');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if ($page == 'log' require ("./lib/init.php");
&& $userinfo['change_serversettings'] == '1'
) { if($page == 'log'
if ($action == '') { && $userinfo['change_serversettings'] == '1')
{
if($action == '')
{
$fields = array( $fields = array(
'action' => $lng['logger']['action'],
'date' => $lng['logger']['date'], 'date' => $lng['logger']['date'],
'type' => $lng['logger']['type'], 'type' => $lng['logger']['type'],
'user' => $lng['logger']['user'], 'user' => $lng['logger']['user']
'text' => $lng['logger']['action']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$paging->sortfield = 'date'; $paging->sortfield = 'date';
@@ -45,21 +47,24 @@ if ($page == 'log'
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s); $pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
$clog = array(); $clog = array();
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if (!isset($clog[$row['action']]) {
|| !is_array($clog[$row['action']]) if(!isset($clog[$row['action']])
) { || !is_array($clog[$row['action']]))
{
$clog[$row['action']] = array(); $clog[$row['action']] = array();
} }
$clog[$row['action']][$row['logid']] = $row; $clog[$row['action']][$row['logid']] = $row;
} }
if ($paging->sortfield == 'date' if($paging->sortfield == 'date'
&& $paging->sortorder == 'desc' && $paging->sortorder == 'desc')
) { {
krsort($clog); krsort($clog);
} else { }
else
{
ksort($clog); ksort($clog);
} }
@@ -67,15 +72,20 @@ if ($page == 'log'
$count = 0; $count = 0;
$log_count = 0; $log_count = 0;
$log = ''; $log = '';
foreach ($clog as $action => $logrows) { foreach($clog as $action => $logrows)
{
$_action = 0; $_action = 0;
foreach ($logrows as $row) { foreach($logrows as $row)
if ($paging->checkDisplay($i)) { {
if($paging->checkDisplay($i))
{
$row = htmlentities_array($row); $row = htmlentities_array($row);
$row['date'] = date("d.m.y H:i:s", $row['date']); $row['date'] = date("d.m.y H:i:s", $row['date']);
if ($_action != $action) { if($_action != $action)
switch ($action) { {
switch($action)
{
case USR_ACTION: case USR_ACTION:
$_action = $lng['admin']['customer']; $_action = $lng['admin']['customer'];
break; break;
@@ -97,14 +107,15 @@ if ($page == 'log'
} }
$row['action'] = $_action; $row['action'] = $_action;
eval("\$log.=\"" . getTemplate('logger/logger_action') . "\";"); eval("\$log.=\"" . getTemplate("logger/logger_action") . "\";");
} }
$log_count++; $log_count++;
$type = $row['type']; $type = $row['type'];
$_type = 'unknown'; $_type = 'unknown';
switch ($type) { switch($type)
{
case LOG_INFO: case LOG_INFO:
$_type = 'Information'; $_type = 'Information';
break; break;
@@ -126,28 +137,35 @@ if ($page == 'log'
} }
$row['type'] = $_type; $row['type'] = $_type;
eval("\$log.=\"" . getTemplate('logger/logger_log') . "\";"); eval("\$log.=\"" . getTemplate("logger/logger_log") . "\";");
$count++; $count++;
$_action = $action; $_action = $action;
} }
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate('logger/logger') . "\";"); eval("echo \"" . getTemplate("logger/logger") . "\";");
} elseif ($action == 'truncate') { }
if (isset($_POST['send']) elseif($action == 'truncate')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$yesterday = time() - (60 * 10); $yesterday = time() - (60 * 10);
/* (60*60*24); */ /* (60*60*24); */
$db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'");
$log->logAction(ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)'); $log->logAction(ADM_ACTION, LOG_WARNING, "truncated the system-log (mysql)");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
else
{
ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG); ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG);
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -22,60 +22,79 @@ define('AREA', 'admin');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if (isset($_POST['id'])) { require ("./lib/init.php");
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif (isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'message') { if($page == 'message')
if ($action == '') { {
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed panel_message'); if($action == '')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed panel_message");
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
if ($_POST['receipient'] == 0 if($_POST['receipient'] == 0
&& $userinfo['customers_see_all'] == '1' && $userinfo['customers_see_all'] == '1')
) { {
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to admins'); $log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to admins");
$result = $db->query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`"); $result = $db->query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`");
} elseif ($_POST['receipient'] == 1) { }
if ($userinfo['customers_see_all'] == '1') { elseif($_POST['receipient'] == 1)
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers'); {
if($userinfo['customers_see_all'] == "1")
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to ALL customers");
$result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`"); $result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`");
} else { }
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to customers'); else
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to customers");
$result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'"); $result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'");
} }
} else { }
else
{
standard_error('noreceipientsgiven'); standard_error('noreceipientsgiven');
} }
$subject = $_POST['subject']; $subject = $_POST['subject'];
$message = wordwrap($_POST['message'], 70); $message = wordwrap($_POST['message'], 70);
if (!empty($message)) { if(!empty($message))
{
$mailcounter = 0; $mailcounter = 0;
$mail->Body = $message; $mail->Body = $message;
$mail->Subject = $subject; $mail->Subject = $subject;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']); $mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']);
$mail->From = $userinfo['email']; $mail->From = $userinfo['email'];
$mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name']; $mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name'];
if (!$mail->Send()) { if(!$mail->Send())
if ($mail->ErrorInfo != '') { {
if($mail->ErrorInfo != '')
{
$mailerr_msg = $mail->ErrorInfo; $mailerr_msg = $mail->ErrorInfo;
} else { }
$mailerr_msg = $row['email']; else
{
$mailerr_msg = $row["email"];
} }
$log->logAction(ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg); $log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error('errorsendingmail', $row['email']); standard_error('errorsendingmail', $row["email"]);
} }
$mailcounter++; $mailcounter++;
@@ -83,34 +102,47 @@ if ($page == 'message') {
} }
redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter)); redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter));
} else { }
else
{
standard_error('nomessagetosend'); standard_error('nomessagetosend');
} }
} }
} }
if ($action == 'showsuccess') { if($action == 'showsuccess')
{
$success = 1; $success = 1;
$sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0; $sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0;
if ($sentitems == 0) { if($sentitems == 0)
{
$successmessage = $lng['message']['noreceipients']; $successmessage = $lng['message']['noreceipients'];
} else { }
else
{
$successmessage = str_replace('%s', $sentitems, $lng['message']['success']); $successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
} }
} else {
$action = '';
}
else
{
$success = 0; $success = 0;
$sentitems = 0; $sentitems = 0;
$successmessage = ''; $successmessage = '';
$action = '';
} }
$action = '';
$receipients = ''; $receipients = '';
if ($userinfo['customers_see_all'] == '1') { if($userinfo['customers_see_all'] == "1")
{
$receipients.= makeoption($lng['panel']['reseller'], 0); $receipients.= makeoption($lng['panel']['reseller'], 0);
} }
$receipients .= makeoption($lng['panel']['customer'], 1); $receipients.= makeoption($lng['panel']['customer'], 1);
eval("echo \"" . getTemplate('message/message') . "\";"); eval("echo \"" . getTemplate("message/message") . "\";");
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -25,58 +25,49 @@ define('AREA', 'admin');
require ("./lib/init.php"); require ("./lib/init.php");
if (isset($_POST['id'])) { if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif (isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
if ($action == '') { if($action == '')
{
$tablecontent = ''; $tablecontent = '';
$count = 0;
$result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`"); $result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$domainresult = false; $domainresult = false;
$query = "SELECT * FROM `".TABLE_PANEL_DOMAINS."` if((int)$userinfo['domains_see_all'] == 0)
WHERE `phpsettingid` = '".(int)$row['id']."' {
AND `parentdomainid` = '0'"; $domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `adminid` = " . (int)$userinfo['userid'] . " AND `phpsettingid` = " . (int)$row['id']);
if ((int)$userinfo['domains_see_all'] == 0) {
$query .= " AND `adminid` = '".(int)$userinfo['userid']."'";
} }
else
if ((int)$settings['panel']['phpconfigs_hidestdsubdomain'] == 1) { {
$query2 = "SELECT DISTINCT `standardsubdomain` $domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `phpsettingid` = " . (int)$row['id']);
FROM `".TABLE_PANEL_CUSTOMERS."`
WHERE `standardsubdomain` > 0 ORDER BY `standardsubdomain` ASC;";
$ssdids_res = $db->query($query2);
$ssdids = array();
while ($ssd = $db->fetch_array($ssdids_res)) {
$ssdids[] = $ssd['standardsubdomain'];
}
if (count($ssdids) > 0) {
$query .= " AND `id` NOT IN (".implode(', ', $ssdids).")";
}
} }
$domainresult = $db->query($query);
$domains = ''; $domains = '';
if ($db->num_rows($domainresult) > 0) {
while ($row2 = $db->fetch_array($domainresult)) { if($db->num_rows($domainresult) > 0)
{
while($row2 = $db->fetch_array($domainresult))
{
$domains.= $row2['domain'] . '<br/>'; $domains.= $row2['domain'] . '<br/>';
} }
} else { }
else
{
$domains = $lng['admin']['phpsettings']['notused']; $domains = $lng['admin']['phpsettings']['notused'];
} }
$count ++;
eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";"); eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";");
} }
@@ -112,13 +103,6 @@ if ($page == 'overview') {
else else
{ {
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1");
$phpconfig_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_add.php';
$phpconfig_add_form = htmlform::genHTMLForm($phpconfig_add_data);
$title = $phpconfig_add_data['phpconfig_add']['title'];
$image = $phpconfig_add_data['phpconfig_add']['image'];
eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";"); eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";");
} }
} }
@@ -188,12 +172,6 @@ if ($page == 'overview') {
} }
else else
{ {
$phpconfig_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_edit.php';
$phpconfig_edit_form = htmlform::genHTMLForm($phpconfig_edit_data);
$title = $phpconfig_edit_data['phpconfig_edit']['title'];
$image = $phpconfig_edit_data['phpconfig_edit']['image'];
eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";"); eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -65,11 +65,6 @@ if(($page == 'settings' || $page == 'overview')
$only_enabledisable = true; $only_enabledisable = true;
} }
// check if the session timeout is too low #815
if (isset($_POST['session_sessiontimeout']) && $_POST['session_sessiontimeout'] <= 60) {
standard_error($lng['error']['session_timeout'], $lng['error']['session_timeout_desc']);
}
if(processFormEx( if(processFormEx(
$settings_data, $settings_data,
$_POST, $_POST,
@@ -82,9 +77,8 @@ if(($page == 'settings' || $page == 'overview')
) { ) {
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting"); $log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
inserttask('5');
standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page)); standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page));
} }
} }
@@ -123,11 +117,9 @@ elseif($page == 'rebuildconfigs'
{ {
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles"); $log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles");
inserttask('1'); inserttask('1');
inserttask('10');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
inserttask('5');
standard_success('rebuildingconfigs', '', array('filename' => 'admin_index.php')); redirectTo('admin_index.php', array('s' => $s));
} }
else else
{ {

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -48,28 +48,17 @@ elseif(isset($_GET['id']))
$available_templates = array( $available_templates = array(
'createcustomer', 'createcustomer',
'pop_success', 'pop_success',
'trafficmaxpercent',
'diskmaxpercent',
'new_ticket_by_customer',
'new_ticket_for_customer',
'new_ticket_by_staff',
'new_reply_ticket_by_customer',
'new_reply_ticket_by_staff',
'new_database_by_customer', 'new_database_by_customer',
'new_ftpaccount_by_customer', 'new_ftpaccount_by_customer',
'password_reset' 'password_reset'
); );
// only show templates of features that are enabled #1191
if ((int)$settings['system']['report_enable'] == 1) {
array_push($available_templates,
'trafficmaxpercent',
'diskmaxpercent'
);
}
if ((int)$settings['ticket']['enabled'] == 1) {
array_push($available_templates,
'new_ticket_by_customer',
'new_ticket_for_customer',
'new_ticket_by_staff',
'new_reply_ticket_by_customer',
'new_reply_ticket_by_staff'
);
}
$file_templates = array( $file_templates = array(
'index_html' 'index_html'
); );
@@ -163,7 +152,7 @@ elseif($action == 'delete'
} }
} }
} }
elseif($action == 'deletef' elseif($action == 'delete'
&& $id != 0) && $id != 0)
{ {
//file templates //file templates
@@ -220,12 +209,6 @@ elseif($action == 'add')
$template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true); $template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true);
} }
$template_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_add.php';
$template_add_form = htmlform::genHTMLForm($template_add_data);
$title = $template_add_data['template_add']['title'];
$image = $template_add_data['template_add']['image'];
eval("echo \"" . getTemplate("templates/templates_add_2") . "\";"); eval("echo \"" . getTemplate("templates/templates_add_2") . "\";");
} }
elseif(isset($_POST['send']) elseif(isset($_POST['send'])
@@ -329,12 +312,6 @@ elseif($action == 'add')
$free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true); $free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true);
} }
$filetemplate_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_add.php';
$filetemplate_add_form = htmlform::genHTMLForm($filetemplate_add_data);
$title = $filetemplate_add_data['filetemplate_add']['title'];
$image = $filetemplate_add_data['filetemplate_add']['image'];
eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";"); eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";");
} }
} }
@@ -367,18 +344,11 @@ elseif($action == 'edit'
$result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'"); $result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'");
$result = htmlentities_array($result); $result = htmlentities_array($result);
$mailbody = $result['value']; $mailbody = $result['value'];
$template_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_edit.php';
$template_edit_form = htmlform::genHTMLForm($template_edit_data);
$title = $template_edit_data['template_edit']['title'];
$image = $template_edit_data['template_edit']['image'];
eval("echo \"" . getTemplate("templates/templates_edit") . "\";"); eval("echo \"" . getTemplate("templates/templates_edit") . "\";");
} }
} }
} }
elseif($action == 'editf' elseif($action == 'edit'
&& $id != 0) && $id != 0)
{ {
//file templates //file templates
@@ -402,13 +372,6 @@ elseif($action == 'editf'
else else
{ {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$filetemplate_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_edit.php';
$filetemplate_edit_form = htmlform::genHTMLForm($filetemplate_edit_data);
$title = $filetemplate_edit_data['filetemplate_edit']['title'];
$image = $filetemplate_edit_data['filetemplate_edit']['image'];
eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";"); eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";");
} }
} }
@@ -418,3 +381,5 @@ elseif($action == 'editf'
exit; exit;
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -32,22 +32,6 @@ if(isset($_POST['id']))
elseif(isset($_GET['id'])) elseif(isset($_GET['id']))
{ {
$id = intval($_GET['id']); $id = intval($_GET['id']);
// only check if this is not a category-id
if (!isset($_GET['page']) || (isset($_GET['page']) && $_GET['page'] != 'categories')) {
if (!$userinfo['customers_see_all']) {
/*
* Check if the current user is allowed to see the current ticket.
*/
$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `adminid` = '".$userinfo['admindid']."'";
$result = $db->query_first($sql);
if ($result == null) {
// no rights to see the requested ticket
standard_error(array('ticketnotaccessible'));
}
}
}
} }
if($page == 'tickets' if($page == 'tickets'
@@ -118,20 +102,16 @@ if($page == 'tickets'
if($_cid != $row['customerid']) if($_cid != $row['customerid'])
{ {
$cid = $row['customerid']; $cid = $row['customerid'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '` $usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'); WHERE `customerid` = "' . (int)$cid . '"');
if(isset($usr['loginname'])) if(isset($usr['loginname'])) {
{ $customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
$customer = getCorrectFullUserDetails($usr); //$customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
$customerloginname = $usr['loginname']; } else {
$customerid = $usr['customerid'];
}
else
{
$customer = $lng['ticket']['nonexistingcustomer']; $customer = $lng['ticket']['nonexistingcustomer'];
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
} }
$tickets_count++; $tickets_count++;
@@ -166,7 +146,7 @@ if($page == 'tickets'
$row['subject'] = substr($row['subject'], 0, 17) . '...'; $row['subject'] = substr($row['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
$count++; $count++;
$_cid = $row['customerid']; $_cid = $row['customerid'];
} }
@@ -175,7 +155,7 @@ if($page == 'tickets'
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/tickets") . "\";"); eval("echo \"" . getTemplate("ticket/tickets") . "\";");
} }
elseif($action == 'new') elseif($action == 'new')
{ {
@@ -190,7 +170,7 @@ if($page == 'tickets'
$newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false); $newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
$newticket->Set('category', validate($_POST['category'], 'category'), true, false); $newticket->Set('category', validate($_POST['category'], 'category'), true, false);
$newticket->Set('customer', (int)$_POST['customer'], true, false); $newticket->Set('customer', (int)$_POST['customer'], true, false);
$newticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false); $newticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
if($newticket->Get('subject') == null) if($newticket->Get('subject') == null)
{ {
@@ -219,16 +199,12 @@ if($page == 'tickets'
else else
{ {
$categories = ''; $categories = '';
$where = ''; $result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
if ($userinfo['tickets_see_all'] != '1') {
$where = 'WHERE `adminid` = "' . $userinfo['adminid'] . '"';
}
$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');
if(isset($result['name']) if(isset($result['name'])
&& $result['name'] != '') && $result['name'] != '')
{ {
$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC'); $result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
while($row = $db->fetch_array($result2)) while($row = $db->fetch_array($result2))
{ {
@@ -248,17 +224,10 @@ if($page == 'tickets'
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']); $customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
} }
$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']); $priorities = makeoption($lng['ticket']['unf_high'], '1', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_normal'], '2', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_low'], '3', $settings['ticket']['default_priority']);
eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
$ticket_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_new.php';
$ticket_new_form = htmlform::genHTMLForm($ticket_new_data);
$title = $ticket_new_data['ticket_new']['title'];
$image = $ticket_new_data['ticket_new']['image'];
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
} }
} }
else else
@@ -275,7 +244,7 @@ if($page == 'tickets'
$replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1); $replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1);
$replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false); $replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
$replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false); $replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
$replyticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false); $replyticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
if($replyticket->Get('message') == null) if($replyticket->Get('message') == null)
{ {
@@ -326,25 +295,18 @@ if($page == 'tickets'
$isclosed = 1; $isclosed = 1;
} }
if ($mainticket->Get('by') == '1') if($mainticket->Get('by') == '1')
{ {
$by = $lng['ticket']['staff']; $by = $lng['ticket']['staff'];
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -361,19 +323,12 @@ if($page == 'tickets'
} }
else else
{ {
$cid = $subticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -383,13 +338,8 @@ if($page == 'tickets'
$ticket_replies_count = $db->num_rows($andere) + 1; $ticket_replies_count = $db->num_rows($andere) + 1;
// don't forget the main-ticket! // don't forget the main-ticket!
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_reply.php';
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
$title = $ticket_reply_data['ticket_reply']['title']; eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
$image = $ticket_reply_data['ticket_reply']['image'];
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
} }
} }
elseif($action == 'close' elseif($action == 'close'
@@ -475,16 +425,11 @@ elseif($page == 'categories'
'name' => $lng['ticket']['category'], 'name' => $lng['ticket']['category'],
'logicalorder' => $lng['ticket']['logicalorder'] 'logicalorder' => $lng['ticket']['logicalorder']
); );
$where = '1'; // WHERE 1 is like no 'where-clause'
if ($userinfo['tickets_see_all'] != '1') {
$where = " `main`.`adminid` = '" . (int)$userinfo['adminid'] . "'";
}
$paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, ( $result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, (
SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub` SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub`
WHERE `sub`.`category` = `main`.`id` WHERE `sub`.`category` = `main`.`id`
AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "') AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
as `ticketcount`, ( as `ticketcount`, (
SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2` SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2`
WHERE `sub2`.`category` = `main`.`id` WHERE `sub2`.`category` = `main`.`id`
@@ -492,7 +437,7 @@ elseif($page == 'categories'
AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2') AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2')
AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "' AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "'
) as `ticketcountnotclosed` ) as `ticketcountnotclosed`
FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE " . $where . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE `main`.`adminid` = '" . (int)$userinfo['adminid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -509,14 +454,14 @@ elseif($page == 'categories'
{ {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']); $closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']);
eval("\$ticketcategories.=\"" . getTemplate("tickets/tickets_categories") . "\";"); eval("\$ticketcategories.=\"" . getTemplate("ticket/tickets_categories") . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/categories") . "\";"); eval("echo \"" . getTemplate("ticket/categories") . "\";");
} }
elseif($action == 'addcategory') elseif($action == 'addcategory')
{ {
@@ -529,7 +474,7 @@ elseif($page == 'categories'
if($order < 1 || $order >= 1000) if($order < 1 || $order >= 1000)
{ {
// use the latest available // use the latest available
$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1; $order = ticket::getHighestOrderNumber($db) + 1;
} }
if($category == '') if($category == '')
@@ -545,15 +490,8 @@ elseif($page == 'categories'
} }
else else
{ {
$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1; $order = ticket::getHighestOrderNumber($db) + 1;
eval("echo \"" . getTemplate("ticket/tickets_newcategory") . "\";");
$category_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_new.php';
$category_new_form = htmlform::genHTMLForm($category_new_data);
$title = $category_new_data['category_new']['title'];
$image = $category_new_data['category_new']['image'];
eval("echo \"" . getTemplate("tickets/tickets_newcategory") . "\";");
} }
} }
elseif($action == 'editcategory' elseif($action == 'editcategory'
@@ -584,14 +522,7 @@ elseif($page == 'categories'
else else
{ {
$row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"'); $row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"');
eval("echo \"" . getTemplate("ticket/tickets_editcategory") . "\";");
$category_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_edit.php';
$category_edit_form = htmlform::genHTMLForm($category_edit_data);
$title = $category_edit_data['category_edit']['title'];
$image = $category_edit_data['category_edit']['image'];
eval("echo \"" . getTemplate("tickets/tickets_editcategory") . "\";");
} }
} }
elseif($action == 'deletecategory' elseif($action == 'deletecategory'
@@ -640,7 +571,8 @@ elseif($page == 'archive'
{ {
$categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : ''; $categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : '';
} }
$query = ticket::getArchiveSearchStatement($db, $subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
$query = ticket::getArchiveSearchStatement($subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
$fields = array( $fields = array(
'lastchange' => $lng['ticket']['lastchange'], 'lastchange' => $lng['ticket']['lastchange'],
'ticket_answers' => $lng['ticket']['ticket_answers'], 'ticket_answers' => $lng['ticket']['ticket_answers'],
@@ -698,39 +630,25 @@ elseif($page == 'archive'
{ {
if($paging->checkDisplay($i)) if($paging->checkDisplay($i))
{ {
$ticket = htmlentities_array($ticket);
$ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']); $ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']);
if($_cid != $ticket['customerid']) if($_cid != $ticket['customerid'])
{ {
$cid = $ticket['customerid']; $cid = $ticket['customerid'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '` $usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'); WHERE `customerid` = "' . (int)$cid . '"');
if(isset($usr['loginname'])) if(isset($usr['loginname'])) {
{ $customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
$customer = getCorrectFullUserDetails($usr); } else {
$customerloginname = $usr['loginname'];
$customerid = $usr['customerid'];
}
else
{
$customer = $lng['ticket']['nonexistingcustomer']; $customer = $lng['ticket']['nonexistingcustomer'];
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
} }
$tickets_count++; $tickets_count++;
switch ($ticket['priority'])
{
case 1: $ticket['display'] = 'high';
break;
case 2: $ticket['display'] = 'normal';
break;
case 3: $ticket['display'] = 'low';
break;
default: $ticket['display'] = 'unknown';
}
$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']); $ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);
if($ticket['lastreplier'] == '1') if($ticket['lastreplier'] == '1')
@@ -746,8 +664,8 @@ elseif($page == 'archive'
{ {
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...'; $ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
} }
$ticket = htmlentities_array($ticket);
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
$count++; $count++;
$_cid = $ticket['customerid']; $_cid = $ticket['customerid'];
} }
@@ -756,7 +674,7 @@ elseif($page == 'archive'
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/archivesearch") . "\";"); eval("echo \"" . getTemplate("ticket/archivesearch") . "\";");
} }
else else
{ {
@@ -785,13 +703,13 @@ elseif($page == 'archive'
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...'; $ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
} }
} }
$priorities_options = makecheckbox('priority1', $lng['ticket']['high'], '1'); $priorities_options = makecheckbox('priority1', $lng['ticket']['unf_high'], '1');
$priorities_options.= makecheckbox('priority2', $lng['ticket']['normal'], '2'); $priorities_options.= makecheckbox('priority2', $lng['ticket']['unf_normal'], '2');
$priorities_options.= makecheckbox('priority3', $lng['ticket']['low'], '3'); $priorities_options.= makecheckbox('priority3', $lng['ticket']['unf_low'], '3');
$category_options = ''; $category_options = '';
$ccount = 0; $ccount = 0;
$result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC'); $result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
@@ -810,7 +728,7 @@ elseif($page == 'archive'
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']); $customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
} }
eval("echo \"" . getTemplate("tickets/archive") . "\";"); eval("echo \"" . getTemplate("ticket/archive") . "\";");
} }
} }
elseif($action == 'view' elseif($action == 'view'
@@ -830,19 +748,12 @@ elseif($page == 'archive'
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -859,29 +770,23 @@ elseif($page == 'archive'
} }
else else
{ {
$cid = $subticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', htmlentities($mainticket->Get('priority')), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
$priorities.= makeoption($lng['ticket']['normal'], '2', htmlentities($mainticket->Get('priority')), true, true); $priorities.= makeoption($lng['ticket']['normal'], '2', $mainticket->Get('priority'), true, true);
$priorities.= makeoption($lng['ticket']['low'], '3', htmlentities($mainticket->Get('priority')), true, true); $priorities.= makeoption($lng['ticket']['low'], '3', $mainticket->Get('priority'), true, true);
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$ticket_replies_count = $db->num_rows($andere) + 1; $ticket_replies_count = $db->num_rows($andere) + 1;
// don't forget the main-ticket! // don't forget the main-ticket!
eval("echo \"" . getTemplate("tickets/tickets_view") . "\";");
eval("echo \"" . getTemplate("ticket/tickets_view") . "\";");
} }
elseif($action == 'delete' elseif($action == 'delete'
&& $id != 0) && $id != 0)
@@ -900,6 +805,6 @@ elseif($page == 'archive'
ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject')); ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
} }
} }
} else {
standard_error('nocustomerforticket');
} }
?>

View File

@@ -1,148 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Morton Jonuschat <m.jonuschat@chrome-it.de>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package Panel
*
*/
define('AREA', 'admin');
/**
* Include our init.php, which manages Sessions, Language etc.
*/
require ("./lib/init.php");
if($action == 'logout')
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['adminid'] . "' AND `adminsession` = '1'");
redirectTo('index.php');
exit;
}
if(isset($_POST['id']))
{
$id = intval($_POST['id']);
}
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']);
}
$months = array(
'0' => 'empty',
'1' => 'jan',
'2' => 'feb',
'3' => 'mar',
'4' => 'apr',
'5' => 'may',
'6' => 'jun',
'7' => 'jul',
'8' => 'aug',
'9' => 'sep',
'10' => 'oct',
'11' => 'nov',
'12' => 'dec',
);
if($page == 'overview' || $page == 'customers')
{
if($action == 'su' && $id != 0)
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$id . "' " . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' "));
if($result['loginname'] != '')
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "'");
$s = md5(uniqid(microtime(), 1));
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
redirectTo('customer_traffic.php', Array(
's' => $s
));
}
else
{
redirectTo('index.php', Array(
'action' => 'login'
));
}
}
$customerview = 1;
$stats_tables = '';
$minyear = $db->query_first("SELECT `year` FROM `". TABLE_PANEL_TRAFFIC . "` ORDER BY `year` ASC LIMIT 1");
if (!isset($minyear['year']) || $minyear['year'] == 0)
{
$maxyears = 0;
}
else
{
$maxyears = date("Y") - $minyear['year'];
}
for($years = 0; $years<=$maxyears; $years++) {
$overview['year'] = date("Y")-$years;
$overview['type'] = $lng['traffic']['customer'];
$domain_list = '';
$customer_name_list = $db->query("SELECT `customerid`,`company`,`name`,`firstname` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' ") . " ORDER BY name");
$totals = array(
'jan' => 0,
'feb' => 0,
'mar' => 0,
'apr' => 0,
'may' => 0,
'jun' => 0,
'jul' => 0,
'aug' => 0,
'sep' => 0,
'oct' => 0,
'nov' => 0,
'dec' => 0,
);
while($customer_name = $db->fetch_array($customer_name_list)) {
$virtual_host = array(
'name' => ($customer_name['company'] == '' ? $customer_name['name'] . ", " . $customer_name['firstname'] : $customer_name['company']),
'customerid' => $customer_name['customerid'],
'jan' => '-',
'feb' => '-',
'mar' => '-',
'apr' => '-',
'may' => '-',
'jun' => '-',
'jul' => '-',
'aug' => '-',
'sep' => '-',
'oct' => '-',
'nov' => '-',
'dec' => '-',
);
$traffic_list = $db->query("SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE year = " . (date("Y")-$years) . " AND `customerid` = '" . $customer_name['customerid'] . "' GROUP BY month ORDER BY month");
while($traffic_month = $db->fetch_array($traffic_list)) {
$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s');
$totals[$months[(int)$traffic_month['month']]] += $traffic_month['traffic'];
}
eval("\$domain_list .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
}
// sum up totals
$virtual_host = array(
'name' => $lng['traffic']['months']['total'],
);
foreach($totals as $month => $bytes) {
$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s'));
}
$customerview = 0;
eval("\$total_list = sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
eval("\$stats_tables .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table") . "\");");
}
eval("echo \"" . getTemplate("traffic/index") . "\";");
}

View File

@@ -12,13 +12,14 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
require('./lib/init.php'); require ("./lib/init.php");
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates"); $log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates");
/** /**
@@ -28,13 +29,13 @@ if ($page == 'overview') {
*/ */
if (!isFroxlor()) { if (!isFroxlor()) {
if (!isset($settings['panel']['version']) if (!isset($settings['panel']['version'])
|| $settings['panel']['version'] == '' || $settings['panel']['version'] == ''
) { ) {
$settings['panel']['version'] = '1.4.2.1'; $settings['panel']['version'] = '1.4.2.1';
$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')"); $db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')");
} }
if (!isset($settings['system']['dbversion']) if (!isset($settings['system']['dbversion'])
|| $settings['system']['dbversion'] == '' || $settings['system']['dbversion'] == ''
) { ) {
/** /**
* for syscp-stable (1.4.2.1) this value has to be 0 * for syscp-stable (1.4.2.1) this value has to be 0
@@ -42,9 +43,11 @@ if ($page == 'overview') {
* and the svn-version has its value in the database * and the svn-version has its value in the database
* -> bug #54 * -> bug #54
*/ */
$result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'"); $result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'");
if (isset($result['value'])) { if(isset($result['value']))
{
$settings['system']['dbversion'] = (int)$result['value']; $settings['system']['dbversion'] = (int)$result['value'];
} else { } else {
$settings['system']['dbversion'] = 0; $settings['system']['dbversion'] = 0;
@@ -52,36 +55,40 @@ if ($page == 'overview') {
} }
} }
if (hasUpdates($version)) { if(hasUpdates($version))
{
$successful_update = false; $successful_update = false;
$message = ''; $message = '';
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
if ((isset($_POST['update_preconfig']) if((isset($_POST['update_preconfig'])
&& isset($_POST['update_changesagreed']) && isset($_POST['update_changesagreed'])
&& intval($_POST['update_changesagreed']) != 0) && intval($_POST['update_changesagreed']) != 0)
|| !isset($_POST['update_preconfig']) || !isset($_POST['update_preconfig'])
) { ) {
eval("echo \"" . getTemplate('update/update_start') . "\";"); eval("echo \"" . getTemplate("update/update_start") . "\";");
include_once './install/updatesql.php'; include_once './install/updatesql.php';
$redirect_url = 'admin_index.php?s=' . $s; $redirect_url = 'admin_index.php?s=' . $s;
eval("echo \"" . getTemplate('update/update_end') . "\";"); eval("echo \"" . getTemplate("update/update_end") . "\";");
updateCounters(); updateCounters();
inserttask('1'); inserttask('1');
@chmod('./lib/userdata.inc.php', 0440); @chmod('./lib/userdata.inc.php', 0440);
$successful_update = true; $successful_update = true;
} else { }
$message = '<br /><strong style="color: red">You have to agree that you have read the update notifications.</strong>'; else
{
$message = '<br /><strong style="color:#ff0000;">You have to agree that you have read the update notifications.</strong>';
} }
} }
if (!$successful_update) { if(!$successful_update)
{
$current_version = $settings['panel']['version']; $current_version = $settings['panel']['version'];
$new_version = $version; $new_version = $version;
@@ -92,20 +99,26 @@ if ($page == 'overview') {
include_once './install/updates/preconfig.php'; include_once './install/updates/preconfig.php';
$preconfig = getPreConfig($current_version); $preconfig = getPreConfig($current_version);
if ($preconfig != '') { if($preconfig != '')
$update_information .= '<br />' . $preconfig . $message; {
$update_information .= '<br />'.$preconfig.$message;
} }
$update_information .= $lng['update']['update_information']['part_b']; $update_information .= $lng['update']['update_information']['part_b'];
eval("echo \"" . getTemplate('update/index') . "\";"); eval("echo \"" . getTemplate("update/index") . "\";");
} }
} else { }
else
{
/* /*
* @TODO version-webcheck check here * @TODO version-webcheck check here
*/ */
$success_message = $lng['update']['noupdatesavail']; $success_message = $lng['update']['noupdatesavail'];
$redirect_url = 'admin_index.php?s=' . $s; $redirect_url = 'admin_index.php?s=' . $s;
eval("echo \"" . getTemplate('update/noupdatesavail') . "\";"); eval("echo \"" . getTemplate("update/noupdatesavail") . "\";");
} }
} }
?>

1
cache/.gitignore vendored
View File

@@ -1 +0,0 @@
*

0
cache/.keep vendored
View File

View File

@@ -1,226 +0,0 @@
/*rules for the plot target div. These will be cascaded down to all plot elements according to css rules*/
.jqplot-target {
position: relative;
color: #666666;
font-family: "Trebuchet MS", Arial, Helvetica, sans-serif;
font-size: 1em;
/* height: 300px;
width: 400px;*/
}
/*rules applied to all axes*/
.jqplot-axis {
font-size: 0.75em;
}
.jqplot-xaxis {
margin-top: 10px;
}
.jqplot-x2axis {
margin-bottom: 10px;
}
.jqplot-yaxis {
margin-right: 10px;
}
.jqplot-y2axis, .jqplot-y3axis, .jqplot-y4axis, .jqplot-y5axis, .jqplot-y6axis, .jqplot-y7axis, .jqplot-y8axis, .jqplot-y9axis {
margin-left: 10px;
margin-right: 10px;
}
/*rules applied to all axis tick divs*/
.jqplot-axis-tick, .jqplot-xaxis-tick, .jqplot-yaxis-tick, .jqplot-x2axis-tick, .jqplot-y2axis-tick, .jqplot-y3axis-tick, .jqplot-y4axis-tick, .jqplot-y5axis-tick, .jqplot-y6axis-tick, .jqplot-y7axis-tick, .jqplot-y8axis-tick, .jqplot-y9axis-tick {
position: absolute;
}
.jqplot-xaxis-tick {
top: 0px;
/* initial position untill tick is drawn in proper place */
left: 15px;
/* padding-top: 10px;*/
vertical-align: top;
}
.jqplot-x2axis-tick {
bottom: 0px;
/* initial position untill tick is drawn in proper place */
left: 15px;
/* padding-bottom: 10px;*/
vertical-align: bottom;
}
.jqplot-yaxis-tick {
right: 0px;
/* initial position untill tick is drawn in proper place */
top: 15px;
/* padding-right: 10px;*/
text-align: right;
}
.jqplot-yaxis-tick.jqplot-breakTick {
right: -20px;
margin-right: 0px;
padding:1px 5px 1px 5px;
/* background-color: white;*/
z-index: 2;
font-size: 1.5em;
}
.jqplot-y2axis-tick, .jqplot-y3axis-tick, .jqplot-y4axis-tick, .jqplot-y5axis-tick, .jqplot-y6axis-tick, .jqplot-y7axis-tick, .jqplot-y8axis-tick, .jqplot-y9axis-tick {
left: 0px;
/* initial position untill tick is drawn in proper place */
top: 15px;
/* padding-left: 10px;*/
/* padding-right: 15px;*/
text-align: left;
}
.jqplot-meterGauge-tick {
font-size: 0.75em;
color: #999999;
}
.jqplot-meterGauge-label {
font-size: 1em;
color: #999999;
}
.jqplot-xaxis-label {
margin-top: 10px;
font-size: 11pt;
position: absolute;
}
.jqplot-x2axis-label {
margin-bottom: 10px;
font-size: 11pt;
position: absolute;
}
.jqplot-yaxis-label {
margin-right: 10px;
/* text-align: center;*/
font-size: 11pt;
position: absolute;
}
.jqplot-y2axis-label, .jqplot-y3axis-label, .jqplot-y4axis-label, .jqplot-y5axis-label, .jqplot-y6axis-label, .jqplot-y7axis-label, .jqplot-y8axis-label, .jqplot-y9axis-label {
/* text-align: center;*/
font-size: 11pt;
position: absolute;
}
table.jqplot-table-legend {
margin-top: 12px;
margin-bottom: 12px;
margin-left: 12px;
margin-right: 12px;
}
table.jqplot-table-legend, table.jqplot-cursor-legend {
background-color: rgba(255,255,255,0.6);
border: 1px solid #cccccc;
position: absolute;
font-size: 0.75em;
}
td.jqplot-table-legend {
vertical-align:middle;
}
td.jqplot-seriesToggle:hover, td.jqplot-seriesToggle:active {
cursor: pointer;
}
td.jqplot-table-legend > div {
border: 1px solid #cccccc;
padding:1px;
}
div.jqplot-table-legend-swatch {
width:0px;
height:0px;
border-top-width: 5px;
border-bottom-width: 5px;
border-left-width: 6px;
border-right-width: 6px;
border-top-style: solid;
border-bottom-style: solid;
border-left-style: solid;
border-right-style: solid;
}
.jqplot-title {
top: 0px;
left: 0px;
padding-bottom: 0.5em;
font-size: 1.2em;
}
table.jqplot-cursor-tooltip {
border: 1px solid #cccccc;
font-size: 0.75em;
}
.jqplot-cursor-tooltip {
border: 1px solid #cccccc;
font-size: 0.75em;
white-space: nowrap;
background: rgba(208,208,208,0.5);
padding: 1px;
}
.jqplot-highlighter-tooltip {
border: 1px solid #cccccc;
font-size: 0.75em;
white-space: nowrap;
background: rgba(208,208,208,0.5);
padding: 1px;
}
.jqplot-point-label {
font-size: 0.75em;
z-index: 2;
}
td.jqplot-cursor-legend-swatch {
vertical-align:middle;
text-align:center;
}
div.jqplot-cursor-legend-swatch {
width:1.2em;
height:0.7em;
}
.jqplot-error {
/* Styles added to the plot target container when there is an error go here.*/
text-align: center;
}
.jqplot-error-message {
/* Styling of the custom error message div goes here.*/
position: relative;
top: 46%;
display: inline-block;
}
div.jqplot-bubble-label {
font-size: 0.8em;
/* background: rgba(90%, 90%, 90%, 0.15);*/
padding-left: 2px;
padding-right: 2px;
color: rgb(20%, 20%, 20%);
}
div.jqplot-bubble-label.jqplot-bubble-label-highlight {
background: rgba(90%, 90%, 90%, 0.7);
}
div.jqplot-noData-container {
text-align: center;
background-color: rgba(96%, 96%, 96%, 0.3);
}

View File

@@ -1 +0,0 @@
.jqplot-target{position:relative;color:#666;font-family:"Trebuchet MS",Arial,Helvetica,sans-serif;font-size:1em;}.jqplot-axis{font-size:.75em;}.jqplot-xaxis{margin-top:10px;}.jqplot-x2axis{margin-bottom:10px;}.jqplot-yaxis{margin-right:10px;}.jqplot-y2axis,.jqplot-y3axis,.jqplot-y4axis,.jqplot-y5axis,.jqplot-y6axis,.jqplot-y7axis,.jqplot-y8axis,.jqplot-y9axis{margin-left:10px;margin-right:10px;}.jqplot-axis-tick,.jqplot-xaxis-tick,.jqplot-yaxis-tick,.jqplot-x2axis-tick,.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{position:absolute;}.jqplot-xaxis-tick{top:0;left:15px;vertical-align:top;}.jqplot-x2axis-tick{bottom:0;left:15px;vertical-align:bottom;}.jqplot-yaxis-tick{right:0;top:15px;text-align:right;}.jqplot-yaxis-tick.jqplot-breakTick{right:-20px;margin-right:0;padding:1px 5px 1px 5px;z-index:2;font-size:1.5em;}.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{left:0;top:15px;text-align:left;}.jqplot-meterGauge-tick{font-size:.75em;color:#999;}.jqplot-meterGauge-label{font-size:1em;color:#999;}.jqplot-xaxis-label{margin-top:10px;font-size:11pt;position:absolute;}.jqplot-x2axis-label{margin-bottom:10px;font-size:11pt;position:absolute;}.jqplot-yaxis-label{margin-right:10px;font-size:11pt;position:absolute;}.jqplot-y2axis-label,.jqplot-y3axis-label,.jqplot-y4axis-label,.jqplot-y5axis-label,.jqplot-y6axis-label,.jqplot-y7axis-label,.jqplot-y8axis-label,.jqplot-y9axis-label{font-size:11pt;position:absolute;}table.jqplot-table-legend{margin-top:12px;margin-bottom:12px;margin-left:12px;margin-right:12px;}table.jqplot-table-legend,table.jqplot-cursor-legend{background-color:rgba(255,255,255,0.6);border:1px solid #ccc;position:absolute;font-size:.75em;}td.jqplot-table-legend{vertical-align:middle;}td.jqplot-seriesToggle:hover,td.jqplot-seriesToggle:active{cursor:pointer;}td.jqplot-table-legend>div{border:1px solid #ccc;padding:1px;}div.jqplot-table-legend-swatch{width:0;height:0;border-top-width:5px;border-bottom-width:5px;border-left-width:6px;border-right-width:6px;border-top-style:solid;border-bottom-style:solid;border-left-style:solid;border-right-style:solid;}.jqplot-title{top:0;left:0;padding-bottom:.5em;font-size:1.2em;}table.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;}.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px;}.jqplot-highlighter-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px;}.jqplot-point-label{font-size:.75em;z-index:2;}td.jqplot-cursor-legend-swatch{vertical-align:middle;text-align:center;}div.jqplot-cursor-legend-swatch{width:1.2em;height:.7em;}.jqplot-error{text-align:center;}.jqplot-error-message{position:relative;top:46%;display:inline-block;}div.jqplot-bubble-label{font-size:.8em;padding-left:2px;padding-right:2px;color:rgb(20%,20%,20%);}div.jqplot-bubble-label.jqplot-bubble-label-highlight{background:rgba(90%,90%,90%,0.7);}div.jqplot-noData-container{text-align:center;background-color:rgba(96%,96%,96%,0.3);}

View File

@@ -1,563 +0,0 @@
/*
* jQuery UI CSS Framework 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Theming/API
*/
/* Layout helpers
----------------------------------*/
.ui-helper-hidden { display: none; }
.ui-helper-hidden-accessible { position: absolute !important; clip: rect(1px 1px 1px 1px); clip: rect(1px,1px,1px,1px); }
.ui-helper-reset { margin: 0; padding: 0; border: 0; outline: 0; line-height: 1.3; text-decoration: none; font-size: 100%; list-style: none; }
.ui-helper-clearfix:before, .ui-helper-clearfix:after { content: ""; display: table; }
.ui-helper-clearfix:after { clear: both; }
.ui-helper-clearfix { zoom: 1; }
.ui-helper-zfix { width: 100%; height: 100%; top: 0; left: 0; position: absolute; opacity: 0; filter:Alpha(Opacity=0); }
/* Interaction Cues
----------------------------------*/
.ui-state-disabled { cursor: default !important; }
/* Icons
----------------------------------*/
/* states and images */
.ui-icon { display: block; text-indent: -99999px; overflow: hidden; background-repeat: no-repeat; }
/* Misc visuals
----------------------------------*/
/* Overlays */
.ui-widget-overlay { position: absolute; top: 0; left: 0; width: 100%; height: 100%; }
/*
* jQuery UI Accordion 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Accordion#theming
*/
/* IE/Win - Fix animation bug - #4615 */
.ui-accordion { width: 100%; }
.ui-accordion .ui-accordion-header { cursor: pointer; position: relative; margin-top: 1px; zoom: 1; }
.ui-accordion .ui-accordion-li-fix { display: inline; }
.ui-accordion .ui-accordion-header-active { border-bottom: 0 !important; }
.ui-accordion .ui-accordion-header a { display: block; font-size: 1em; padding: .5em .5em .5em .7em; }
.ui-accordion-icons .ui-accordion-header a { padding-left: 2.2em; }
.ui-accordion .ui-accordion-header .ui-icon { position: absolute; left: .5em; top: 50%; margin-top: -8px; }
.ui-accordion .ui-accordion-content { padding: 1em 2.2em; border-top: 0; margin-top: -2px; position: relative; top: 1px; margin-bottom: 2px; overflow: auto; display: none; zoom: 1; }
.ui-accordion .ui-accordion-content-active { display: block; }
/*
* jQuery UI Autocomplete 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Autocomplete#theming
*/
.ui-autocomplete { position: absolute; cursor: default; }
/* workarounds */
* html .ui-autocomplete { width:1px; } /* without this, the menu expands to 100% in IE6 */
/*
* jQuery UI Menu 1.8.17
*
* Copyright 2010, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Menu#theming
*/
.ui-menu {
list-style:none;
padding: 2px;
margin: 0;
display:block;
float: left;
}
.ui-menu .ui-menu {
margin-top: -3px;
}
.ui-menu .ui-menu-item {
margin:0;
padding: 0;
zoom: 1;
float: left;
clear: left;
width: 100%;
}
.ui-menu .ui-menu-item a {
text-decoration:none;
display:block;
padding:.2em .4em;
line-height:1.5;
zoom:1;
}
.ui-menu .ui-menu-item a.ui-state-hover,
.ui-menu .ui-menu-item a.ui-state-active {
font-weight: normal;
margin: -1px;
}
/*
* jQuery UI Button 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Button#theming
*/
.ui-button { display: inline-block; position: relative; padding: 0; margin-right: .1em; text-decoration: none !important; cursor: pointer; text-align: center; zoom: 1; overflow: visible; } /* the overflow property removes extra width in IE */
.ui-button-icon-only { width: 2.2em; } /* to make room for the icon, a width needs to be set here */
button.ui-button-icon-only { width: 2.4em; } /* button elements seem to need a little more width */
.ui-button-icons-only { width: 3.4em; }
button.ui-button-icons-only { width: 3.7em; }
/*button text element */
.ui-button .ui-button-text { display: block; line-height: 1.4; }
.ui-button-text-only .ui-button-text { padding: .4em 1em; }
.ui-button-icon-only .ui-button-text, .ui-button-icons-only .ui-button-text { padding: .4em; text-indent: -9999999px; }
.ui-button-text-icon-primary .ui-button-text, .ui-button-text-icons .ui-button-text { padding: .4em 1em .4em 2.1em; }
.ui-button-text-icon-secondary .ui-button-text, .ui-button-text-icons .ui-button-text { padding: .4em 2.1em .4em 1em; }
.ui-button-text-icons .ui-button-text { padding-left: 2.1em; padding-right: 2.1em; }
/* no icon support for input elements, provide padding by default */
input.ui-button { padding: .4em 1em; }
/*button icon element(s) */
.ui-button-icon-only .ui-icon, .ui-button-text-icon-primary .ui-icon, .ui-button-text-icon-secondary .ui-icon, .ui-button-text-icons .ui-icon, .ui-button-icons-only .ui-icon { position: absolute; top: 50%; margin-top: -8px; }
.ui-button-icon-only .ui-icon { left: 50%; margin-left: -8px; }
.ui-button-text-icon-primary .ui-button-icon-primary, .ui-button-text-icons .ui-button-icon-primary, .ui-button-icons-only .ui-button-icon-primary { left: .5em; }
.ui-button-text-icon-secondary .ui-button-icon-secondary, .ui-button-text-icons .ui-button-icon-secondary, .ui-button-icons-only .ui-button-icon-secondary { right: .5em; }
.ui-button-text-icons .ui-button-icon-secondary, .ui-button-icons-only .ui-button-icon-secondary { right: .5em; }
/*button sets*/
.ui-buttonset { margin-right: 7px; }
.ui-buttonset .ui-button { margin-left: 0; margin-right: -.3em; }
/* workarounds */
button.ui-button::-moz-focus-inner { border: 0; padding: 0; } /* reset extra padding in Firefox */
/*
* jQuery UI Datepicker 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Datepicker#theming
*/
.ui-datepicker { width: 17em; padding: .2em .2em 0; display: none; }
.ui-datepicker .ui-datepicker-header { position:relative; padding:.2em 0; }
.ui-datepicker .ui-datepicker-prev, .ui-datepicker .ui-datepicker-next { position:absolute; top: 2px; width: 1.8em; height: 1.8em; }
.ui-datepicker .ui-datepicker-prev-hover, .ui-datepicker .ui-datepicker-next-hover { top: 1px; }
.ui-datepicker .ui-datepicker-prev { left:2px; }
.ui-datepicker .ui-datepicker-next { right:2px; }
.ui-datepicker .ui-datepicker-prev-hover { left:1px; }
.ui-datepicker .ui-datepicker-next-hover { right:1px; }
.ui-datepicker .ui-datepicker-prev span, .ui-datepicker .ui-datepicker-next span { display: block; position: absolute; left: 50%; margin-left: -8px; top: 50%; margin-top: -8px; }
.ui-datepicker .ui-datepicker-title { margin: 0 2.3em; line-height: 1.8em; text-align: center; }
.ui-datepicker .ui-datepicker-title select { font-size:1em; margin:1px 0; }
.ui-datepicker select.ui-datepicker-month-year {width: 100%;}
.ui-datepicker select.ui-datepicker-month,
.ui-datepicker select.ui-datepicker-year { width: 49%;}
.ui-datepicker table {width: 100%; font-size: .9em; border-collapse: collapse; margin:0 0 .4em; }
.ui-datepicker th { padding: .7em .3em; text-align: center; font-weight: bold; border: 0; }
.ui-datepicker td { border: 0; padding: 1px; }
.ui-datepicker td span, .ui-datepicker td a { display: block; padding: .2em; text-align: right; text-decoration: none; }
.ui-datepicker .ui-datepicker-buttonpane { background-image: none; margin: .7em 0 0 0; padding:0 .2em; border-left: 0; border-right: 0; border-bottom: 0; }
.ui-datepicker .ui-datepicker-buttonpane button { float: right; margin: .5em .2em .4em; cursor: pointer; padding: .2em .6em .3em .6em; width:auto; overflow:visible; }
.ui-datepicker .ui-datepicker-buttonpane button.ui-datepicker-current { float:left; }
/* with multiple calendars */
.ui-datepicker.ui-datepicker-multi { width:auto; }
.ui-datepicker-multi .ui-datepicker-group { float:left; }
.ui-datepicker-multi .ui-datepicker-group table { width:95%; margin:0 auto .4em; }
.ui-datepicker-multi-2 .ui-datepicker-group { width:50%; }
.ui-datepicker-multi-3 .ui-datepicker-group { width:33.3%; }
.ui-datepicker-multi-4 .ui-datepicker-group { width:25%; }
.ui-datepicker-multi .ui-datepicker-group-last .ui-datepicker-header { border-left-width:0; }
.ui-datepicker-multi .ui-datepicker-group-middle .ui-datepicker-header { border-left-width:0; }
.ui-datepicker-multi .ui-datepicker-buttonpane { clear:left; }
.ui-datepicker-row-break { clear:both; width:100%; font-size:0em; }
/* RTL support */
.ui-datepicker-rtl { direction: rtl; }
.ui-datepicker-rtl .ui-datepicker-prev { right: 2px; left: auto; }
.ui-datepicker-rtl .ui-datepicker-next { left: 2px; right: auto; }
.ui-datepicker-rtl .ui-datepicker-prev:hover { right: 1px; left: auto; }
.ui-datepicker-rtl .ui-datepicker-next:hover { left: 1px; right: auto; }
.ui-datepicker-rtl .ui-datepicker-buttonpane { clear:right; }
.ui-datepicker-rtl .ui-datepicker-buttonpane button { float: left; }
.ui-datepicker-rtl .ui-datepicker-buttonpane button.ui-datepicker-current { float:right; }
.ui-datepicker-rtl .ui-datepicker-group { float:right; }
.ui-datepicker-rtl .ui-datepicker-group-last .ui-datepicker-header { border-right-width:0; border-left-width:1px; }
.ui-datepicker-rtl .ui-datepicker-group-middle .ui-datepicker-header { border-right-width:0; border-left-width:1px; }
/* IE6 IFRAME FIX (taken from datepicker 1.5.3 */
.ui-datepicker-cover {
display: none; /*sorry for IE5*/
display/**/: block; /*sorry for IE5*/
position: absolute; /*must have*/
z-index: -1; /*must have*/
filter: mask(); /*must have*/
top: -4px; /*must have*/
left: -4px; /*must have*/
width: 200px; /*must have*/
height: 200px; /*must have*/
}/*
* jQuery UI Dialog 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Dialog#theming
*/
.ui-dialog { position: absolute; padding: .2em; width: 300px; overflow: hidden; }
.ui-dialog .ui-dialog-titlebar { padding: .4em 1em; position: relative; }
.ui-dialog .ui-dialog-title { float: left; margin: .1em 16px .1em 0; }
.ui-dialog .ui-dialog-titlebar-close { position: absolute; right: .3em; top: 50%; width: 19px; margin: -10px 0 0 0; padding: 1px; height: 18px; }
.ui-dialog .ui-dialog-titlebar-close span { display: block; margin: 1px; }
.ui-dialog .ui-dialog-titlebar-close:hover, .ui-dialog .ui-dialog-titlebar-close:focus { padding: 0; }
.ui-dialog .ui-dialog-content { position: relative; border: 0; padding: .5em 1em; background: none; overflow: auto; zoom: 1; }
.ui-dialog .ui-dialog-buttonpane { text-align: left; border-width: 1px 0 0 0; background-image: none; margin: .5em 0 0 0; padding: .3em 1em .5em .4em; }
.ui-dialog .ui-dialog-buttonpane .ui-dialog-buttonset { float: right; }
.ui-dialog .ui-dialog-buttonpane button { margin: .5em .4em .5em 0; cursor: pointer; }
.ui-dialog .ui-resizable-se { width: 14px; height: 14px; right: 3px; bottom: 3px; }
.ui-draggable .ui-dialog-titlebar { cursor: move; }
/*
* jQuery UI Progressbar 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Progressbar#theming
*/
.ui-progressbar { height:2em; text-align: left; overflow: hidden; }
.ui-progressbar .ui-progressbar-value {margin: -1px; height:100%; }/*
* jQuery UI Resizable 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Resizable#theming
*/
.ui-resizable { position: relative;}
.ui-resizable-handle { position: absolute;font-size: 0.1px;z-index: 99999; display: block; }
.ui-resizable-disabled .ui-resizable-handle, .ui-resizable-autohide .ui-resizable-handle { display: none; }
.ui-resizable-n { cursor: n-resize; height: 7px; width: 100%; top: -5px; left: 0; }
.ui-resizable-s { cursor: s-resize; height: 7px; width: 100%; bottom: -5px; left: 0; }
.ui-resizable-e { cursor: e-resize; width: 7px; right: -5px; top: 0; height: 100%; }
.ui-resizable-w { cursor: w-resize; width: 7px; left: -5px; top: 0; height: 100%; }
.ui-resizable-se { cursor: se-resize; width: 12px; height: 12px; right: 1px; bottom: 1px; }
.ui-resizable-sw { cursor: sw-resize; width: 9px; height: 9px; left: -5px; bottom: -5px; }
.ui-resizable-nw { cursor: nw-resize; width: 9px; height: 9px; left: -5px; top: -5px; }
.ui-resizable-ne { cursor: ne-resize; width: 9px; height: 9px; right: -5px; top: -5px;}/*
* jQuery UI Selectable 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Selectable#theming
*/
.ui-selectable-helper { position: absolute; z-index: 100; border:1px dotted black; }
/*
* jQuery UI Slider 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Slider#theming
*/
.ui-slider { position: relative; text-align: left; }
.ui-slider .ui-slider-handle { position: absolute; z-index: 2; width: 1.2em; height: 1.2em; cursor: default; }
.ui-slider .ui-slider-range { position: absolute; z-index: 1; font-size: .7em; display: block; border: 0; background-position: 0 0; }
.ui-slider-horizontal { height: .8em; }
.ui-slider-horizontal .ui-slider-handle { top: -.3em; margin-left: -.6em; }
.ui-slider-horizontal .ui-slider-range { top: 0; height: 100%; }
.ui-slider-horizontal .ui-slider-range-min { left: 0; }
.ui-slider-horizontal .ui-slider-range-max { right: 0; }
.ui-slider-vertical { width: .8em; height: 100px; }
.ui-slider-vertical .ui-slider-handle { left: -.3em; margin-left: 0; margin-bottom: -.6em; }
.ui-slider-vertical .ui-slider-range { left: 0; width: 100%; }
.ui-slider-vertical .ui-slider-range-min { bottom: 0; }
.ui-slider-vertical .ui-slider-range-max { top: 0; }/*
* jQuery UI Tabs 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Tabs#theming
*/
.ui-tabs { position: relative; padding: .2em; zoom: 1; } /* position: relative prevents IE scroll bug (element with position: relative inside container with overflow: auto appear as "fixed") */
.ui-tabs .ui-tabs-nav { margin: 0; padding: .2em .2em 0; }
.ui-tabs .ui-tabs-nav li { list-style: none; float: left; position: relative; top: 1px; margin: 0 .2em 1px 0; border-bottom: 0 !important; padding: 0; white-space: nowrap; }
.ui-tabs .ui-tabs-nav li a { float: left; padding: .5em 1em; text-decoration: none; }
.ui-tabs .ui-tabs-nav li.ui-tabs-selected { margin-bottom: 0; padding-bottom: 1px; }
.ui-tabs .ui-tabs-nav li.ui-tabs-selected a, .ui-tabs .ui-tabs-nav li.ui-state-disabled a, .ui-tabs .ui-tabs-nav li.ui-state-processing a { cursor: text; }
.ui-tabs .ui-tabs-nav li a, .ui-tabs.ui-tabs-collapsible .ui-tabs-nav li.ui-tabs-selected a { cursor: pointer; } /* first selector in group seems obsolete, but required to overcome bug in Opera applying cursor: text overall if defined elsewhere... */
.ui-tabs .ui-tabs-panel { display: block; border-width: 0; padding: 1em 1.4em; background: none; }
.ui-tabs .ui-tabs-hide { display: none !important; }
/*
* jQuery UI CSS Framework 1.8.17
*
* Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
* Dual licensed under the MIT or GPL Version 2 licenses.
* http://jquery.org/license
*
* http://docs.jquery.com/UI/Theming/API
*
* To view and modify this theme, visit http://jqueryui.com/themeroller/
*/
/* Component containers
----------------------------------*/
.ui-widget { font-family: Verdana,Arial,sans-serif/*{ffDefault}*/; font-size: 1.1em/*{fsDefault}*/; }
.ui-widget .ui-widget { font-size: 1em; }
.ui-widget input, .ui-widget select, .ui-widget textarea, .ui-widget button { font-family: Verdana,Arial,sans-serif/*{ffDefault}*/; font-size: 1em; }
.ui-widget-content { border: 1px solid #aaaaaa/*{borderColorContent}*/; background: #ffffff/*{bgColorContent}*/ url(images/ui-bg_flat_75_ffffff_40x100.png)/*{bgImgUrlContent}*/ 50%/*{bgContentXPos}*/ 50%/*{bgContentYPos}*/ repeat-x/*{bgContentRepeat}*/; color: #222222/*{fcContent}*/; }
.ui-widget-content a { color: #222222/*{fcContent}*/; }
.ui-widget-header { border: 1px solid #aaaaaa/*{borderColorHeader}*/; background: #cccccc/*{bgColorHeader}*/ url(images/ui-bg_highlight-soft_75_cccccc_1x100.png)/*{bgImgUrlHeader}*/ 50%/*{bgHeaderXPos}*/ 50%/*{bgHeaderYPos}*/ repeat-x/*{bgHeaderRepeat}*/; color: #222222/*{fcHeader}*/; font-weight: bold; }
.ui-widget-header a { color: #222222/*{fcHeader}*/; }
/* Interaction states
----------------------------------*/
.ui-state-default, .ui-widget-content .ui-state-default, .ui-widget-header .ui-state-default { border: 1px solid #d3d3d3/*{borderColorDefault}*/; background: #e6e6e6/*{bgColorDefault}*/ url(images/ui-bg_glass_75_e6e6e6_1x400.png)/*{bgImgUrlDefault}*/ 50%/*{bgDefaultXPos}*/ 50%/*{bgDefaultYPos}*/ repeat-x/*{bgDefaultRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #555555/*{fcDefault}*/; }
.ui-state-default a, .ui-state-default a:link, .ui-state-default a:visited { color: #555555/*{fcDefault}*/; text-decoration: none; }
.ui-state-hover, .ui-widget-content .ui-state-hover, .ui-widget-header .ui-state-hover, .ui-state-focus, .ui-widget-content .ui-state-focus, .ui-widget-header .ui-state-focus { border: 1px solid #999999/*{borderColorHover}*/; background: #dadada/*{bgColorHover}*/ url(images/ui-bg_glass_75_dadada_1x400.png)/*{bgImgUrlHover}*/ 50%/*{bgHoverXPos}*/ 50%/*{bgHoverYPos}*/ repeat-x/*{bgHoverRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #212121/*{fcHover}*/; }
.ui-state-hover a, .ui-state-hover a:hover { color: #212121/*{fcHover}*/; text-decoration: none; }
.ui-state-active, .ui-widget-content .ui-state-active, .ui-widget-header .ui-state-active { border: 1px solid #aaaaaa/*{borderColorActive}*/; background: #ffffff/*{bgColorActive}*/ url(images/ui-bg_glass_65_ffffff_1x400.png)/*{bgImgUrlActive}*/ 50%/*{bgActiveXPos}*/ 50%/*{bgActiveYPos}*/ repeat-x/*{bgActiveRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #212121/*{fcActive}*/; }
.ui-state-active a, .ui-state-active a:link, .ui-state-active a:visited { color: #212121/*{fcActive}*/; text-decoration: none; }
.ui-widget :active { outline: none; }
/* Interaction Cues
----------------------------------*/
.ui-state-highlight, .ui-widget-content .ui-state-highlight, .ui-widget-header .ui-state-highlight {border: 1px solid #fcefa1/*{borderColorHighlight}*/; background: #fbf9ee/*{bgColorHighlight}*/ url(images/ui-bg_glass_55_fbf9ee_1x400.png)/*{bgImgUrlHighlight}*/ 50%/*{bgHighlightXPos}*/ 50%/*{bgHighlightYPos}*/ repeat-x/*{bgHighlightRepeat}*/; color: #363636/*{fcHighlight}*/; }
.ui-state-highlight a, .ui-widget-content .ui-state-highlight a,.ui-widget-header .ui-state-highlight a { color: #363636/*{fcHighlight}*/; }
.ui-state-error, .ui-widget-content .ui-state-error, .ui-widget-header .ui-state-error {border: 1px solid #cd0a0a/*{borderColorError}*/; background: #fef1ec/*{bgColorError}*/ url(images/ui-bg_glass_95_fef1ec_1x400.png)/*{bgImgUrlError}*/ 50%/*{bgErrorXPos}*/ 50%/*{bgErrorYPos}*/ repeat-x/*{bgErrorRepeat}*/; color: #cd0a0a/*{fcError}*/; }
.ui-state-error a, .ui-widget-content .ui-state-error a, .ui-widget-header .ui-state-error a { color: #cd0a0a/*{fcError}*/; }
.ui-state-error-text, .ui-widget-content .ui-state-error-text, .ui-widget-header .ui-state-error-text { color: #cd0a0a/*{fcError}*/; }
.ui-priority-primary, .ui-widget-content .ui-priority-primary, .ui-widget-header .ui-priority-primary { font-weight: bold; }
.ui-priority-secondary, .ui-widget-content .ui-priority-secondary, .ui-widget-header .ui-priority-secondary { opacity: .7; filter:Alpha(Opacity=70); font-weight: normal; }
.ui-state-disabled, .ui-widget-content .ui-state-disabled, .ui-widget-header .ui-state-disabled { opacity: .35; filter:Alpha(Opacity=35); background-image: none; }
/* Icons
----------------------------------*/
/* states and images */
.ui-icon { width: 16px; height: 16px; background-image: url(images/ui-icons_222222_256x240.png)/*{iconsContent}*/; }
.ui-widget-content .ui-icon {background-image: url(images/ui-icons_222222_256x240.png)/*{iconsContent}*/; }
.ui-widget-header .ui-icon {background-image: url(images/ui-icons_222222_256x240.png)/*{iconsHeader}*/; }
.ui-state-default .ui-icon { background-image: url(images/ui-icons_888888_256x240.png)/*{iconsDefault}*/; }
.ui-state-hover .ui-icon, .ui-state-focus .ui-icon {background-image: url(images/ui-icons_454545_256x240.png)/*{iconsHover}*/; }
.ui-state-active .ui-icon {background-image: url(images/ui-icons_454545_256x240.png)/*{iconsActive}*/; }
.ui-state-highlight .ui-icon {background-image: url(images/ui-icons_2e83ff_256x240.png)/*{iconsHighlight}*/; }
.ui-state-error .ui-icon, .ui-state-error-text .ui-icon {background-image: url(images/ui-icons_cd0a0a_256x240.png)/*{iconsError}*/; }
/* positioning */
.ui-icon-carat-1-n { background-position: 0 0; }
.ui-icon-carat-1-ne { background-position: -16px 0; }
.ui-icon-carat-1-e { background-position: -32px 0; }
.ui-icon-carat-1-se { background-position: -48px 0; }
.ui-icon-carat-1-s { background-position: -64px 0; }
.ui-icon-carat-1-sw { background-position: -80px 0; }
.ui-icon-carat-1-w { background-position: -96px 0; }
.ui-icon-carat-1-nw { background-position: -112px 0; }
.ui-icon-carat-2-n-s { background-position: -128px 0; }
.ui-icon-carat-2-e-w { background-position: -144px 0; }
.ui-icon-triangle-1-n { background-position: 0 -16px; }
.ui-icon-triangle-1-ne { background-position: -16px -16px; }
.ui-icon-triangle-1-e { background-position: -32px -16px; }
.ui-icon-triangle-1-se { background-position: -48px -16px; }
.ui-icon-triangle-1-s { background-position: -64px -16px; }
.ui-icon-triangle-1-sw { background-position: -80px -16px; }
.ui-icon-triangle-1-w { background-position: -96px -16px; }
.ui-icon-triangle-1-nw { background-position: -112px -16px; }
.ui-icon-triangle-2-n-s { background-position: -128px -16px; }
.ui-icon-triangle-2-e-w { background-position: -144px -16px; }
.ui-icon-arrow-1-n { background-position: 0 -32px; }
.ui-icon-arrow-1-ne { background-position: -16px -32px; }
.ui-icon-arrow-1-e { background-position: -32px -32px; }
.ui-icon-arrow-1-se { background-position: -48px -32px; }
.ui-icon-arrow-1-s { background-position: -64px -32px; }
.ui-icon-arrow-1-sw { background-position: -80px -32px; }
.ui-icon-arrow-1-w { background-position: -96px -32px; }
.ui-icon-arrow-1-nw { background-position: -112px -32px; }
.ui-icon-arrow-2-n-s { background-position: -128px -32px; }
.ui-icon-arrow-2-ne-sw { background-position: -144px -32px; }
.ui-icon-arrow-2-e-w { background-position: -160px -32px; }
.ui-icon-arrow-2-se-nw { background-position: -176px -32px; }
.ui-icon-arrowstop-1-n { background-position: -192px -32px; }
.ui-icon-arrowstop-1-e { background-position: -208px -32px; }
.ui-icon-arrowstop-1-s { background-position: -224px -32px; }
.ui-icon-arrowstop-1-w { background-position: -240px -32px; }
.ui-icon-arrowthick-1-n { background-position: 0 -48px; }
.ui-icon-arrowthick-1-ne { background-position: -16px -48px; }
.ui-icon-arrowthick-1-e { background-position: -32px -48px; }
.ui-icon-arrowthick-1-se { background-position: -48px -48px; }
.ui-icon-arrowthick-1-s { background-position: -64px -48px; }
.ui-icon-arrowthick-1-sw { background-position: -80px -48px; }
.ui-icon-arrowthick-1-w { background-position: -96px -48px; }
.ui-icon-arrowthick-1-nw { background-position: -112px -48px; }
.ui-icon-arrowthick-2-n-s { background-position: -128px -48px; }
.ui-icon-arrowthick-2-ne-sw { background-position: -144px -48px; }
.ui-icon-arrowthick-2-e-w { background-position: -160px -48px; }
.ui-icon-arrowthick-2-se-nw { background-position: -176px -48px; }
.ui-icon-arrowthickstop-1-n { background-position: -192px -48px; }
.ui-icon-arrowthickstop-1-e { background-position: -208px -48px; }
.ui-icon-arrowthickstop-1-s { background-position: -224px -48px; }
.ui-icon-arrowthickstop-1-w { background-position: -240px -48px; }
.ui-icon-arrowreturnthick-1-w { background-position: 0 -64px; }
.ui-icon-arrowreturnthick-1-n { background-position: -16px -64px; }
.ui-icon-arrowreturnthick-1-e { background-position: -32px -64px; }
.ui-icon-arrowreturnthick-1-s { background-position: -48px -64px; }
.ui-icon-arrowreturn-1-w { background-position: -64px -64px; }
.ui-icon-arrowreturn-1-n { background-position: -80px -64px; }
.ui-icon-arrowreturn-1-e { background-position: -96px -64px; }
.ui-icon-arrowreturn-1-s { background-position: -112px -64px; }
.ui-icon-arrowrefresh-1-w { background-position: -128px -64px; }
.ui-icon-arrowrefresh-1-n { background-position: -144px -64px; }
.ui-icon-arrowrefresh-1-e { background-position: -160px -64px; }
.ui-icon-arrowrefresh-1-s { background-position: -176px -64px; }
.ui-icon-arrow-4 { background-position: 0 -80px; }
.ui-icon-arrow-4-diag { background-position: -16px -80px; }
.ui-icon-extlink { background-position: -32px -80px; }
.ui-icon-newwin { background-position: -48px -80px; }
.ui-icon-refresh { background-position: -64px -80px; }
.ui-icon-shuffle { background-position: -80px -80px; }
.ui-icon-transfer-e-w { background-position: -96px -80px; }
.ui-icon-transferthick-e-w { background-position: -112px -80px; }
.ui-icon-folder-collapsed { background-position: 0 -96px; }
.ui-icon-folder-open { background-position: -16px -96px; }
.ui-icon-document { background-position: -32px -96px; }
.ui-icon-document-b { background-position: -48px -96px; }
.ui-icon-note { background-position: -64px -96px; }
.ui-icon-mail-closed { background-position: -80px -96px; }
.ui-icon-mail-open { background-position: -96px -96px; }
.ui-icon-suitcase { background-position: -112px -96px; }
.ui-icon-comment { background-position: -128px -96px; }
.ui-icon-person { background-position: -144px -96px; }
.ui-icon-print { background-position: -160px -96px; }
.ui-icon-trash { background-position: -176px -96px; }
.ui-icon-locked { background-position: -192px -96px; }
.ui-icon-unlocked { background-position: -208px -96px; }
.ui-icon-bookmark { background-position: -224px -96px; }
.ui-icon-tag { background-position: -240px -96px; }
.ui-icon-home { background-position: 0 -112px; }
.ui-icon-flag { background-position: -16px -112px; }
.ui-icon-calendar { background-position: -32px -112px; }
.ui-icon-cart { background-position: -48px -112px; }
.ui-icon-pencil { background-position: -64px -112px; }
.ui-icon-clock { background-position: -80px -112px; }
.ui-icon-disk { background-position: -96px -112px; }
.ui-icon-calculator { background-position: -112px -112px; }
.ui-icon-zoomin { background-position: -128px -112px; }
.ui-icon-zoomout { background-position: -144px -112px; }
.ui-icon-search { background-position: -160px -112px; }
.ui-icon-wrench { background-position: -176px -112px; }
.ui-icon-gear { background-position: -192px -112px; }
.ui-icon-heart { background-position: -208px -112px; }
.ui-icon-star { background-position: -224px -112px; }
.ui-icon-link { background-position: -240px -112px; }
.ui-icon-cancel { background-position: 0 -128px; }
.ui-icon-plus { background-position: -16px -128px; }
.ui-icon-plusthick { background-position: -32px -128px; }
.ui-icon-minus { background-position: -48px -128px; }
.ui-icon-minusthick { background-position: -64px -128px; }
.ui-icon-close { background-position: -80px -128px; }
.ui-icon-closethick { background-position: -96px -128px; }
.ui-icon-key { background-position: -112px -128px; }
.ui-icon-lightbulb { background-position: -128px -128px; }
.ui-icon-scissors { background-position: -144px -128px; }
.ui-icon-clipboard { background-position: -160px -128px; }
.ui-icon-copy { background-position: -176px -128px; }
.ui-icon-contact { background-position: -192px -128px; }
.ui-icon-image { background-position: -208px -128px; }
.ui-icon-video { background-position: -224px -128px; }
.ui-icon-script { background-position: -240px -128px; }
.ui-icon-alert { background-position: 0 -144px; }
.ui-icon-info { background-position: -16px -144px; }
.ui-icon-notice { background-position: -32px -144px; }
.ui-icon-help { background-position: -48px -144px; }
.ui-icon-check { background-position: -64px -144px; }
.ui-icon-bullet { background-position: -80px -144px; }
.ui-icon-radio-off { background-position: -96px -144px; }
.ui-icon-radio-on { background-position: -112px -144px; }
.ui-icon-pin-w { background-position: -128px -144px; }
.ui-icon-pin-s { background-position: -144px -144px; }
.ui-icon-play { background-position: 0 -160px; }
.ui-icon-pause { background-position: -16px -160px; }
.ui-icon-seek-next { background-position: -32px -160px; }
.ui-icon-seek-prev { background-position: -48px -160px; }
.ui-icon-seek-end { background-position: -64px -160px; }
.ui-icon-seek-start { background-position: -80px -160px; }
/* ui-icon-seek-first is deprecated, use ui-icon-seek-start instead */
.ui-icon-seek-first { background-position: -80px -160px; }
.ui-icon-stop { background-position: -96px -160px; }
.ui-icon-eject { background-position: -112px -160px; }
.ui-icon-volume-off { background-position: -128px -160px; }
.ui-icon-volume-on { background-position: -144px -160px; }
.ui-icon-power { background-position: 0 -176px; }
.ui-icon-signal-diag { background-position: -16px -176px; }
.ui-icon-signal { background-position: -32px -176px; }
.ui-icon-battery-0 { background-position: -48px -176px; }
.ui-icon-battery-1 { background-position: -64px -176px; }
.ui-icon-battery-2 { background-position: -80px -176px; }
.ui-icon-battery-3 { background-position: -96px -176px; }
.ui-icon-circle-plus { background-position: 0 -192px; }
.ui-icon-circle-minus { background-position: -16px -192px; }
.ui-icon-circle-close { background-position: -32px -192px; }
.ui-icon-circle-triangle-e { background-position: -48px -192px; }
.ui-icon-circle-triangle-s { background-position: -64px -192px; }
.ui-icon-circle-triangle-w { background-position: -80px -192px; }
.ui-icon-circle-triangle-n { background-position: -96px -192px; }
.ui-icon-circle-arrow-e { background-position: -112px -192px; }
.ui-icon-circle-arrow-s { background-position: -128px -192px; }
.ui-icon-circle-arrow-w { background-position: -144px -192px; }
.ui-icon-circle-arrow-n { background-position: -160px -192px; }
.ui-icon-circle-zoomin { background-position: -176px -192px; }
.ui-icon-circle-zoomout { background-position: -192px -192px; }
.ui-icon-circle-check { background-position: -208px -192px; }
.ui-icon-circlesmall-plus { background-position: 0 -208px; }
.ui-icon-circlesmall-minus { background-position: -16px -208px; }
.ui-icon-circlesmall-close { background-position: -32px -208px; }
.ui-icon-squaresmall-plus { background-position: -48px -208px; }
.ui-icon-squaresmall-minus { background-position: -64px -208px; }
.ui-icon-squaresmall-close { background-position: -80px -208px; }
.ui-icon-grip-dotted-vertical { background-position: 0 -224px; }
.ui-icon-grip-dotted-horizontal { background-position: -16px -224px; }
.ui-icon-grip-solid-vertical { background-position: -32px -224px; }
.ui-icon-grip-solid-horizontal { background-position: -48px -224px; }
.ui-icon-gripsmall-diagonal-se { background-position: -64px -224px; }
.ui-icon-grip-diagonal-se { background-position: -80px -224px; }
/* Misc visuals
----------------------------------*/
/* Corner radius */
.ui-corner-all, .ui-corner-top, .ui-corner-left, .ui-corner-tl { -moz-border-radius-topleft: 4px/*{cornerRadius}*/; -webkit-border-top-left-radius: 4px/*{cornerRadius}*/; -khtml-border-top-left-radius: 4px/*{cornerRadius}*/; border-top-left-radius: 4px/*{cornerRadius}*/; }
.ui-corner-all, .ui-corner-top, .ui-corner-right, .ui-corner-tr { -moz-border-radius-topright: 4px/*{cornerRadius}*/; -webkit-border-top-right-radius: 4px/*{cornerRadius}*/; -khtml-border-top-right-radius: 4px/*{cornerRadius}*/; border-top-right-radius: 4px/*{cornerRadius}*/; }
.ui-corner-all, .ui-corner-bottom, .ui-corner-left, .ui-corner-bl { -moz-border-radius-bottomleft: 4px/*{cornerRadius}*/; -webkit-border-bottom-left-radius: 4px/*{cornerRadius}*/; -khtml-border-bottom-left-radius: 4px/*{cornerRadius}*/; border-bottom-left-radius: 4px/*{cornerRadius}*/; }
.ui-corner-all, .ui-corner-bottom, .ui-corner-right, .ui-corner-br { -moz-border-radius-bottomright: 4px/*{cornerRadius}*/; -webkit-border-bottom-right-radius: 4px/*{cornerRadius}*/; -khtml-border-bottom-right-radius: 4px/*{cornerRadius}*/; border-bottom-right-radius: 4px/*{cornerRadius}*/; }
/* Overlays */
.ui-widget-overlay { background: #aaaaaa/*{bgColorOverlay}*/ url(images/ui-bg_flat_0_aaaaaa_40x100.png)/*{bgImgUrlOverlay}*/ 50%/*{bgOverlayXPos}*/ 50%/*{bgOverlayYPos}*/ repeat-x/*{bgOverlayRepeat}*/; opacity: .3;filter:Alpha(Opacity=30)/*{opacityOverlay}*/; }
.ui-widget-shadow { margin: -8px/*{offsetTopShadow}*/ 0 0 -8px/*{offsetLeftShadow}*/; padding: 8px/*{thicknessShadow}*/; background: #aaaaaa/*{bgColorShadow}*/ url(images/ui-bg_flat_0_aaaaaa_40x100.png)/*{bgImgUrlShadow}*/ 50%/*{bgShadowXPos}*/ 50%/*{bgShadowYPos}*/ repeat-x/*{bgShadowRepeat}*/; opacity: .3;filter:Alpha(Opacity=30)/*{opacityShadow}*/; -moz-border-radius: 8px/*{cornerRadiusShadow}*/; -khtml-border-radius: 8px/*{cornerRadiusShadow}*/; -webkit-border-radius: 8px/*{cornerRadiusShadow}*/; border-radius: 8px/*{cornerRadiusShadow}*/; }

View File

@@ -14,21 +14,21 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
// Required code
define('AREA', 'customer'); define('AREA', 'customer');
require ('./lib/init.php'); require ("./lib/init.php");
$Id = 0; $Id = 0;
if (isset($_GET['id'])) {
$Id = (int)$_GET['id'];
}
if (isset($_POST['id'])) {
$Id = (int)$_POST['id'];
}
eval("echo \"" . getTemplate('aps/header') . "\";"); if(isset($_GET['id']))$Id = (int)$_GET['id'];
if(isset($_POST['id']))$Id = (int)$_POST['id'];
eval("echo \"" . getTemplate("aps/header") . "\";");
$Aps = new ApsParser($userinfo, $settings, $db); $Aps = new ApsParser($userinfo, $settings, $db);
$Aps->MainHandler($action); $Aps->MainHandler($action);
eval("echo \"" . getTemplate('aps/footer') . "\";"); eval("echo \"" . getTemplate("aps/footer") . "\";");
?>

View File

@@ -14,17 +14,21 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); // Required code
require('./lib/init.php');
if ($action == 'add') { define('AREA', 'customer');
// Create new autoresponder require ("./lib/init.php");
if (isset($_POST['send'])
&& $_POST['send'] == 'send' // Create new autoresponder
) {
if($action == "add")
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$account = trim($_POST['account']); $account = trim($_POST['account']);
$subject = trim($_POST['subject']); $subject = trim($_POST['subject']);
$message = trim($_POST['message']); $message = trim($_POST['message']);
@@ -38,31 +42,39 @@ if ($action == 'add') {
$ts_from = -1; $ts_from = -1;
$ts_until = -1; $ts_until = -1;
if ($date_from_off > -1) { if($date_from_off > -1)
{
$date_from = $_POST['date_from']; $date_from = $_POST['date_from'];
$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4)); $ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
} }
if ($date_until_off > -1) { if($date_until_off > -1)
{
$date_until = $_POST['date_until']; $date_until = $_POST['date_until'];
$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4)); $ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
} }
if (empty($account) if(empty($account)
|| empty($subject) || empty($subject)
|| empty($message) || empty($message))
) { {
standard_error('missingfields'); standard_error('missingfields');
} }
// Does account exist? // Does account exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('accountnotexisting'); standard_error('accountnotexisting');
} }
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 1) {
if($db->num_rows($result) == 1)
{
standard_error('autoresponderalreadyexists'); standard_error('autoresponderalreadyexists');
} }
@@ -80,33 +92,36 @@ if ($action == 'add') {
} }
// Get accounts // Get accounts
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('noemailaccount'); standard_error('noemailaccount');
} }
$accounts = ''; $accounts = '';
while ($row = $db->fetch_array($result)) {
$accounts .= '<option value="' . $row['email'] . '">' . $row['email'] . '</option>'; while($row = $db->fetch_array($result))
{
$accounts.= "<option value=\"" . $row['email'] . "\">" . $row['email'] . "</option>";
} }
$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true); $date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true); $date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
//$isactive = makeyesno('active', '1', '0', '1'); eval("echo \"" . getTemplate("email/autoresponder_add") . "\";");
}
$autoresponder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_add.php'; // Edit autoresponder
$autoresponder_add_form = htmlform::genHTMLForm($autoresponder_add_data);
$title = $autoresponder_add_data['autoresponder_add']['title']; else
$image = $autoresponder_add_data['autoresponder_add']['image'];
eval("echo \"" . getTemplate('autoresponder/autoresponder_add') . "\";"); if($action == "edit")
} elseif ($action == 'edit') { {
// Edit autoresponder if(isset($_POST['send'])
if (isset($_POST['send']) && $_POST['send'] == 'send')
&& $_POST['send'] == 'send' {
) {
$account = trim($_POST['account']); $account = trim($_POST['account']);
$subject = trim($_POST['subject']); $subject = trim($_POST['subject']);
$message = trim($_POST['message']); $message = trim($_POST['message']);
@@ -120,36 +135,49 @@ if ($action == 'add') {
$ts_from = -1; $ts_from = -1;
$ts_until = -1; $ts_until = -1;
if ($date_from_off > -1) { if($date_from_off > -1)
{
$date_from = $_POST['date_from']; $date_from = $_POST['date_from'];
$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4)); $ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
} }
if ($date_until_off > -1) { if($date_until_off > -1)
{
$date_until = $_POST['date_until']; $date_until = $_POST['date_until'];
$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4)); $ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
} }
if (empty($account) if(empty($account)
|| empty($subject) || empty($subject)
|| empty($message) || empty($message))
) { {
standard_error('missingfields'); standard_error('missingfields');
} }
// Does account exist? // Does account exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0)
if($db->num_rows($result) == 0)
{ {
standard_error('accountnotexisting'); standard_error('accountnotexisting');
} }
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
$ResponderActive = (isset($_POST['active']) && $_POST['active'] == '1') ? 1 : 0; $ResponderActive = 0;
if(isset($_POST['active'])
&& $_POST['active'] == '1')
{
$ResponderActive = 1;
}
$db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "` $db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "`
SET `message` = '" . $db->escape($message) . "', SET `message` = '" . $db->escape($message) . "',
@@ -166,8 +194,11 @@ if ($action == 'add') {
$email = trim(htmlspecialchars($_GET['email'])); $email = trim(htmlspecialchars($_GET['email']));
// Get account data // Get account data
$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1"); $result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
@@ -178,43 +209,56 @@ if ($action == 'add') {
$date_from = (int)$row['date_from']; $date_from = (int)$row['date_from'];
$date_until = (int)$row['date_until']; $date_until = (int)$row['date_until'];
if ($date_from == -1) { if($date_from == -1)
{
$deactivated = '-1'; $deactivated = '-1';
$date_from = ''; }
} else { else
{
$deactivated = '0'; $deactivated = '0';
$date_from = date('d-m-Y', $date_from); $date_from = date('d-m-Y', $date_from);
} }
$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true); $date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
if ($date_until == -1) { if($date_until == -1)
{
$deactivated = '-1'; $deactivated = '-1';
$date_until = ''; $date_until = '-1';
} else { }
else
{
$deactivated = '0'; $deactivated = '0';
$date_until = date('d-m-Y', $date_until); $date_until = date('d-m-Y', $date_until);
} }
$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true); $date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
//$isactive = makeyesno('active', '1', '0', $row['enabled']); $checked = '';
$autoresponder_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_edit.php'; if($row['enabled'] == 1)
$autoresponder_edit_form = htmlform::genHTMLForm($autoresponder_edit_data); {
$checked = "checked=\"checked\"";
}
$title = $autoresponder_edit_data['autoresponder_edit']['title']; eval("echo \"" . getTemplate("email/autoresponder_edit") . "\";");
$image = $autoresponder_edit_data['autoresponder_edit']['image']; }
eval("echo \"" . getTemplate('autoresponder/autoresponder_edit') . "\";"); // Delete autoresponder
} elseif ($action == 'delete') {
// Delete autoresponder else
if (isset($_POST['send'])
&& $_POST['send'] == 'send' if($action == "delete")
) { {
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$account = trim($_POST['account']); $account = trim($_POST['account']);
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
@@ -228,25 +272,37 @@ if ($action == 'add') {
$email = trim(htmlspecialchars($_GET['email'])); $email = trim(htmlspecialchars($_GET['email']));
ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email)); ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email));
} else { }
// List existing autoresponders
// List existing autoresponders
else
{
$autoresponder = ''; $autoresponder = '';
$count = 0;
$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC"); $result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($row['date_from'] == -1 && $row['date_until'] == -1) { {
if($row['date_from'] == -1 && $row['date_until'] == -1)
{
$activated_date = $lng['panel']['not_activated']; $activated_date = $lng['panel']['not_activated'];
} elseif($row['date_from'] == -1 && $row['date_until'] != -1) { }
elseif($row['date_from'] == -1 && $row['date_until'] != -1)
{
$activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']); $activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']);
} elseif($row['date_from'] != -1 && $row['date_until'] == -1) { }
elseif($row['date_from'] != -1 && $row['date_until'] == -1)
{
$activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']); $activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']);
} else { }
else
{
$activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']); $activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']);
} }
eval("\$autoresponder.=\"" . getTemplate('autoresponder/autoresponder_autoresponder') . "\";"); eval("\$autoresponder.=\"" . getTemplate("email/autoresponder_autoresponder") . "\";");
$count++;
} }
eval("echo \"" . getTemplate('autoresponder/autoresponder') . "\";"); eval("echo \"" . getTemplate("email/autoresponder") . "\";");
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -50,7 +50,7 @@ elseif($page == 'domains')
'd.aliasdomain' => $lng['domains']['aliasdomain'] 'd.aliasdomain' => $lng['domains']['aliasdomain']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_ipandport`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -151,15 +151,6 @@ elseif($page == 'domains')
$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot']))); $row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
} }
// get ssl-ips if activated
// FIXME for multi-ip later
$show_ssledit = false;
if ($settings['system']['use_ssl'] == '1'
&& $row['ssl_ipandport'] != 0
&& $row['caneditdomain'] == '1'
) {
$show_ssledit = true;
}
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";"); eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
} }
@@ -205,10 +196,7 @@ elseif($page == 'domains')
$result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
else else
@@ -261,17 +249,8 @@ elseif($page == 'domains')
if(!preg_match('/^https?\:\/\//', $path) if(!preg_match('/^https?\:\/\//', $path)
|| !validateUrl($idna_convert->encode($path))) || !validateUrl($idna_convert->encode($path)))
{ {
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, $path = $userinfo['documentroot'] . '/' . $path;
// set default path to subdomain or domain name $path = makeCorrectDir($path);
if((($path == '') || ($path == '/'))
&& $settings['system']['documentroot_use_default_value'] == 1)
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
}
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
}
if (strstr($path, ":") !== FALSE) if (strstr($path, ":") !== FALSE)
{ {
standard_error('pathmaynotcontaincolon'); standard_error('pathmaynotcontaincolon');
@@ -351,6 +330,7 @@ elseif($page == 'domains')
`isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', `isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "',
`openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "', `openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "',
`openbasedir_path` = '" . $db->escape($openbasedir_path) . "', `openbasedir_path` = '" . $db->escape($openbasedir_path) . "',
`safemode` = '" . $db->escape($domain_check['safemode']) . "',
`speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "', `speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "',
`specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "', `specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "',
`ssl_redirect` = '" . $ssl_redirect . "', `ssl_redirect` = '" . $ssl_redirect . "',
@@ -366,10 +346,7 @@ elseif($page == 'domains')
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
@@ -391,9 +368,9 @@ elseif($page == 'domains')
$aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']); $aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
} }
$redirectcode = '';
if($settings['customredirect']['enabled'] == '1') if($settings['customredirect']['enabled'] == '1')
{ {
$redirectcode = '';
$codes = getRedirectCodesArray(); $codes = getRedirectCodesArray();
foreach($codes as $rc) foreach($codes as $rc)
{ {
@@ -401,22 +378,9 @@ elseif($page == 'domains')
} }
} }
// check if we at least have one ssl-ip/port, #1179 $ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
$ssl_ipsandports = '';
$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
$ssl_ipsandports = 'notempty';
}
$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true); $openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php';
$subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data);
$title = $subdomain_add_data['domain_add']['title'];
$image = $subdomain_add_data['domain_add']['image'];
eval("echo \"" . getTemplate("domains/domains_add") . "\";"); eval("echo \"" . getTemplate("domains/domains_add") . "\";");
} }
} }
@@ -424,7 +388,7 @@ elseif($page == 'domains')
elseif($action == 'edit' elseif($action == 'edit'
&& $id != 0) && $id != 0)
{ {
$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'"); $result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
$alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\''); $alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\'');
$alias_check = $alias_check['count']; $alias_check = $alias_check['count'];
$_doredirect = false; $_doredirect = false;
@@ -450,17 +414,8 @@ elseif($page == 'domains')
if(!preg_match('/^https?\:\/\//', $path) if(!preg_match('/^https?\:\/\//', $path)
|| !validateUrl($idna_convert->encode($path))) || !validateUrl($idna_convert->encode($path)))
{ {
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, $path = $userinfo['documentroot'] . '/' . $path;
// set default path to subdomain or domain name $path = makeCorrectDir($path);
if((($path == '') || ($path == '/'))
&& $settings['system']['documentroot_use_default_value'] == 1)
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
}
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
}
if (strstr($path, ":") !== FALSE) if (strstr($path, ":") !== FALSE)
{ {
standard_error('pathmaynotcontaincolon'); standard_error('pathmaynotcontaincolon');
@@ -559,10 +514,7 @@ elseif($page == 'domains')
$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'"); $log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
} }
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -582,17 +534,10 @@ elseif($page == 'domains')
if(preg_match('/^https?\:\/\//', $result['documentroot']) if(preg_match('/^https?\:\/\//', $result['documentroot'])
&& validateUrl($idna_convert->encode($result['documentroot'])) && validateUrl($idna_convert->encode($result['documentroot']))
) { && $settings['panel']['pathedit'] == 'Dropdown')
if($settings['panel']['pathedit'] == 'Dropdown') {
{ $urlvalue = $result['documentroot'];
$urlvalue = $result['documentroot']; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
}
else
{
$urlvalue = '';
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot'], true);
}
} }
else else
{ {
@@ -600,10 +545,10 @@ elseif($page == 'domains')
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']);
} }
$redirectcode = '';
if($settings['customredirect']['enabled'] == '1') if($settings['customredirect']['enabled'] == '1')
{ {
$def_code = getDomainRedirectId($id); $def_code = getDomainRedirectId($id);
$redirectcode = '';
$codes = getRedirectCodesArray(); $codes = getRedirectCodesArray();
foreach($codes as $rc) foreach($codes as $rc)
{ {
@@ -611,13 +556,9 @@ elseif($page == 'domains')
} }
} }
// check if we at least have one ssl-ip/port, #1179 $ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
$ssl_ipsandports = ''; $iswildcarddomain = makeyesno('iswildcarddomain', '1', '0', $result['iswildcarddomain']);
$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'"); $isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
$ssl_ipsandports = 'notempty';
}
$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true); $openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
$result_ipandport = $db->query_first("SELECT `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` WHERE `id`='".(int)$result['ipandport']."'"); $result_ipandport = $db->query_first("SELECT `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` WHERE `id`='".(int)$result['ipandport']."'");
@@ -628,12 +569,6 @@ elseif($page == 'domains')
$domainip = $result_ipandport['ip']; $domainip = $result_ipandport['ip'];
$result = htmlentities_array($result); $result = htmlentities_array($result);
$subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php';
$subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data);
$title = $subdomain_edit_data['domain_edit']['title'];
$image = $subdomain_edit_data['domain_edit']['image'];
eval("echo \"" . getTemplate("domains/domains_edit") . "\";"); eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
} }
} }
@@ -643,127 +578,5 @@ elseif($page == 'domains')
} }
} }
} }
elseif ($page == 'domainssleditor') {
if ($action == ''
|| $action == 'view'
) {
if (isset($_POST['send'])
&& $_POST['send'] == 'send'
) {
$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
if ($ssl_cert_file != '' && $ssl_key_file == '') {
standard_error('sslcertificateismissingprivatekey');
}
$do_verify = true;
// no cert-file given -> forget everything
if ($ssl_cert_file == '') {
$ssl_key_file = '';
$ssl_ca_file = '';
$ssl_cert_chainfile = '';
$do_verify = false;
}
// verify certificate content
if ($do_verify) {
// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
// openssl_x509_parse() returns information about the supplied x509cert, including fields such as
// subject name, issuer name, purposes, valid from and valid to dates etc.
$cert_content = openssl_x509_parse($ssl_cert_file);
if (is_array($cert_content)
&& isset($cert_content['subject'])
&& isset($cert_content['subject']['CN'])
) {
// TODO self-signed certs might differ and don't need/want this
/*
$domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'");
if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) {
standard_error('sslcertificatewrongdomain');
}
*/
// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
// Checks whether the given key is the private key that corresponds to cert.
if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
standard_error('sslcertificateinvalidcertkeypair');
}
// check optional stuff
if ($ssl_ca_file != '') {
$ca_content = openssl_x509_parse($ssl_ca_file);
if (!is_array($ca_content)) {
// invalid
standard_error('sslcertificateinvalidca');
}
}
if ($ssl_cert_chainfile != '') {
$chain_content = openssl_x509_parse($ssl_cert_chainfile);
if (!is_array($chain_content)) {
// invalid
standard_error('sslcertificateinvalidchain');
}
}
} else {
standard_error('sslcertificateinvalidcert');
}
}
// Add/Update database entry
$qrystart = "UPDATE ";
$qrywhere = "WHERE ";
if ($do_insert) {
$qrystart = "INSERT INTO ";
$qrywhere = ", ";
}
$db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
`ssl_cert_file` = '".$db->escape($ssl_cert_file)."',
`ssl_key_file` = '".$db->escape($ssl_key_file)."',
`ssl_ca_file` = '".$db->escape($ssl_ca_file)."',
`ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."'
".$qrywhere." `domainid`='".(int)$id."';"
);
// insert task to re-generate webserver-configs (#1260)
inserttask('1');
// back to domain overview
redirectTo($filename, array('page' => 'domains', 's' => $s));
}
$result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
WHERE `domainid`='".(int)$id."';"
);
$do_insert = false;
// if no entry can be found, behave like we have empty values
if (!is_array($result) || !isset($result['ssl_cert_file'])) {
$result = array(
'ssl_cert_file' => '',
'ssl_key_file' => '',
'ssl_ca_file' => '',
'ssl_cert_chainfile' => ''
);
$do_insert = true;
}
$result = htmlentities_array($result);
$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
$title = $ssleditor_data['domain_ssleditor']['title'];
$image = $ssleditor_data['domain_ssleditor']['image'];
eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
}
}
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -237,7 +237,7 @@ elseif($page == 'emails')
standard_error('emailiswrong', $email_full); standard_error('emailiswrong', $email_full);
} }
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE (`email` = '" . strtolower($db->escape($email)) . "' OR `email_full` = '" . strtolower($db->escape($email_full)) . "') AND `customerid`='" . (int)$userinfo['customerid'] . "'"); $email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE ( `email`='" . $db->escape($email) . "' OR `email_full` = '" . $db->escape($email_full) . "' ) AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email == '' if($email == ''
|| $email_full == '' || $email_full == ''
@@ -253,7 +253,7 @@ elseif($page == 'emails')
{ {
standard_error('maindomainnonexist', $domain); standard_error('maindomainnonexist', $domain);
} }
elseif(strtolower($email_check['email_full']) == strtolower($email_full)) elseif($email_check['email_full'] == $email_full)
{ {
standard_error('emailexistalready', $email_full); standard_error('emailexistalready', $email_full);
} }
@@ -281,20 +281,7 @@ elseif($page == 'emails')
$domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']); $domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']);
} }
//$iscatchall = makeyesno('iscatchall', '1', '0', '0'); $iscatchall = makeyesno('iscatchall', '1', '0', '0');
$email_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_add.php';
if ( $settings['catchall']['catchall_enabled'] != '1' )
{
unset($email_add_data['emails_add']['sections']['section_a']['fields']['iscatchall']);
}
$email_add_form = htmlform::genHTMLForm($email_add_data);
$title = $email_add_data['emails_add']['title'];
$image = $email_add_data['emails_add']['image'];
eval("echo \"" . getTemplate("email/emails_add") . "\";"); eval("echo \"" . getTemplate("email/emails_add") . "\";");
} }
} }
@@ -334,60 +321,40 @@ elseif($page == 'emails')
$destinations_count = count($result['destination']); $destinations_count = count($result['destination']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$email_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_edit.php';
if ( $settings['catchall']['catchall_enabled'] != '1' )
{
unset($email_edit_data['emails_edit']['sections']['section_a']['fields']['mail_catchall']);
}
$email_edit_form = htmlform::genHTMLForm($email_edit_data);
$title = $email_edit_data['emails_edit']['title'];
$image = $email_edit_data['emails_edit']['image'];
eval("echo \"" . getTemplate("email/emails_edit") . "\";"); eval("echo \"" . getTemplate("email/emails_edit") . "\";");
} }
} }
elseif($action == 'togglecatchall' elseif($action == 'togglecatchall'
&& $id != 0) && $id != 0)
{ {
if ( $settings['catchall']['catchall_enabled'] == '1' ) $result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
{
$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if(isset($result['email']) if(isset($result['email'])
&& $result['email'] != '') && $result['email'] != '')
{
if($result['iscatchall'] == '1')
{ {
if($result['iscatchall'] == '1') $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
}
else
{
$email_parts = explode('@', $result['email_full']);
$email = '@' . $email_parts[1];
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email_check['email'] == $email)
{ {
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'"); standard_error('youhavealreadyacatchallforthisdomain');
exit;
} }
else else
{ {
$email_parts = explode('@', $result['email_full']); $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
$email = '@' . $email_parts[1]; $log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email_check['email'] == $email)
{
standard_error('youhavealreadyacatchallforthisdomain');
exit;
}
else
{
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
}
} }
redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
} }
}
else redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
{
standard_error(array('operationnotpermitted', 'featureisdisabled'), 'Catchall');
} }
} }
} }
@@ -458,42 +425,11 @@ elseif($page == 'accounts')
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} }
$cryptPassword = makeCryptPassword($password); $db->query("INSERT INTO `" . TABLE_MAIL_USERS . "` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($email_full) . "', '" . $db->escape($username) . "', " . ($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "'," : '') . " ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_full . '/') . "', '" . (int)$settings['system']['vmail_uid'] . "', '" . (int)$settings['system']['vmail_gid'] . "', '" . (int)$result['domainid'] . "', 'y', '" . (int)$quota . "', '" . (int)$userinfo['imap'] . "', '" . (int)$userinfo['pop3'] . "')");
$email_user=substr($email_full,0,strrpos($email_full,"@"));
$email_domain=substr($email_full,strrpos($email_full,"@")+1);
$maildirname=trim($settings['system']['vmail_maildirname']);
// Add trailing slash to Maildir if needed
$maildirpath=$maildirname;
if (!empty($maildirname) and substr($maildirname,-1) != "/") $maildirpath.="/";
$db->query("INSERT INTO `" . TABLE_MAIL_USERS .
"` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) ".
"VALUES (".
"'" . (int)$userinfo['customerid'] . "', ".
"'" . $db->escape($email_full) . "', ".
"'" . $db->escape($username) . "', " .
($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "', " : '') .
"'" . $db->escape($cryptPassword) . "', ".
"'" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_domain . "/" . $email_user . "/" . $maildirpath) . "', ".
"'" . (int)$settings['system']['vmail_uid'] . "', ".
"'" . (int)$settings['system']['vmail_gid'] . "', ".
"'" . (int)$result['domainid'] . "', ".
"'y', ".
"'" . (int)$quota . "', ".
"'" . (int)$userinfo['imap'] . "', ".
"'" . (int)$userinfo['pop3'] . "')");
$popaccountid = $db->insert_id(); $popaccountid = $db->insert_id();
$result['destination'].= ' ' . $email_full; $result['destination'].= ' ' . $email_full;
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET ". $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', `popaccountid` = '" . (int)$popaccountid . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
"`destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', ". $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used`=`email_accounts_used`+1, `email_quota_used`=`email_quota_used`+" . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
"`popaccountid` = '" . (int)$popaccountid . "' ".
"WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET ".
"`email_accounts_used`=`email_accounts_used`+1, ".
"`email_quota_used`=`email_quota_used`+" . (int)$quota . " ".
"WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'");
$replace_arr = array( $replace_arr = array(
'EMAIL' => $email_full, 'EMAIL' => $email_full,
@@ -512,7 +448,7 @@ elseif($page == 'accounts')
$mail->Subject = $mail_subject; $mail->Subject = $mail_subject;
$mail->AltBody = $mail_body; $mail->AltBody = $mail_body;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body)); $mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
$mail->AddAddress($email_full); $mail->AddAddress($email_full, getCorrectUserSalutation($userinfo));
$mail->Send(); $mail->Send();
} catch(phpmailerException $e) { } catch(phpmailerException $e) {
$mailerr_msg = $e->errorMessage(); $mailerr_msg = $e->errorMessage();
@@ -569,13 +505,6 @@ elseif($page == 'accounts')
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$quota = $settings['system']['mail_quota']; $quota = $settings['system']['mail_quota'];
$account_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addaccount.php';
$account_add_form = htmlform::genHTMLForm($account_add_data);
$title = $account_add_data['emails_addaccount']['title'];
$image = $account_add_data['emails_addaccount']['image'];
eval("echo \"" . getTemplate("email/account_add") . "\";"); eval("echo \"" . getTemplate("email/account_add") . "\";");
} }
} }
@@ -607,21 +536,13 @@ elseif($page == 'accounts')
$password = validatePassword($password); $password = validatePassword($password);
$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'");
$cryptPassword = makeCryptPassword($password); $result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s)); redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
} }
else else
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$account_changepw_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangepasswd.php';
$account_changepw_form = htmlform::genHTMLForm($account_changepw_data);
$title = $account_changepw_data['emails_accountchangepasswd']['title'];
$image = $account_changepw_data['emails_accountchangepasswd']['image'];
eval("echo \"" . getTemplate("email/account_changepw") . "\";"); eval("echo \"" . getTemplate("email/account_changepw") . "\";");
} }
} }
@@ -663,13 +584,6 @@ elseif($page == 'accounts')
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$quota_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangequota.php';
$quota_edit_form = htmlform::genHTMLForm($quota_edit_data);
$title = $quota_edit_data['emails_accountchangequota']['title'];
$image = $quota_edit_data['emails_accountchangequota']['image'];
eval("echo \"" . getTemplate("email/account_changequota") . "\";"); eval("echo \"" . getTemplate("email/account_changequota") . "\";");
} }
} }
@@ -764,13 +678,6 @@ elseif($page == 'forwarders')
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$forwarder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addforwarder.php';
$forwarder_add_form = htmlform::genHTMLForm($forwarder_add_data);
$title = $forwarder_add_data['emails_addforwarder']['title'];
$image = $forwarder_add_data['emails_addforwarder']['image'];
eval("echo \"" . getTemplate("email/forwarder_add") . "\";"); eval("echo \"" . getTemplate("email/forwarder_add") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -39,30 +39,6 @@ if($page == 'overview')
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras");
eval("echo \"" . getTemplate("extras/extras") . "\";"); eval("echo \"" . getTemplate("extras/extras") . "\";");
} }
elseif($page == 'backup')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras_backup");
$result = $db->query("SELECT `backup_enabled` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$row = $db->fetch_array($result);
$backup_enabled = makeyesno('backup_enabled', '1', '0', $row['backup_enabled']);
if(isset($_POST['send']) && $_POST['send'] == 'send'){
$backup_enabled = ($_POST['backup_enabled'] == '1' ? '1' : '0');
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `backup_enabled`='" . $backup_enabled . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
redirectTo($filename, Array('page' => $page, 's' => $s));
}
$backup_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.backup.php';
$backup_form = htmlform::genHTMLForm($backup_data);
$title = $backup_data['backup']['title'];
$image = $backup_data['backup']['image'];
eval("echo \"" . getTemplate("extras/backup") . "\";");
}
elseif($page == 'htpasswds') elseif($page == 'htpasswds')
{ {
if($action == '') if($action == '')
@@ -185,13 +161,6 @@ elseif($page == 'htpasswds')
else else
{ {
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$htpasswd_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_add.php';
$htpasswd_add_form = htmlform::genHTMLForm($htpasswd_add_data);
$title = $htpasswd_add_data['htpasswd_add']['title'];
$image = $htpasswd_add_data['htpasswd_add']['image'];
eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";"); eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";");
} }
} }
@@ -251,13 +220,6 @@ elseif($page == 'htpasswds')
} }
$result = htmlentities_array($result); $result = htmlentities_array($result);
$htpasswd_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_edit.php';
$htpasswd_edit_form = htmlform::genHTMLForm($htpasswd_edit_data);
$title = $htpasswd_edit_data['htpasswd_edit']['title'];
$image = $htpasswd_edit_data['htpasswd_edit']['image'];
eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";"); eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";");
} }
} }
@@ -352,28 +314,18 @@ elseif($page == 'htaccess')
standard_error('invalidpath'); standard_error('invalidpath');
} }
if(isset($_POST['options_cgi']) if(isset($_POST['options_cgi']))
&& (int)$_POST['options_cgi'] != 0 {
) { $options_cgi = intval($_POST['options_cgi']);
$options_cgi = '1';
} }
else else
{ {
$options_cgi = '0'; $options_cgi = '0';
} }
$error404path = ''; $error404path = correctErrorDocument($_POST['error404path']);
if (isset($_POST['error404path'])) { $error403path = correctErrorDocument($_POST['error403path']);
$error404path = correctErrorDocument($_POST['error404path']); $error500path = correctErrorDocument($_POST['error500path']);
}
$error403path = '';
if (isset($_POST['error403path'])) {
$error403path = correctErrorDocument($_POST['error403path']);
}
$error500path = '';
if (isset($_POST['error500path'])) {
$error500path = correctErrorDocument($_POST['error500path']);
}
if($path_dupe_check['path'] == $path) if($path_dupe_check['path'] == $path)
{ {
@@ -402,18 +354,9 @@ elseif($page == 'htaccess')
else else
{ {
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
/*
$options_indexes = makeyesno('options_indexes', '1', '0', '0'); $options_indexes = makeyesno('options_indexes', '1', '0', '0');
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
$options_cgi = makeyesno('options_cgi', '1', '0', '0'); $options_cgi = makeyesno('options_cgi', '1', '0', '0');
*/
$htaccess_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_add.php';
$htaccess_add_form = htmlform::genHTMLForm($htaccess_add_data);
$title = $htaccess_add_data['htaccess_add']['title'];
$image = $htaccess_add_data['htaccess_add']['image'];
eval("echo \"" . getTemplate("extras/htaccess_add") . "\";"); eval("echo \"" . getTemplate("extras/htaccess_add") . "\";");
} }
} }
@@ -471,19 +414,10 @@ elseif($page == 'htaccess')
$result['error404path'] = $result['error404path']; $result['error404path'] = $result['error404path'];
$result['error403path'] = $result['error403path']; $result['error403path'] = $result['error403path'];
$result['error500path'] = $result['error500path']; $result['error500path'] = $result['error500path'];
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
/*
$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']); $options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']); $options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
*/
$result = htmlentities_array($result); $result = htmlentities_array($result);
$htaccess_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_edit.php';
$htaccess_edit_form = htmlform::genHTMLForm($htaccess_edit_data);
$title = $htaccess_edit_data['htaccess_edit']['title'];
$image = $htaccess_edit_data['htaccess_edit']['image'];
eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";"); eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,27 +22,34 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
$id = 0; require ("./lib/init.php");
if (isset($_POST['id'])) {
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
eval("echo \"" . getTemplate('ftp/ftp') . "\";"); eval("echo \"" . getTemplate("ftp/ftp") . "\";");
} elseif ($page == 'accounts') { }
if ($action == '') { elseif($page == 'accounts')
{
if($action == '')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
$fields = array( $fields = array(
'username' => $lng['login']['username'], 'username' => $lng['login']['username'],
'homedir' => $lng['panel']['path'] 'homedir' => $lng['panel']['path']
); );
$paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' AND `username` NOT LIKE '%_backup'" . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -52,18 +59,23 @@ if ($page == 'overview') {
$count = 0; $count = 0;
$accounts = ''; $accounts = '';
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($paging->checkDisplay($i)) { {
if (strpos($row['homedir'], $userinfo['documentroot']) === 0) { if($paging->checkDisplay($i))
{
if(strpos($row['homedir'], $userinfo['documentroot']) === 0)
{
$row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot'])); $row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot']));
} else { }
else
{
$row['documentroot'] = $row['homedir']; $row['documentroot'] = $row['homedir'];
} }
$row['documentroot'] = makeCorrectDir($row['documentroot']); $row['documentroot'] = makeCorrectDir($row['documentroot']);
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$accounts.=\"" . getTemplate('ftp/accounts_account') . "\";"); eval("\$accounts.=\"" . getTemplate("ftp/accounts_account") . "\";");
$count++; $count++;
} }
@@ -71,86 +83,118 @@ if ($page == 'overview') {
} }
$ftps_count = $db->num_rows($result); $ftps_count = $db->num_rows($result);
eval("echo \"" . getTemplate('ftp/accounts') . "\";"); eval("echo \"" . getTemplate("ftp/accounts") . "\";");
} elseif ($action == 'delete' && $id != 0) { }
elseif($action == 'delete'
&& $id != 0)
{
$result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if (isset($result['username']) if(isset($result['username'])
&& $result['username'] != $userinfo['loginname'] && $result['username'] != $userinfo['loginname'])
) { {
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'"); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'");
$result = $db->query_first("SELECT `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query("SELECT `username` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($result['username']) . "'"); while($row = $db->fetch_array($result))
{
$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($row['username']) . "'");
}
$db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'");
$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$resetaccnumber = ($userinfo['ftps_used'] == '1') ? " , `ftp_lastaccountnumber`='0'" : ''; if($userinfo['ftps_used'] == '1')
{
$resetaccnumber = " , `ftp_lastaccountnumber`='0'";
}
else
{
$resetaccnumber = '';
}
// refs #293 // refs #293
if (isset($_POST['delete_userfiles']) if(isset($_POST['delete_userfiles'])
&& (int)$_POST['delete_userfiles'] == 1 && (int)$_POST['delete_userfiles'] == 1)
) { {
inserttask('8', $userinfo['loginname'], $result['homedir']); inserttask('8', $userinfo['loginname'], $result['homedir']);
} }
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
else
{
ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']); ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
} }
} else { }
else
{
standard_error('ftp_cantdeletemainaccount'); standard_error('ftp_cantdeletemainaccount');
} }
} elseif ($action == 'add') { }
if ($userinfo['ftps_used'] < $userinfo['ftps'] elseif($action == 'add')
|| $userinfo['ftps'] == '-1' {
) { if($userinfo['ftps_used'] < $userinfo['ftps']
if (isset($_POST['send']) || $userinfo['ftps'] == '-1')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$path = validate($_POST['path'], 'path'); $path = validate($_POST['path'], 'path');
$password = validate($_POST['ftp_password'], 'password'); $password = validate($_POST['ftp_password'], 'password');
$password = validatePassword($password); $password = validatePassword($password);
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0; $sendinfomail = intval($_POST['sendinfomail']);
if ($sendinfomail != 1) { if($sendinfomail != 1)
{
$sendinfomail = 0; $sendinfomail = 0;
} }
if ($settings['customer']['ftpatdomain'] == '1') { if($settings['customer']['ftpatdomain'] == '1')
{
$ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/'); $ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
if ($ftpusername == '') { if($ftpusername == '')
{
standard_error(array('stringisempty', 'username')); standard_error(array('stringisempty', 'username'));
} }
$ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain')); $ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain'));
$ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'"); $ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if ($ftpdomain_check['domain'] != $ftpdomain) { if($ftpdomain_check['domain'] != $ftpdomain)
{
standard_error('maindomainnonexist', $domain); standard_error('maindomainnonexist', $domain);
} }
$username = $ftpusername . "@" . $ftpdomain; $username = $ftpusername . "@" . $ftpdomain;
} else { }
else
{
$username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1); $username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1);
} }
$username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\''); $username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\'');
if (!empty($username_check) && $username_check['username'] = $username) { if(!empty($username_check) && $username_check['username'] = $username)
{
standard_error('usernamealreadyexists', $username); standard_error('usernamealreadyexists', $username);
} elseif ($password == '') { }
elseif($password == '')
{
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
} elseif ($path == '') { }
elseif($path == '')
{
standard_error('patherror'); standard_error('patherror');
} else { }
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
$cryptPassword = makeCryptPassword($password); $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
$result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'"); $result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')"); $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')");
} }
$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'"); $db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'");
@@ -159,10 +203,10 @@ if ($page == 'overview') {
$log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'"); $log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'");
inserttask(5); inserttask(5);
if ($sendinfomail == 1) { if($sendinfomail == 1)
{
$replace_arr = array( $replace_arr = array(
'SALUTATION' => getCorrectUserSalutation($userinfo), 'CUST_NAME' => getCorrectUserSalutation($userinfo),
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
'USR_NAME' => $username, 'USR_NAME' => $username,
'USR_PASS' => $password, 'USR_PASS' => $password,
'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot']))) 'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot'])))
@@ -199,80 +243,84 @@ if ($page == 'overview') {
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} else { }
else
{
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/'); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/');
if ($settings['customer']['ftpatdomain'] == '1') { if($settings['customer']['ftpatdomain'] == '1')
{
$domainlist = array(); $domainlist = array();
$domains = ''; $domains = '';
$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
while ($row_domain = $db->fetch_array($result_domains)) { while($row_domain = $db->fetch_array($result_domains))
{
$domainlist[] = $row_domain['domain']; $domainlist[] = $row_domain['domain'];
} }
sort($domainlist); sort($domainlist);
if (isset($domainlist[0]) && $domainlist[0] != '') { if(isset($domainlist[0]) && $domainlist[0] != '')
foreach ($domainlist as $dom) { {
foreach($domainlist as $dom)
{
$domains .= makeoption($idna_convert->decode($dom), $dom); $domains .= makeoption($idna_convert->decode($dom), $dom);
} }
} }
} }
//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0'); $sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
$ftp_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_add.php'; eval("echo \"" . getTemplate("ftp/accounts_add") . "\";");
$ftp_add_form = htmlform::genHTMLForm($ftp_add_data);
$title = $ftp_add_data['ftp_add']['title'];
$image = $ftp_add_data['ftp_add']['image'];
eval("echo \"" . getTemplate('ftp/accounts_add') . "\";");
} }
} }
} elseif ($action == 'edit' && $id != 0) { }
elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if (isset($result['username']) if(isset($result['username'])
&& $result['username'] != '' && $result['username'] != '')
) { {
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
$path = validate($_POST['path'], 'path'); $path = validate($_POST['path'], 'path');
$_setnewpass = false; $_setnewpass = false;
if (isset($_POST['ftp_password']) && $_POST['ftp_password'] != '') { if(isset($_POST['ftp_password']) && $_POST['ftp_password'] != '')
{
$password = validate($_POST['ftp_password'], 'password'); $password = validate($_POST['ftp_password'], 'password');
$password = validatePassword($password); $password = validatePassword($password);
$_setnewpass = true; $_setnewpass = true;
} }
if ($_setnewpass) { if($_setnewpass)
if ($password == '') { {
if($password == '')
{
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
exit; exit;
} }
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'"); else
$cryptPassword = makeCryptPassword($password); {
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
// also update customers backup user password if password of main ftp user is changed
if(!preg_match('/' . $settings['customer']['ftpprefix'] . '/', $result['username'])){
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $result['username'] . "_backup'");
} }
} }
if ($path != '') { if($path != '')
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
if ($path != $result['homedir']) { if($path != $result['homedir'])
if (!file_exists($path)) { {
// it's the task for "new ftp" but that will if(!file_exists($path))
// create all directories and correct their permissions {
inserttask(5); mkDirWithCorrectOwnership($userinfo['documentroot'], $path, $result['uid'], $result['gid']);
} }
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'");
@@ -281,34 +329,37 @@ if ($page == 'overview') {
} }
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
if (strpos($result['homedir'], $userinfo['documentroot']) === 0) { else
{
if(strpos($result['homedir'], $userinfo['documentroot']) === 0)
{
$homedir = substr($result['homedir'], strlen($userinfo['documentroot'])); $homedir = substr($result['homedir'], strlen($userinfo['documentroot']));
} else { }
else
{
$homedir = $result['homedir']; $homedir = $result['homedir'];
} }
$homedir = makeCorrectDir($homedir); $homedir = makeCorrectDir($homedir);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir);
if ($settings['customer']['ftpatdomain'] == '1') { if($settings['customer']['ftpatdomain'] == '1')
{
$domains = ''; $domains = '';
$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
while ($row_domain = $db->fetch_array($result_domains)) { while($row_domain = $db->fetch_array($result_domains))
$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']); {
$domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
} }
} }
$ftp_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_edit.php'; eval("echo \"" . getTemplate("ftp/accounts_edit") . "\";");
$ftp_edit_form = htmlform::genHTMLForm($ftp_edit_data);
$title = $ftp_edit_data['ftp_edit']['title'];
$image = $ftp_edit_data['ftp_edit']['image'];
eval("echo \"" . getTemplate('ftp/accounts_edit') . "\";");
} }
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,32 +22,40 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if ($action == 'logout') { require ("./lib/init.php");
$log->logAction(USR_ACTION, LOG_NOTICE, 'logged out');
$query = "DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'"; if($action == 'logout')
if ($settings['session']['allow_multiple_login'] == '1') { {
$query .= " AND `hash` = '" . $s . "'"; $log->logAction(USR_ACTION, LOG_NOTICE, "logged out");
if($settings['session']['allow_multiple_login'] == '1')
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0' AND `hash` = '" . $s . "'");
} }
$db->query($query); else
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'");
}
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index");
$domains = ''; $domains = '';
$result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' "); $result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' ");
$domainArray = array(); $domainArray = array();
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$domainArray[] = $idna_convert->decode($row['domain']); $domainArray[] = $idna_convert->decode($row['domain']);
} }
natsort($domainArray); natsort($domainArray);
$domains = implode(',<br />', $domainArray); $domains = implode(', ', $domainArray);
$userinfo['email'] = $idna_convert->decode($userinfo['email']); $userinfo['email'] = $idna_convert->decode($userinfo['email']);
$yesterday = time() - (60 * 60 * 24); $yesterday = time() - (60 * 60 * 24);
$month = date('M Y', $yesterday); $month = date('M Y', $yesterday);
@@ -69,49 +77,67 @@ if ($page == 'overview') {
$awaitingtickets = $opentickets['count']; $awaitingtickets = $opentickets['count'];
$awaitingtickets_text = ''; $awaitingtickets_text = '';
if ($opentickets > 0) { if($opentickets > 0)
{
$awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>')); $awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>'));
} }
eval("echo \"" . getTemplate('index/index') . "\";"); eval("echo \"" . getTemplate("index/index") . "\";");
} elseif ($page == 'change_password') { }
if (isset($_POST['send']) && $_POST['send'] == 'send') { elseif($page == 'change_password')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$old_password = validate($_POST['old_password'], 'old password'); $old_password = validate($_POST['old_password'], 'old password');
if (md5($old_password) != $userinfo['password']) {
if(md5($old_password) != $userinfo['password'])
{
standard_error('oldpasswordnotcorrect'); standard_error('oldpasswordnotcorrect');
exit; exit;
} }
$new_password = validatePassword($_POST['new_password'], 'new password'); $new_password = validate($_POST['new_password'], 'new password');
$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm'); $new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
if ($old_password == '') { if($old_password == '')
{
standard_error(array('stringisempty', 'oldpassword')); standard_error(array('stringisempty', 'oldpassword'));
} elseif($new_password == '') { }
elseif($new_password == '')
{
standard_error(array('stringisempty', 'newpassword')); standard_error(array('stringisempty', 'newpassword'));
} elseif($new_password_confirm == '') { }
elseif($new_password_confirm == '')
{
standard_error(array('stringisempty', 'newpasswordconfirm')); standard_error(array('stringisempty', 'newpasswordconfirm'));
} elseif($new_password != $new_password_confirm) { }
elseif($new_password != $new_password_confirm)
{
standard_error('newpasswordconfirmerror'); standard_error('newpasswordconfirmerror');
} else { }
else
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed password'); $log->logAction(USR_ACTION, LOG_NOTICE, 'changed password');
if (isset($_POST['change_main_ftp']) if(isset($_POST['change_main_ftp'])
&& $_POST['change_main_ftp'] == 'true' && $_POST['change_main_ftp'] == 'true')
) { {
$cryptPassword = makeCryptPassword($new_password); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($new_password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password'); $log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password');
} }
if (isset($_POST['change_webalizer']) if(isset($_POST['change_webalizer'])
&& $_POST['change_webalizer'] == 'true' && $_POST['change_webalizer'] == 'true')
) { {
if (CRYPT_STD_DES == 1) { if(CRYPT_STD_DES == 1)
{
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2); $saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
$new_webalizer_password = crypt($new_password, $saltfordescrypt); $new_webalizer_password = crypt($new_password, $saltfordescrypt);
} else { }
else
{
$new_webalizer_password = crypt($new_password); $new_webalizer_password = crypt($new_password);
} }
@@ -120,52 +146,44 @@ if ($page == 'overview') {
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} }
} else {
eval("echo \"" . getTemplate('index/change_password') . "\";");
} }
} elseif ($page == 'change_language') { else
if (isset($_POST['send']) && $_POST['send'] == 'send') { {
eval("echo \"" . getTemplate("index/change_password") . "\";");
}
}
elseif($page == 'change_language')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
if (isset($languages[$def_language])) {
if(isset($languages[$def_language]))
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'"); $db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
} }
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} else { }
else
{
$language_options = '';
$default_lang = $settings['panel']['standardlanguage']; $default_lang = $settings['panel']['standardlanguage'];
if ($userinfo['def_language'] != '') { if($userinfo['def_language'] != '') {
$default_lang = $userinfo['def_language']; $default_lang = $userinfo['def_language'];
} }
$language_options = ''; while(list($language_file, $language_name) = each($languages))
while (list($language_file, $language_name) = each($languages)) { {
$language_options .= makeoption($language_name, $language_file, $default_lang, true); $language_options.= makeoption($language_name, $language_file, $default_lang, true);
} }
eval("echo \"" . getTemplate('index/change_language') . "\";"); eval("echo \"" . getTemplate("index/change_language") . "\";");
}
} elseif ($page == 'change_theme') {
if (isset($_POST['send']) && $_POST['send'] == 'send') {
$theme = validate($_POST['theme'], 'theme');
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'");
redirectTo($filename, Array('s' => $s));
} else {
$default_theme = $settings['panel']['default_theme'];
if ($userinfo['theme'] != '') {
$default_theme = $userinfo['theme'];
}
$theme_options = '';
$themes_avail = getThemes();
foreach ($themes_avail as $t) {
$theme_options .= makeoption($t, $t, $default_theme, true);
}
eval("echo \"" . getTemplate('index/change_theme') . "\";");
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,22 +22,30 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
$need_db_sql_data = true; $need_db_sql_data = true;
$need_root_db_sql_data = true; $need_root_db_sql_data = true;
require('./lib/init.php'); require ("./lib/init.php");
if (isset($_POST['id'])) { if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
$lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']); $lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']);
eval("echo \"" . getTemplate('mysql/mysql') . "\";"); eval("echo \"" . getTemplate("mysql/mysql") . "\";");
} elseif($page == 'mysqls') { }
if ($action == '') { elseif($page == 'mysqls')
{
if($action == '')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
$fields = array( $fields = array(
'databasename' => $lng['mysql']['databasename'], 'databasename' => $lng['mysql']['databasename'],
@@ -54,117 +62,125 @@ if ($page == 'overview') {
$count = 0; $count = 0;
$mysqls = ''; $mysqls = '';
// Begin root-session while($row = $db->fetch_array($result))
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], ''); {
while ($row = $db->fetch_array($result)) { if($paging->checkDisplay($i))
if ($paging->checkDisplay($i)) { {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$mbdata = $db_root->query_first("SELECT SUM( data_length + index_length) / 1024 / 1024 'MB' FROM information_schema.TABLES WHERE table_schema = '" . $db_root->escape($row['databasename']) . "' GROUP BY table_schema ;"); eval("\$mysqls.=\"" . getTemplate("mysql/mysqls_database") . "\";");
$row['size'] = number_format($mbdata['MB'], 3, '.', '');
eval("\$mysqls.=\"" . getTemplate('mysql/mysqls_database') . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
$db_root->close();
// End root-session
$mysqls_count = $db->num_rows($result); $mysqls_count = $db->num_rows($result);
eval("echo \"" . getTemplate('mysql/mysqls') . "\";"); eval("echo \"" . getTemplate("mysql/mysqls") . "\";");
} elseif($action == 'delete' && $id != 0) { }
elseif($action == 'delete'
&& $id != 0)
{
$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
if (isset($result['databasename']) if(isset($result['databasename'])
&& $result['databasename'] != '' && $result['databasename'] != '')
) { {
if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) { if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
{
$result['dbserver'] = 0; $result['dbserver'] = 0;
} }
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// Begin root-session // Begin root-session
$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
$log->logAction(USR_ACTION, LOG_INFO, "deleted database '" . $result['databasename'] . "'");
if (mysql_get_server_info() < '5.0.2') {
// Revoke privileges (only required for MySQL 4.1.2 - 5.0.1)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($result['databasename']) .'\'',false,true);
}
$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($result['databasename']) . "'"); $db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
while ($host = $db_root->fetch_array($host_res)) { unset($db_root->password);
// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+) foreach(array_map('trim', array_unique(explode(',', $settings['system']['mysql_access_host']))) as $mysql_access_host)
$db_root->query('DROP USER \'' . $db_root->escape($result['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true); {
$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($result['databasename'])) . '` . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($result['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
} }
$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`'); $db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`');
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session // End root-session
$db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
$resetaccnumber = ($userinfo['mysqls_used'] == '1') ? " , `mysql_lastaccountnumber`='0' " : ''; if($userinfo['mysqls_used'] == '1')
{
$resetaccnumber = " , `mysql_lastaccountnumber`='0' ";
}
else
{
$resetaccnumber = '';
}
$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
else
{
$dbnamedesc = $result['databasename']; $dbnamedesc = $result['databasename'];
if (isset($result['description']) && $result['description'] != '') { if(isset($result['description']) && $result['description'] != '') {
$dbnamedesc .= ' ('.$result['description'].')'; $dbnamedesc.= ' ('.$result['description'].')';
} }
ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc); ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc);
} }
} }
} elseif ($action == 'add') { }
if ($userinfo['mysqls_used'] < $userinfo['mysqls'] elseif($action == 'add')
|| $userinfo['mysqls'] == '-1' {
) { if($userinfo['mysqls_used'] < $userinfo['mysqls']
if (isset($_POST['send']) || $userinfo['mysqls'] == '-1')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$password = validate($_POST['mysql_password'], 'password'); $password = validate($_POST['mysql_password'], 'password');
$password = validatePassword($password); $password = validatePassword($password);
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0; $sendinfomail = intval($_POST['sendinfomail']);
if ($sendinfomail != 1) { if($sendinfomail != 1)
{
$sendinfomail = 0; $sendinfomail = 0;
} }
if ($password == '') { if($password == '')
{
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
} else { }
$dbserver = 0; else
if (count($sql_root) > 1) { {
$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
if(count($sql_root) > 1)
{
$dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0); $dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0);
if (!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver])) {
if(!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver]))
{
$dbserver = 0; $dbserver = 0;
} }
} }
else
// validate description before actual adding the database, #1052 {
$databasedescription = validate(trim($_POST['description']), 'description'); $dbserver = 0;
// Begin root-session
$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
if (strtoupper($settings['customer']['mysqlprefix']) == 'RANDOM') {
$result = $db_root->query('SELECT `User` FROM mysql.user');
while ($row = $db_root->fetch_array($result)) {
$allsqlusers[] = $row[User];
}
$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
while (in_array($username , $allsqlusers)) {
$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
}
} else {
$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
} }
// Begin root-session
$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
unset($db_root->password);
$db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`'); $db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`');
$log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'"); $log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'");
foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) { foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\''); $db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\'');
$db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')'); $db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
$log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'");
@@ -172,21 +188,24 @@ if ($page == 'overview') {
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session
// Statement modified for Database description -- PH 2004-11-29 // End root-session
// Statement modifyed for Database description -- PH 2004-11-29
$databasedescription = validate($_POST['description'], 'description');
$result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")'); $result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")');
$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
if ($sendinfomail == 1) { if($sendinfomail == 1)
{
$pma = $lng['admin']['notgiven']; $pma = $lng['admin']['notgiven'];
if ($settings['panel']['phpmyadmin_url'] != '') { if($settings['panel']['phpmyadmin_url'] != '')
{
$pma = $settings['panel']['phpmyadmin_url']; $pma = $settings['panel']['phpmyadmin_url'];
} }
$replace_arr = array( $replace_arr = array(
'SALUTATION' => getCorrectUserSalutation($userinfo), 'CUST_NAME' => getCorrectUserSalutation($userinfo),
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
'DB_NAME' => $username, 'DB_NAME' => $username,
'DB_PASS' => $password, 'DB_PASS' => $password,
'DB_DESC' => $databasedescription, 'DB_DESC' => $databasedescription,
@@ -225,68 +244,73 @@ if ($page == 'overview') {
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} else { }
else
{
$mysql_servers = ''; $mysql_servers = '';
foreach ($sql_root as $mysql_server => $mysql_server_details) { foreach($sql_root as $mysql_server => $mysql_server_details)
{
$mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server); $mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server);
} }
//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0'); $sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
$mysql_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_add.php'; eval("echo \"" . getTemplate("mysql/mysqls_add") . "\";");
$mysql_add_form = htmlform::genHTMLForm($mysql_add_data);
$title = $mysql_add_data['mysql_add']['title'];
$image = $mysql_add_data['mysql_add']['image'];
eval("echo \"" . getTemplate('mysql/mysqls_add') . "\";");
} }
} }
} elseif ($action == 'edit' && $id != 0) { }
elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"'); $result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"');
if (isset($result['databasename']) if(isset($result['databasename'])
&& $result['databasename'] != '' && $result['databasename'] != '')
) { {
if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) { if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
{
$result['dbserver'] = 0; $result['dbserver'] = 0;
} }
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29 // Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29
$password = validate($_POST['mysql_password'], 'password'); $password = validate($_POST['mysql_password'], 'password');
if ($password != '') {
if($password != '')
{
// validate password // validate password
$password = validatePassword($password); $password = validatePassword($password);
// Begin root-session // Begin root-session
$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], ''); $db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) { unset($db_root->password);
foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')'); $db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
} }
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session // End root-session
} }
// Update the Database description -- PH 2004-11-29 // Update the Database description -- PH 2004-11-29
$log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'");
$databasedescription = validate($_POST['description'], 'description'); $databasedescription = validate($_POST['description'], 'description');
$result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
$mysql_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_edit.php'; else
$mysql_edit_form = htmlform::genHTMLForm($mysql_edit_data); {
eval("echo \"" . getTemplate("mysql/mysqls_edit") . "\";");
$title = $mysql_edit_data['mysql_edit']['title'];
$image = $mysql_edit_data['mysql_edit']['image'];
eval("echo \"" . getTemplate('mysql/mysqls_edit') . "\";");
} }
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -28,17 +28,6 @@ require ("./lib/init.php");
if(isset($_POST['id'])) if(isset($_POST['id']))
{ {
$id = intval($_POST['id']); $id = intval($_POST['id']);
/*
* Check if the current user is allowed to see the current ticket.
*/
$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `customerid` = '".$userinfo['customerid']."'";
$result = $db->query_first($sql);
if ($result == null) {
// no rights to see the requested ticket
standard_error(array('ticketnotaccessible'));
}
} }
elseif(isset($_GET['id'])) elseif(isset($_GET['id']))
{ {
@@ -48,7 +37,7 @@ elseif(isset($_GET['id']))
if($page == 'overview') if($page == 'overview')
{ {
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets");
eval("echo \"" . getTemplate("tickets/ticket") . "\";"); eval("echo \"" . getTemplate("ticket/ticket") . "\";");
} }
elseif($page == 'tickets') elseif($page == 'tickets')
{ {
@@ -66,7 +55,7 @@ elseif($page == 'tickets')
$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$paging->sortfield = 'lastchange'; $paging->sortfield = 'lastchange';
$paging->sortorder = 'desc'; $paging->sortorder = 'desc';
$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" AND `adminid`="' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -115,7 +104,7 @@ elseif($page == 'tickets')
$row['subject'] = substr($row['subject'], 0, 17) . '...'; $row['subject'] = substr($row['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
$count++; $count++;
} }
@@ -168,7 +157,7 @@ elseif($page == 'tickets')
} }
$ticketsopen = (int)$opentickets['count']; $ticketsopen = (int)$opentickets['count'];
eval("echo \"" . getTemplate("tickets/tickets") . "\";"); eval("echo \"" . getTemplate("ticket/tickets") . "\";");
} }
elseif($action == 'new') elseif($action == 'new')
{ {
@@ -221,12 +210,12 @@ elseif($page == 'tickets')
else else
{ {
$categories = ''; $categories = '';
$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC'); $result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
if(isset($result['name']) if(isset($result['name'])
&& $result['name'] != '') && $result['name'] != '')
{ {
$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC'); $result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
while($row = $db->fetch_array($result2)) while($row = $db->fetch_array($result2))
{ {
@@ -238,9 +227,9 @@ elseif($page == 'tickets')
$categories = makeoption($lng['ticket']['no_cat'], '0'); $categories = makeoption($lng['ticket']['no_cat'], '0');
} }
$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']); $priorities = makeoption($lng['ticket']['unf_high'], '1', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_normal'], '2', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_low'], '3', $settings['ticket']['default_priority']);
$ticketsopen = 0; $ticketsopen = 0;
$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '` $opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
WHERE `customerid` = "' . $userinfo['customerid'] . '" WHERE `customerid` = "' . $userinfo['customerid'] . '"
@@ -258,14 +247,7 @@ elseif($page == 'tickets')
} }
$ticketsopen = (int)$opentickets['count']; $ticketsopen = (int)$opentickets['count'];
eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
$ticket_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_add.php';
$ticket_add_form = htmlform::genHTMLForm($ticket_add_data);
$title = $ticket_add_data['ticket_add']['title'];
$image = $ticket_add_data['ticket_add']['image'];
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
} }
} }
else else
@@ -340,18 +322,12 @@ elseif($page == 'tickets')
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = getCorrectFullUserDetails($usr);
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -368,13 +344,12 @@ elseif($page == 'tickets')
} }
else else
{ {
$by = getCorrectFullUserDetails($usr); $by = $lng['ticket']['customer'];
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -385,13 +360,7 @@ elseif($page == 'tickets')
// don't forget the main-ticket! // don't forget the main-ticket!
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_reply.php'; eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
$title = $ticket_reply_data['ticket_reply']['title'];
$image = $ticket_reply_data['ticket_reply']['image'];
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
} }
} }
elseif($action == 'close' elseif($action == 'close'

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,20 +22,21 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
$intrafficpage = 1;
require('./lib/init.php'); require ("./lib/init.php");
$traffic = ''; $traffic = '';
$month = null; $month = null;
$year = null; $year = null;
if (isset($_POST['month']) if(isset($_POST['month'])
&& isset($_POST['year']) && isset($_POST['year']))
) { {
$month = intval($_POST['month']); $month = intval($_POST['month']);
$year = intval($_POST['year']); $year = intval($_POST['year']);
} elseif (isset($_GET['month']) }
&& isset($_GET['year']) elseif(isset($_GET['month'])
) { && isset($_GET['year']))
{
$month = intval($_GET['month']); $month = intval($_GET['month']);
$year = intval($_GET['year']); $year = intval($_GET['year']);
} }
@@ -43,25 +44,40 @@ if (isset($_POST['month'])
//BAM! $_GET??? //BAM! $_GET???
elseif (isset($_GET['page']) elseif (isset($_GET['page'])
&& $_GET['page'] == 'current' && $_GET['page'] == "current")
) { {
if (date('d') != '01') { if(date('d') != '01')
{
$month = date('m'); $month = date('m');
$year = date('Y'); $year = date('Y');
} else { }
if (date('m') == '01') { else
{
if(date('m') == '01')
{
$month = 12; $month = 12;
$year = date('Y') - 1; $year = date('Y') - 1;
} else { }
else
{
$month = date('m') - 1; $month = date('m') - 1;
$year = date('Y'); $year = date('Y');
} }
} }
} }
if (!is_null($month) if(!is_null($month)
&& !is_null($year)) { && !is_null($year))
{
$traf['byte'] = 0; $traf['byte'] = 0;
$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid`='" . $userinfo['customerid'] . "'
AND `month` = '" . $month . "'
AND `year` = '" . $year . "'");
$row = mysql_fetch_row($result);
rsort($row);
$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));;
$result = $db->query("SELECT $result = $db->query("SELECT
SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail', SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail',
`day`, `month`, `year` `day`, `month`, `year`
@@ -74,50 +90,106 @@ if (!is_null($month)
$traffic_complete['mail'] = 0; $traffic_complete['mail'] = 0;
$show = ''; $show = '';
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$http = $row['http']; $http = $row['http'];
$ftp = $row['ftp_up'] + $row['ftp_down']; $ftp = $row['ftp_up'] + $row['ftp_down'];
$mail = $row['mail']; $mail = $row['mail'];
$traf['byte'] = $http + $ftp + $mail; $traf['byte'] = $http + $ftp + $mail;
$traffic_complete['http'] += $http; $traffic_complete['http']+= $http;
$traffic_complete['ftp'] += $ftp; $traffic_complete['ftp']+= $ftp;
$traffic_complete['mail'] += $mail; $traffic_complete['mail']+= $mail;
$traf['day'] = $row['day'] . '.'; $traf['day'] = $row['day'];
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['ftp'] = bcdiv($ftp, 1024, $settings['panel']['decimal_places']); }
$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']); else
$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']); {
$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
} else {
$traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['http'] = round($http, $settings['panel']['decimal_places']); }
$traf['ftp'] = round($ftp, $settings['panel']['decimal_places']);
$traf['mail'] = round($mail, $settings['panel']['decimal_places']); if($traf['byte'] != 0
&& $traf['max'] != 0)
{
$proz = $traf['max'] / 100;
$traf['http'] = round($http / $proz, 0);
$traf['ftp'] = round($ftp / $proz, 0);
$traf['mail'] = round($mail / $proz, 0);
if($traf['http'] == 0)
{
$traf['http'] = 1;
}
if($traf['ftp'] == 0)
{
$traf['ftp'] = 1;
}
if($traf['mail'] == 0)
{
$traf['mail'] = 1;
}
}
else
{
$traf['http'] = 0;
$traf['ftp'] = 0;
$traf['mail'] = 0;
}
if(extension_loaded('bcmath'))
{
$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
}
else
{
$traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']); $traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']);
} }
eval("\$traffic.=\"" . getTemplate('traffic/traffic_month') . "\";"); eval("\$traffic.=\"" . getTemplate("traffic/traffic_month") . "\";");
$show = $lng['traffic']['months'][intval($row['month'])] . ' ' . $row['year']; $show = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
} }
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']);
} else { }
else
{
$traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']);
} }
eval("echo \"" . getTemplate('traffic/traffic_details') . "\";"); eval("echo \"" . getTemplate("traffic/traffic_details") . "\";");
} else { }
else
{
$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid`='" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
$nums = mysql_num_rows($result);
if($nums > 0)
{
$row = mysql_fetch_row($result);
rsort($row);
$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));
} else {
// no records yet
$traf['max'] = 0;
}
$result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail $result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail
FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "' FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12"); GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
@@ -125,49 +197,88 @@ if (!is_null($month)
$traffic_complete['ftp'] = 0; $traffic_complete['ftp'] = 0;
$traffic_complete['mail'] = 0; $traffic_complete['mail'] = 0;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$http = $row['http']; $http = $row['http'];
$ftp_up = $row['ftp_up']; $ftp_up = $row['ftp_up'];
$ftp_down = $row['ftp_down']; $ftp_down = $row['ftp_down'];
$mail = $row['mail']; $mail = $row['mail'];
$traffic_complete['http'] += $http; $traffic_complete['http']+= $http;
$traffic_complete['ftp'] += $ftp_up + $ftp_down; $traffic_complete['ftp']+= $ftp_up + $ftp_down;
$traffic_complete['mail'] += $mail; $traffic_complete['mail']+= $mail;
$traf['month'] = $row['month']; $traf['month'] = $row['month'];
$traf['year'] = $row['year']; $traf['year'] = $row['year'];
$traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year']; $traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
$traf['byte'] = $http + $ftp_up + $ftp_down + $mail; $traf['byte'] = $http + $ftp_up + $ftp_down + $mail;
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
$traf['ftptext'] = bcdiv($ftp_up, 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($ftp_down, 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; {
$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['ftptext'] = bcdiv($ftp_up, 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . bcdiv($ftp_down, 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['httptext'] = bcdiv($http, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
$traf['ftp'] = bcdiv(($ftp_up + $ftp_down), 1024, $settings['panel']['decimal_places']); $traf['mailtext'] = bcdiv($mail, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']); }
$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']); else
$traf['byte'] = bcdiv($traf['byte'], 1024 * 1024, $settings['panel']['decimal_places']); {
} else { $traf['ftptext'] = round($ftp_up / 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . round($ftp_down / 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
$traf['ftptext'] = round($ftp_up / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($ftp_down / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['httptext'] = round($http / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['mailtext'] = round($mail / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['ftp'] = round(($ftp_up + $ftp_down) / 1024, $settings['panel']['decimal_places']);
$traf['http'] = round($http / 1024, $settings['panel']['decimal_places']);
$traf['mail'] = round($mail / 1024, $settings['panel']['decimal_places']);
$traf['byte'] = round($traf['byte'] / (1024 * 1024), $settings['panel']['decimal_places']);
} }
eval("\$traffic.=\"" . getTemplate('traffic/traffic_traffic') . "\";"); if($traf['max'] != 0)
{
$proz = $traf['max'] / 100;
$traf['ftp'] = round(($ftp_up + $ftp_down) / $proz, 0);
$traf['http'] = round($http / $proz, 0);
$traf['mail'] = round($mail / $proz, 0);
if($traf['http'] == 0)
{
$traf['http'] = 1;
}
if($traf['ftp'] == 0)
{
$traf['ftp'] = 1;
}
if($traf['mail'] == 0)
{
$traf['mail'] = 1;
}
}
else
{
$traf['ftp'] = 0;
$traf['http'] = 0;
$traf['mail'] = 0;
}
if(extension_loaded('bcmath'))
{
$traf['byte'] = bcadd($traf['byte'] / (1024 * 1024), 0.0000, 4);
}
else
{
$traf['byte'] = round($traf['byte'] + (1024 * 1024), 4);
}
eval("\$traffic.=\"" . getTemplate("traffic/traffic_traffic") . "\";");
} }
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']);
} else { }
$traffic_complete['http'] = round($traffic_complete['http'] / (1024 * 1024), $settings['panel']['decimal_places']); else
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / (1024 * 1024), $settings['panel']['decimal_places']); {
$traffic_complete['mail'] = round($traffic_complete['mail'] / (1024 * 1024), $settings['panel']['decimal_places']); $traffic_complete['http'] = round($traffic_complete['http'] / 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024 * 1024, $settings['panel']['decimal_places']);
} }
eval("echo \"" . getTemplate('traffic/traffic') . "\";"); eval("echo \"" . getTemplate("traffic/traffic") . "\";");
} }
?>

BIN
images/ball.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 51 B

BIN
images/changelanguage.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.8 KiB

BIN
images/default.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.6 KiB

BIN
images/endsection.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.3 KiB

BIN
images/error.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.3 KiB

BIN
images/error.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.7 KiB

BIN
images/footer.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 21 KiB

BIN
images/header.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 16 KiB

BIN
images/header_r.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.2 KiB

BIN
images/info.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 2.9 KiB

BIN
images/login.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 2.0 KiB

BIN
images/logininternal.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.8 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 4.0 KiB

After

Width:  |  Height:  |  Size: 4.4 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.1 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 3.5 KiB

After

Width:  |  Height:  |  Size: 4.0 KiB

BIN
images/multiserver/view.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.5 KiB

BIN
images/order_asc.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 62 B

BIN
images/order_desc.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 60 B

BIN
images/section.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.3 KiB

BIN
images/shadow.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 86 B

BIN
images/subsection.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 3.6 KiB

BIN
images/title.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 69 B

View File

Before

Width:  |  Height:  |  Size: 66 B

After

Width:  |  Height:  |  Size: 66 B

View File

Before

Width:  |  Height:  |  Size: 82 B

After

Width:  |  Height:  |  Size: 82 B

View File

Before

Width:  |  Height:  |  Size: 105 B

After

Width:  |  Height:  |  Size: 105 B

View File

Before

Width:  |  Height:  |  Size: 827 B

After

Width:  |  Height:  |  Size: 827 B

279
index.php
View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'login'); define('AREA', 'login');
@@ -22,74 +22,106 @@ define('AREA', 'login');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require ('./lib/init.php');
if ($action == '') { require ("./lib/init.php");
if($action == '')
{
$action = 'login'; $action = 'login';
} }
if ($action == 'login') { if($action == 'login')
if (isset($_POST['send']) {
&& $_POST['send'] == 'send' if(isset($_POST['send'])
) { && $_POST['send'] == 'send')
{
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$password = validate($_POST['password'], 'password'); $password = validate($_POST['password'], 'password');
$row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($row['customer'] == $loginname) { if($row['customer'] == $loginname)
{
$table = "`" . TABLE_PANEL_CUSTOMERS . "`"; $table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid'; $uid = 'customerid';
$adminsession = '0'; $adminsession = '0';
$is_admin = false; $is_admin = false;
} else { }
$is_admin = true; else
if ((int)$settings['login']['domain_login'] == 1) { {
if((int)$settings['login']['domain_login'] == 1)
{
/** /**
* check if the customer tries to login with a domain, #374 * check if the customer tries to login with a domain, #374
*/ */
$domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname)); $domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname));
$row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'"); $row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'");
if (isset($row2['customerid']) && $row2['customerid'] > 0) { if(isset($row2['customerid']) && $row2['customerid'] > 0)
{
$loginname = getCustomerDetail($row2['customerid'], 'loginname'); $loginname = getCustomerDetail($row2['customerid'], 'loginname');
if ($loginname !== false) {
if($loginname !== false)
{
$row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($row3['customer'] == $loginname) {
if($row3['customer'] == $loginname)
{
$table = "`" . TABLE_PANEL_CUSTOMERS . "`"; $table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid'; $uid = 'customerid';
$adminsession = '0'; $adminsession = '0';
$is_admin = false; $is_admin = false;
} }
} }
else
{
$is_admin = true;
}
} }
else
{
$is_admin = true;
}
}
else
{
$is_admin = true;
} }
} }
if (hasUpdates($version) && $is_admin == false) { if(hasUpdates($version) && $is_admin == false)
{
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
if ($is_admin) { if($is_admin)
if (hasUpdates($version)) { {
if(hasUpdates($version))
{
$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'"); $row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'");
/* /*
* not an admin who can see updates * not an admin who can see updates
*/ */
if (!isset($row['admin'])) { if(!isset($row['admin']))
{
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
} else { }
else
{
$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
} }
if ($row['admin'] == $loginname) { if($row['admin'] == $loginname)
{
$table = "`" . TABLE_PANEL_ADMINS . "`"; $table = "`" . TABLE_PANEL_ADMINS . "`";
$uid = 'adminid'; $uid = 'adminid';
$adminsession = '1'; $adminsession = '1';
} else { }
else
{
redirectTo('index.php', Array('showmessage' => '2'), true); redirectTo('index.php', Array('showmessage' => '2'), true);
exit; exit;
} }
@@ -97,174 +129,191 @@ if ($action == 'login') {
$userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'"); $userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts'] if($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']) && $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']))
) { {
redirectTo('index.php', Array('showmessage' => '3'), true); redirectTo('index.php', Array('showmessage' => '3'), true);
exit; exit;
} elseif($userinfo['password'] == md5($password)) { }
elseif($userinfo['password'] == md5($password))
{
// login correct // login correct
// reset loginfail_counter, set lastlogin_succ // reset loginfail_counter, set lastlogin_succ
$db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'"); $db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
$userinfo['userid'] = $userinfo[$uid]; $userinfo['userid'] = $userinfo[$uid];
$userinfo['adminsession'] = $adminsession; $userinfo['adminsession'] = $adminsession;
} else { }
else
{
// login incorrect // login incorrect
$db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'"); $db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
unset($userinfo); unset($userinfo);
redirectTo('index.php', Array('showmessage' => '2'), true); redirectTo('index.php', Array('showmessage' => '2'), true);
exit; exit;
} }
if (isset($userinfo['userid']) if(isset($userinfo['userid'])
&& $userinfo['userid'] != '' && $userinfo['userid'] != '')
) { {
$s = md5(uniqid(microtime(), 1)); $s = md5(uniqid(microtime(), 1));
if (isset($_POST['language'])) { if(isset($_POST['language']))
{
$language = validate($_POST['language'], 'language'); $language = validate($_POST['language'], 'language');
if ($language == 'profile') {
if($language == 'profile')
{
$language = $userinfo['def_language']; $language = $userinfo['def_language'];
} elseif(!isset($languages[$language])) { }
elseif(!isset($languages[$language]))
{
$language = $settings['panel']['standardlanguage']; $language = $settings['panel']['standardlanguage'];
} }
} else { }
else
{
$language = $settings['panel']['standardlanguage']; $language = $settings['panel']['standardlanguage'];
} }
if (isset($userinfo['theme']) && $userinfo['theme'] != '') { if($settings['session']['allow_multiple_login'] != '1')
$theme = $userinfo['theme']; {
} else {
$theme = $settings['panel']['default_theme'];
}
if ($settings['session']['allow_multiple_login'] != '1') {
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'");
} }
// check for field 'theme' in session-table, refs #607 $db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
$fields = mysql_list_fields($db->getDbName(), TABLE_PANEL_SESSIONS);
$columns = mysql_num_fields($fields);
$field_array = array();
for ($i = 0; $i < $columns; $i++) {
$field_array[] = mysql_field_name($fields, $i);
}
if (!in_array('theme', $field_array)) { if($userinfo['adminsession'] == '1')
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')"); {
} else { if(hasUpdates($version))
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "', '" . $db->escape($theme) . "')"); {
}
if ($userinfo['adminsession'] == '1') {
if (hasUpdates($version)) {
redirectTo('admin_updates.php', Array('s' => $s), true); redirectTo('admin_updates.php', Array('s' => $s), true);
} else { exit;
redirectTo('admin_index.php', Array('s' => $s), true); }
else
{
redirectTo('admin_index.php', Array('s' => $s), true);
exit;
} }
} else {
redirectTo('customer_index.php', Array('s' => $s), true);
} }
} else { else
redirectTo('index.php', Array('showmessage' => '2'), true); {
redirectTo('customer_index.php', Array('s' => $s), true);
exit;
}
} }
exit; else
} else { {
redirectTo('index.php', Array('showmessage' => '2'), true);
exit;
}
}
else
{
$language_options = ''; $language_options = '';
$language_options .= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true); $language_options.= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
while (list($language_file, $language_name) = each($languages)) { while(list($language_file, $language_name) = each($languages))
$language_options .= makeoption($language_name, $language_file, 'profile', true); {
$language_options.= makeoption($language_name, $language_file, 'profile', true);
} }
$smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0; $smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0;
$message = ''; $message = '';
$successmessage = '';
switch ($smessage) { switch($smessage)
{
case 1: case 1:
$successmessage = $lng['pwdreminder']['success']; $message = $lng['pwdreminder']['success'];
break; break;
case 2: case 2:
$message = $lng['error']['login']; $message = $lng['error']['login'];
break; break;
case 3: case 3:
$message = sprintf($lng['error']['login_blocked'],$settings['login']['deactivatetime']); $message = $lng['error']['login_blocked'];
break; break;
case 4: case 4:
$cmail = isset($_GET['customermail']) ? $_GET['customermail'] : 'unknown'; $message = $lng['error']['errorsendingmail'];
$message = str_replace('%s', $cmail, $lng['error']['errorsendingmail']);
break;
case 5:
$message = $lng['error']['user_banned'];
break; break;
} }
$update_in_progress = ''; $update_in_progress = '';
if (hasUpdates($version)) { if(hasUpdates($version))
{
$update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin']; $update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin'];
} }
eval("echo \"" . getTemplate('login') . "\";"); eval("echo \"" . getTemplate("login") . "\";");
} }
} }
if ($action == 'forgotpwd') { if($action == 'forgotpwd')
{
$adminchecked = false; $adminchecked = false;
$message = ''; $message = '';
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$email = validateEmail($_POST['loginemail'], 'email'); $email = validateEmail($_POST['loginemail'], 'email');
$sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_CUSTOMERS . "` $sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_CUSTOMERS . "`
WHERE `loginname`='" . $db->escape($loginname) . "' WHERE `loginname`='" . $db->escape($loginname) . "'
AND `email`='" . $db->escape($email) . "'"; AND `email`='" . $db->escape($email) . "'";
$result = $db->query($sql); $result = $db->query($sql);
if ($db->num_rows() == 0) { if($db->num_rows() == 0)
{
$sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "` $sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "`
WHERE `loginname`='" . $db->escape($loginname) . "' WHERE `loginname`='" . $db->escape($loginname) . "'
AND `email`='" . $db->escape($email) . "'"; AND `email`='" . $db->escape($email) . "'";
$result = $db->query($sql); $result = $db->query($sql);
if ($db->num_rows() > 0) { if($db->num_rows() > 0)
{
$adminchecked = true; $adminchecked = true;
} else { }
else
{
$result = null; $result = null;
} }
} }
if ($result !== null) { if($result !== null)
{
$user = $db->fetch_array($result); $user = $db->fetch_array($result);
/* Check whether user is banned */ if(($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
if ($user['deactivated']) { || $adminchecked == false)
$message = $lng['pwdreminder']['notallowed']; {
redirectTo('index.php', Array('showmessage' => '5'), true); if($user !== false)
} {
if (($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
|| $adminchecked == false
) {
if ($user !== false) {
if ($settings['panel']['password_min_length'] <= 6) { if ($settings['panel']['password_min_length'] <= 6) {
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} else { } else {
// make it two times larger than password_min_length // make it two times larger than password_min_length
$rnd = ''; $rnd = '';
$minlength = $settings['panel']['password_min_length']; $minlength = $settings['panel']['password_min_length'];
while (strlen($rnd) < ($minlength * 2)) { while (strlen($rnd) < ($minlength * 2))
{
$rnd .= md5(uniqid(microtime(), 1)); $rnd .= md5(uniqid(microtime(), 1));
} }
$password = substr($rnd, (int)($minlength / 2), $minlength); $password = substr($rnd, (int)($minlength / 2), $minlength);
} }
$passwordTable = $adminchecked ? TABLE_PANEL_ADMINS : TABLE_PANEL_CUSTOMERS; if($adminchecked)
$db->query("UPDATE `" . $passwordTable . "` SET `password`='" . md5($password) . "' {
WHERE `loginname`='" . $user['loginname'] . "' $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `password`='" . md5($password) . "'
AND `email`='" . $user['email'] . "'"); WHERE `loginname`='" . $user['loginname'] . "'
AND `email`='" . $user['email'] . "'");
}
else
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($password) . "'
WHERE `loginname`='" . $user['loginname'] . "'
AND `email`='" . $user['email'] . "'");
}
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings); $rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!"); $rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
@@ -301,36 +350,44 @@ if ($action == 'forgotpwd') {
if ($_mailerror) { if ($_mailerror) {
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings); $rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg); $rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
redirectTo('index.php', Array('showmessage' => '4', 'customermail' => $user['email']), true); redirectTo('index.php', Array('showmessage' => '4'), true);
exit; exit;
} }
$mail->ClearAddresses(); $mail->ClearAddresses();
redirectTo('index.php', Array('showmessage' => '1'), true); redirectTo('index.php', Array('showmessage' => '1'), true);
exit; exit;
} else { }
else
{
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings); $rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!"); $rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
$message = $lng['login']['combination_not_found']; $message = $lng['login']['usernotfound'];
} }
unset($user); unset($user);
} }
} else {
$message = $lng['login']['usernotfound'];
} }
} }
if ($adminchecked) {
if ($settings['panel']['allow_preset_admin'] != '1') { if($adminchecked)
{
if($settings['panel']['allow_preset_admin'] != '1')
{
$message = $lng['pwdreminder']['notallowed']; $message = $lng['pwdreminder']['notallowed'];
unset ($adminchecked); unset ($adminchecked);
} }
} else { }
if ($settings['panel']['allow_preset'] != '1') { else
{
if($settings['panel']['allow_preset'] != '1')
{
$message = $lng['pwdreminder']['notallowed']; $message = $lng['pwdreminder']['notallowed'];
} }
} }
eval("echo \"" . getTemplate('fpwd') . "\";"); eval("echo \"" . getTemplate("fpwd") . "\";");
} }
?>

File diff suppressed because it is too large Load Diff

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
/** /**
@@ -37,10 +37,9 @@ if(file_exists('../lib/userdata.inc.php'))
require ('../lib/userdata.inc.php'); require ('../lib/userdata.inc.php');
if(isset($sql) if(isset($sql)
&& is_array($sql) && is_array($sql))
) { {
$installed_hint = file_get_contents('../templates/Froxlor/misc/alreadyinstalledhint.tpl'); die('Sorry, Froxlor is already configured...');
die($installed_hint);
} }
} }
@@ -95,49 +94,58 @@ if(file_exists('./lng/' . $language . '.lng.php'))
* BEGIN FUNCTIONS ----------------------------------------------- * BEGIN FUNCTIONS -----------------------------------------------
*/ */
function page_header() { function page_header()
{
?> ?>
<!DOCTYPE html> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
<html lang="en"> <html xmlns="http://www.w3.org/1999/xhtml">
<head> <head>
<meta charset="utf-8" /> <meta content="text/html; charset=ISO-8859-1" http-equiv="content-type" />
<meta http-equiv="Default-Style" content="text/css" /> <link rel="stylesheet" href="../templates/main.css" type="text/css" />
<link rel="stylesheet" href="../templates/Froxlor/assets/css/main.css" /> <title>Froxlor</title>
<!--[if IE]><link rel="stylesheet" href="../templates/Froxlor/assets/css/main_ie.css" /><![endif]-->
<!--[if lt IE 9]><script src="http://html5shiv.googlecode.com/svn/trunk/html5.js"></script><![endif]-->
<script type="text/javascript" src="../js/jquery.min.js"></script>
<script type="text/javascript" src="../templates/Froxlor/assets/js/main.js"></script>
<link href="../templates/Froxlor/assets/img/favicon.ico" rel="icon" type="image/x-icon" />
<title>Froxlor Server Management Panel - Installation</title>
<style>
body {
font-family: Verdana, Geneva, sans-serif;
}
input {
background: #dae7ee url('../templates/Froxlor/assets/img/icons/text_align_left.png') no-repeat 5px 4px;
}
input[type="password"] {
background: #dae7ee url('../templates/Froxlor/assets/img/icons/password.png') no-repeat 4px 4px;
}
input[type="submit"] {
background: #ccc url('../templates/Froxlor/assets/img/icons/button_ok.png') no-repeat 4px 8px;
}
</style>
</head> </head>
<body> <body style="margin: 0; padding: 0;" onload="document.loginform.loginname.focus()">
<div class="loginpage"> <!--
We request you retain the full copyright notice below including the link to www.froxlor.org.
This not only gives respect to the large amount of time given freely by the developers
but also helps build interest, traffic and use of Froxlor. If you refuse
to include even this then support on our forums may be affected.
The Froxlor Team : 2009-2010
// -->
<!--
Templates based on work by Luca Piona (info@havanastudio.ch) and Luca Longinotti (chtekk@gentoo.org)
// -->
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td width="800"><img src="../images/header.gif" width="800" height="90" alt="" /></td>
<td class="header">&nbsp;</td>
</tr>
</table>
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td valign="top" bgcolor="#FFFFFF">
<br />
<br />
<?php <?php
} }
function page_footer() { function page_footer()
{
?> ?>
</div> </td>
<footer> </tr>
<span> </table>
Froxlor &copy; 2009-<?php echo date('Y', time()); ?> by <a href="http://www.froxlor.org/" rel="external">the Froxlor Team</a> <table cellspacing="0" cellpadding="0" border="0" width="100%">
</span> <tr>
</footer> <td width="100%" class="footer">
</body> <br />Froxlor &copy; 2009-2010 by <a href="http://www.froxlor.org/" target="_blank">the Froxlor Team</a>
<br /><br/>
</td>
</tr>
</table>
</body>
</html> </html>
<?php <?php
} }
@@ -146,30 +154,24 @@ function status_message($case, $text)
{ {
if($case == 'begin') if($case == 'begin')
{ {
echo '<tr><td>'.$text; echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\">$text";
} }
else else
{ {
echo '</td><td class="installstatus"> echo " <span style=\"color:$case;\">$text</span></td>\n\t\t</tr>\n";
<span style="color:'.$case.';">'.$text.'</span>
</td></tr>';
} }
} }
function requirement_checks() { function requirement_checks()
{
global $lng, $theme; global $lng;
page_header(); page_header();
?> ?>
<article class="install bradius"> <table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
<header class="dark"> <tr>
<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" /> <td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
</header> </tr>
<section class="installsec">
<h2>Requirements</h2>
<table class="noborder">
<?php <?php
$_die = false; $_die = false;
@@ -199,10 +201,9 @@ function requirement_checks() {
status_message('green', 'OK'); status_message('green', 'OK');
} }
// check for mysql-extension
status_message('begin', $lng['install']['phpmysql']); status_message('begin', $lng['install']['phpmysql']);
if(!extension_loaded('mysql') && !extension_loaded('mysqlnd')) if(!extension_loaded('mysql'))
{ {
status_message('red', $lng['install']['notinstalled']); status_message('red', $lng['install']['notinstalled']);
$_die = true; $_die = true;
@@ -212,7 +213,6 @@ function requirement_checks() {
status_message('green', 'OK'); status_message('green', 'OK');
} }
// check for xml-extension
status_message('begin', $lng['install']['phpxml']); status_message('begin', $lng['install']['phpxml']);
if(!extension_loaded('xml')) if(!extension_loaded('xml'))
@@ -225,7 +225,8 @@ function requirement_checks() {
status_message('green', 'OK'); status_message('green', 'OK');
} }
// check for filter-extension
status_message('begin', $lng['install']['phpfilter']); status_message('begin', $lng['install']['phpfilter']);
if(!extension_loaded('filter')) if(!extension_loaded('filter'))
@@ -238,7 +239,6 @@ function requirement_checks() {
status_message('green', 'OK'); status_message('green', 'OK');
} }
// check for posix-extension
status_message('begin', $lng['install']['phpposix']); status_message('begin', $lng['install']['phpposix']);
if(!extension_loaded('posix')) if(!extension_loaded('posix'))
@@ -251,7 +251,6 @@ function requirement_checks() {
status_message('green', 'OK'); status_message('green', 'OK');
} }
// check for bcmath extension
status_message('begin', $lng['install']['phpbcmath']); status_message('begin', $lng['install']['phpbcmath']);
if(!extension_loaded('bcmath')) if(!extension_loaded('bcmath'))
@@ -263,7 +262,6 @@ function requirement_checks() {
status_message('green', 'OK'); status_message('green', 'OK');
} }
// check for open_basedir
status_message('begin', $lng['install']['openbasedir']); status_message('begin', $lng['install']['openbasedir']);
$php_ob = @ini_get("open_basedir"); $php_ob = @ini_get("open_basedir");
@@ -277,32 +275,30 @@ function requirement_checks() {
status_message('green', 'OK'); status_message('green', 'OK');
} }
?>
</table>
<?php
if($_die) if($_die)
{ {
?> ?>
<p style="padding-left:15px;"> <tr>
<strong><?php echo $lng['install']['diedbecauseofrequirements']; ?></strong> <td class="main_field_display" align="center">
</p> <?php echo $lng['install']['diedbecauseofrequirements']; ?><br />
<p class="submit"> <a href="install.php"><?php echo $lng['install']['click_here_to_refresh']; ?></a>
<a href="install.php"><?php echo $lng['install']['click_here_to_refresh']; ?></a> </td>
</p> </tr>
<?php <?php
} else { } else {
?> ?>
<p style="padding-left:15px;"> <tr>
<strong><?php echo $lng['install']['froxlor_succ_checks']; ?></strong> <td class="main_field_display" align="center">
</p> <?php echo $lng['install']['froxlor_succ_checks']; ?><br />
<p class="submit"> <a href="install.php?check=1"><?php echo $lng['install']['click_here_to_continue']; ?></a>
<a href="install.php?check=1"><?php echo $lng['install']['click_here_to_continue']; ?></a> </td>
</p> </tr>
<?php <?php
} }
?> ?>
</section> </table>
</article> <br />
<br />
<?php <?php
page_footer(); page_footer();
} }
@@ -522,14 +518,10 @@ if(isset($_POST['installstep'])
page_header(); page_header();
?> ?>
<article class="install bradius"> <table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
<header class="dark"> <tr>
<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" /> <td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
</header> </tr>
<section class="installsec">
<h2>Installation</h2>
<table class="noborder">
<?php <?php
//first test if we can access the database server with the given root user and password //first test if we can access the database server with the given root user and password
@@ -677,6 +669,8 @@ if(isset($_POST['installstep'])
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($languages[$language]) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'standardlanguage'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($languages[$language]) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'standardlanguage'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($mysql_access_host) . "' WHERE `settinggroup` = 'system' AND `varname` = 'mysql_access_host'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($mysql_access_host) . "' WHERE `settinggroup` = 'system' AND `varname` = 'mysql_access_host'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpuser) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpuser'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpuser) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpuser'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpgroup) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpgroup) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'");
@@ -694,16 +688,19 @@ if(isset($_POST['installstep'])
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/lighttpd reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/lighttpd reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/lighttpd.pem' WHERE `settinggroup` = 'system' AND `varname` = 'ssl_cert_file'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/lighttpd.pem' WHERE `settinggroup` = 'system' AND `varname` = 'ssl_cert_file'");
$ssettings = '';
} }
elseif($webserver == "nginx") elseif($webserver == "nginx")
{ {
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/nginx reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'"); $db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/nginx reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
$ssettings = '';
} }
// insert the lastcronrun to be the installation date // insert the lastcronrun to be the installation date
$query = 'UPDATE `%s` SET `value` = UNIX_TIMESTAMP() WHERE `settinggroup` = \'system\' AND `varname` = \'lastcronrun\''; $query = 'UPDATE `%s` SET `value` = UNIX_TIMESTAMP() WHERE `settinggroup` = \'system\' AND `varname` = \'lastcronrun\'';
$query = sprintf($query, TABLE_PANEL_SETTINGS); $query = sprintf($query, TABLE_PANEL_SETTINGS);
$db->query($query); $db->query($query);
@@ -716,6 +713,7 @@ if(isset($_POST['installstep'])
$db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_ticketarchive.php';"); $db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_ticketarchive.php';");
// and lets insert the default ip and port // and lets insert the default ip and port
$query = "INSERT INTO `".TABLE_PANEL_IPSANDPORTS."` $query = "INSERT INTO `".TABLE_PANEL_IPSANDPORTS."`
SET `ip`= '".$db->escape($serverip)."', SET `ip`= '".$db->escape($serverip)."',
`port` = '80', `port` = '80',
@@ -726,12 +724,14 @@ if(isset($_POST['installstep'])
$defaultip = $db->insert_id(); $defaultip = $db->insert_id();
// insert the defaultip // insert the defaultip
$query = 'UPDATE `%s` SET `value` = \'%s\' WHERE `settinggroup` = \'system\' AND `varname` = \'defaultip\''; $query = 'UPDATE `%s` SET `value` = \'%s\' WHERE `settinggroup` = \'system\' AND `varname` = \'defaultip\'';
$query = sprintf($query, TABLE_PANEL_SETTINGS, $db->escape($defaultip)); $query = sprintf($query, TABLE_PANEL_SETTINGS, $db->escape($defaultip));
$db->query($query); $db->query($query);
status_message('green', 'OK'); status_message('green', 'OK');
//last but not least create the main admin //last but not least create the main admin
status_message('begin', $lng['install']['adding_admin_user']); status_message('begin', $lng['install']['adding_admin_user']);
$db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET $db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET
`loginname` = '" . $db->escape($admin_user) . "', `loginname` = '" . $db->escape($admin_user) . "',
@@ -763,7 +763,6 @@ if(isset($_POST['installstep'])
`ftps_used` = 0, `ftps_used` = 0,
`tickets` = -1, `tickets` = -1,
`tickets_used` = 0, `tickets_used` = 0,
`tickets_see_all` = 1,
`subdomains` = -1, `subdomains` = -1,
`subdomains_used` = 0, `subdomains_used` = 0,
`traffic` = -1048576, `traffic` = -1048576,
@@ -776,6 +775,7 @@ if(isset($_POST['installstep'])
status_message('green', 'OK'); status_message('green', 'OK');
//now we create the userdata.inc.php with the mysql-accounts //now we create the userdata.inc.php with the mysql-accounts
status_message('begin', $lng['install']['creating_configfile']); status_message('begin', $lng['install']['creating_configfile']);
$userdata = "<?php\n"; $userdata = "<?php\n";
$userdata.= "//automatically generated userdata.inc.php for Froxlor\n"; $userdata.= "//automatically generated userdata.inc.php for Froxlor\n";
@@ -790,6 +790,7 @@ if(isset($_POST['installstep'])
$userdata.= "?>"; $userdata.= "?>";
//we test now if we can store the userdata.inc.php in ../lib //we test now if we can store the userdata.inc.php in ../lib
if($fp = @fopen('../lib/userdata.inc.php', 'w')) if($fp = @fopen('../lib/userdata.inc.php', 'w'))
{ {
$result = @fputs($fp, $userdata, strlen($userdata)); $result = @fputs($fp, $userdata, strlen($userdata));
@@ -811,15 +812,15 @@ if(isset($_POST['installstep'])
} }
?> ?>
</table> <tr>
<p style="padding-left: 15px;"> <td class="main_field_display" align="center">
<strong><?php echo $lng['install']['froxlor_succ_installed']; ?></strong> <?php echo $lng['install']['froxlor_succ_installed']; ?><br />
</p> <a href="../index.php"><?php echo $lng['install']['click_here_to_login']; ?></a>
<p class="submit"> </td>
<a href="../index.php"><?php echo $lng['install']['click_here_to_login']; ?></a> </tr>
</p> </table>
</section> <br />
</article> <br />
<?php <?php
page_footer(); page_footer();
} }
@@ -834,124 +835,116 @@ else
page_header(); page_header();
?> ?>
<article class="install bradius"> <form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="get">
<header class="dark"> <input type="hidden" name="check" value="1" />
<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" /> <table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
</header> <tr>
<section class="installsec"> <td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['welcome']; ?></b></td>
<h2><?php echo $lng['install']['language']; ?></h2> </tr>
<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="get"> <tr>
<fieldset> <td class="main_field_name" colspan="2"><?php echo $lng['install']['welcometext']; ?></td>
<legend>Froxlor&nbsp;-&nbsp;Install</legend> </tr>
<p> <tr>
<label for="language"><?php echo $lng['install']['language']; ?>:</label>&nbsp; <td class="main_field_name"><?php echo $lng['install']['language']; ?>: </td>
<select name="language" id="language"> <td class="main_field_display" nowrap="nowrap">
<?php <select name="language" class="dropdown_noborder"><?php
$language_options = ''; $language_options = '';
while(list($language_file, $language_name) = each($languages)) {
$language_options.= makeoption($language_name, $language_file, $language, true, true); while(list($language_file, $language_name) = each($languages))
} {
echo $language_options; $language_options.= "\n\t\t\t\t\t\t" . makeoption($language_name, $language_file, $language, true, true);
?> }
echo $language_options;
?>
</select> </select>
</p> </td>
<p class="submit"> </tr>
<input type="hidden" name="check" value="1" /> <tr>
<input type="submit" name="chooselang" value="Go" /> <td class="main_field_confirm" colspan="2">
</p> <input class="bottom" type="submit" name="chooselang" value="Go" />
</fieldset> </td>
</form> </tr>
<aside>&nbsp;</aside> </table>
</section> </form>
<section class="installsec"> <br />
<h2><?php echo $lng['install']['installdata']; ?></h2> <form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="post">
<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="post"> <input type="hidden" name="check" value="1" />
<fieldset> <table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
<legend>Froxlor&nbsp;-&nbsp;Install</legend> <tr>
<p> <td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['database']; ?></b></td>
<strong><?php echo $lng['install']['database']; ?></strong> </tr>
</p> <tr>
<p> <td class="main_field_name"><?php echo $lng['install']['mysql_hostname']; ?>:</td>
<label for="mysql_host"><?php echo $lng['install']['mysql_hostname']; ?>:</label>&nbsp; <td class="main_field_display"><input type="text" name="mysql_host" value="<?php echo htmlspecialchars($mysql_host); ?>"/></td>
<input type="text" name="mysql_host" id="mysql_host" value="<?php echo htmlspecialchars($mysql_host); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"><?php echo $lng['install']['mysql_database']; ?>:</td>
<label for="mysql_database"><?php echo $lng['install']['mysql_database']; ?>:</label>&nbsp; <td class="main_field_display"><input type="text" name="mysql_database" value="<?php echo htmlspecialchars($mysql_database); ?>"/></td>
<input type="text" name="mysql_database" id="mysql_database" value="<?php echo htmlspecialchars($mysql_database); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_user']; ?>:</td>
<label for="mysql_unpriv_user"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_user']; ?>:</label>&nbsp; <td class="main_field_display"><input type="text" name="mysql_unpriv_user" value="<?php echo htmlspecialchars($mysql_unpriv_user); ?>"/></td>
<input type="text" name="mysql_unpriv_user" id="mysql_unpriv_user" value="<?php echo htmlspecialchars($mysql_unpriv_user); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_unpriv_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_pass']; ?>:</td>
<label for="mysql_unpriv_pass"<?php echo ((!empty($_POST['installstep']) && $mysql_unpriv_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_pass']; ?>:</label>&nbsp; <td class="main_field_display"><input type="password" name="mysql_unpriv_pass" value="<?php echo htmlspecialchars($mysql_unpriv_pass); ?>"/></td>
<input type="password" name="mysql_unpriv_pass" id="mysql_unpriv_pass" value="<?php echo htmlspecialchars($mysql_unpriv_pass); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_root_user']; ?>:</td>
<label for="mysql_root_user"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_root_user']; ?>:</label>&nbsp; <td class="main_field_display"><input type="text" name="mysql_root_user" value="<?php echo htmlspecialchars($mysql_root_user); ?>"/></td>
<input type="text" name="mysql_root_user" id="mysql_root_user" value="<?php echo htmlspecialchars($mysql_root_user); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_root_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_root_pass']; ?>:</td>
<label for="mysql_root_pass"<?php echo ((!empty($_POST['installstep']) && $mysql_root_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_root_pass']; ?>:</label>&nbsp; <td class="main_field_display"><input type="password" name="mysql_root_pass" value="<?php echo htmlspecialchars($mysql_root_pass); ?>"/></td>
<input type="password" name="mysql_root_pass" id="mysql_root_pass" value="<?php echo htmlspecialchars($mysql_root_pass); ?>" required/> </tr>
</p> <tr>
<p> <td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['admin_account']; ?></b></td>
<strong><?php echo $lng['install']['admin_account']; ?></strong> </tr>
</p> <tr>
<p> <td class="main_field_name"><?php echo $lng['install']['admin_user']; ?>:</td>
<label for="admin_user"><?php echo $lng['install']['admin_user']; ?>:</label>&nbsp; <td class="main_field_display"><input type="text" name="admin_user" value="<?php echo htmlspecialchars($admin_user); ?>"/></td>
<input type="text" name="admin_user" id="admin_user" value="<?php echo htmlspecialchars($admin_user); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass1 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass']; ?>:</td>
<label for="admin_pass1"<?php echo ((!empty($_POST['installstep']) && ($admin_pass1 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass']; ?>:</label>&nbsp; <td class="main_field_display"><input type="password" name="admin_pass1" value="<?php echo htmlspecialchars($admin_pass1); ?>"/></td>
<input type="password" name="admin_pass1" id="admin_pass1" value="<?php echo htmlspecialchars($admin_pass1); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass2 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass_confirm']; ?>:</td>
<label for="admin_pass2"<?php echo ((!empty($_POST['installstep']) && ($admin_pass2 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass_confirm']; ?>:</label>&nbsp; <td class="main_field_display"><input type="password" name="admin_pass2" value="<?php echo htmlspecialchars($admin_pass2); ?>"/></td>
<input type="password" name="admin_pass2" id="admin_pass2" value="<?php echo htmlspecialchars($admin_pass2); ?>" required/> </tr>
</p> <tr>
<p> <td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['serversettings']; ?></b></td>
<strong><?php echo $lng['install']['serversettings']; ?></strong> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $servername == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['servername']; ?>:</td>
<label for="servername"<?php echo ((!empty($_POST['installstep']) && $servername == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['servername']; ?>:</label>&nbsp; <td class="main_field_display"><input type="text" name="servername" value="<?php echo htmlspecialchars($servername); ?>"/></td>
<input type="text" name="servername" id="servername" value="<?php echo htmlspecialchars($servername); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['serverip']; ?>:</td>
<label for="serverip"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['serverip']; ?>:</label>&nbsp; <td class="main_field_display"><input type="text" name="serverip" value="<?php echo htmlspecialchars($serverip); ?>"/></td>
<input type="text" name="serverip" id="serverip" value="<?php echo htmlspecialchars($serverip); ?>" required/> </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?>:</td>
<label for="apache"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?> Apache:</label>&nbsp; <td class="main_field_display"><input type="radio" name="webserver" value="apache2" <?php echo $webserver == "apache2" ? 'checked="checked"' : "" ?>/>Apache2&nbsp;<br /><input type="radio" name="webserver" value="lighttpd" <?php echo $webserver == "lighttpd" ? 'checked="checked"' : "" ?>/>Lighttpd2&nbsp;<br /><input type="radio" name="webserver" value="nginx" <?php echo $webserver == "nginx" ? 'checked="checked"' : "" ?>/>Nginx</td>
<input type="radio" name="webserver" id="apache" value="apache2" <?php echo $webserver == "apache2" ? 'checked="checked"' : "" ?>/>Apache2 </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpuser']; ?>:</td>
<label for="lighty"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?> LigHTTPd:</label>&nbsp; <td class="main_field_display"><input type="text" name="httpuser" value="<?php $posixusername = posix_getpwuid(posix_getuid()); echo $posixusername['name']; ?>"/></td>
<input type="radio" name="webserver" id="lighty" value="lighttpd" <?php echo $webserver == "lighttpd" ? 'checked="checked"' : "" ?>/>LigHTTPd </tr>
</p> <tr>
<p> <td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpgroup']; ?>:</td>
<label for="nginx"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?> Nginx:</label>&nbsp; <td class="main_field_display"><input type="text" name="httpgroup" value="<?php $posixgroup = posix_getgrgid(posix_getgid()); echo $posixgroup['name']; ?>"/></td>
<input type="radio" name="webserver" id="nginx" value="nginx" <?php echo $webserver == "nginx" ? 'checked="checked"' : "" ?>/>Nginx </tr>
</p> <tr>
<p> <td class="main_field_confirm" colspan="2"><input type="hidden" name="language" value="<?php echo htmlspecialchars($language); ?>"/><input type="hidden" name="installstep" value="1"/><input class="bottom" type="submit" name="submitbutton" value="<?php echo $lng['install']['next']; ?>"/></td>
<label for="httpuser"<?php echo ((!empty($_POST['installstep']) && $httpuser == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpuser']; ?>:</label>&nbsp; </tr>
<input type="text" name="httpuser" id="httpuser" value="<?php $posixusername = posix_getpwuid(posix_getuid()); echo $posixusername['name']; ?>" required/> </table>
</p> </form>
<p> <br />
<label for="httpgroup"<?php echo ((!empty($_POST['installstep']) && $httpgroup == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpgroup']; ?>:</label>&nbsp; <br />
<input type="text" name="httpgroup" id="httpgroup" value="<?php $posixgroup = posix_getgrgid(posix_getgid()); echo $posixgroup['name']; ?>" required/>
</p>
<p class="submit">
<input type="hidden" name="check" value="1" />
<input type="hidden" name="language" value="<?php echo htmlspecialchars($language); ?>"/>
<input type="hidden" name="installstep" value="1"/>
<input class="bottom" type="submit" name="submitbutton" value="<?php echo $lng['install']['next']; ?>"/>
</p>
</fieldset>
</form>
<aside>&nbsp;</aside>
</section>
</article>
<?php <?php
page_footer(); page_footer();
} }
@@ -964,3 +957,5 @@ else
/** /**
* END INSTALL --------------------------------------------------- * END INSTALL ---------------------------------------------------
*/ */
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
/** /**
@@ -42,7 +42,6 @@ $lng['install']['httpuser'] = 'HTTP username';
$lng['install']['httpgroup'] = 'HTTP groupname'; $lng['install']['httpgroup'] = 'HTTP groupname';
$lng['install']['apacheversion'] = 'Apacheversion'; $lng['install']['apacheversion'] = 'Apacheversion';
$lng['install']['next'] = 'Next'; $lng['install']['next'] = 'Next';
$lng['install']['installdata'] = 'Installation - Data';
/** /**
* Progress * Progress
@@ -73,12 +72,6 @@ $lng['install']['bcmathdescription'] = 'Traffic-calculation related functions wi
$lng['install']['openbasedir'] = 'Testing if open_basedir is enabled...'; $lng['install']['openbasedir'] = 'Testing if open_basedir is enabled...';
$lng['install']['openbasedirenabled'] = 'enabled. Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor'; $lng['install']['openbasedirenabled'] = 'enabled. Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor';
/**
* ADDED IN 1.2.19-svn7
*/
$lng['install']['servername_should_be_fqdn'] = 'The servername should be a FQDN and not an IP address';
/** /**
* Renamed in 1.2.19-svn40 * Renamed in 1.2.19-svn40
*/ */

View File

@@ -15,7 +15,7 @@
* @author Froxlor Team <team@froxlor.org> * @author Froxlor Team <team@froxlor.org>
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
/** /**
@@ -23,16 +23,16 @@
*/ */
$lng['install']['language'] = 'Langue d\'installation'; $lng['install']['language'] = 'Langue d\'installation';
$lng['install']['welcome'] = 'Bienvenue <20> l\'installation de Froxlor'; $lng['install']['welcome'] = 'Bienvenue <20> l\'installation de Froxlor';
$lng['install']['welcometext'] = 'Merci beaucoup d\'avoir choisi Froxlor. Pour installer Froxlor remplissez les cases ci-dessous avec les informations demand<6E>es.<br /><b>Attention :</b> Si vous entrez le nom d\'une base de donn<6E>es existante, celle-ci sera effac<61>e !'; $lng['install']['welcometext'] = 'Merci beaucoup d\'avoir choisi Froxlor. Pour installer Froxlor remplissez les cases ci-dessous avec les informations demand<6E>es.<br /><b>Attention :</b> Si vous entrez le nom d\'une base de donn<6E>es existante, celle-ci sera effac<61>e !';
$lng['install']['database'] = 'Base de donn<6E>es'; $lng['install']['database'] = 'Base de donn<6E>es';
$lng['install']['mysql_hostname'] = 'Nom d\'h<>te du serveur MySQL'; $lng['install']['mysql_hostname'] = 'Nom d\'h<>te du serveur MySQL';
$lng['install']['mysql_database'] = 'Base de donn<6E>es MySQL'; $lng['install']['mysql_database'] = 'Base de donn<6E>es MySQL';
$lng['install']['mysql_unpriv_user'] = 'Utilisateur pour l\'acc<63>s non privil<69>gi<67> <20> MySQL'; $lng['install']['mysql_unpriv_user'] = 'Utilisateur pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
$lng['install']['mysql_unpriv_pass'] = 'Mot de passe pour l\'acc<63>s non privil<69>gi<67> <20> MySQL'; $lng['install']['mysql_unpriv_pass'] = 'Mot de passe pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
$lng['install']['mysql_root_user'] = 'Utilisateur pour l\'acc<63>s root <20> MySQL'; $lng['install']['mysql_root_user'] = 'Utilisateur pour l\'acc<63>s root <20> MySQL';
$lng['install']['mysql_root_pass'] = 'Mot de passe pour l\'acc<63>s root <20> MySQL'; $lng['install']['mysql_root_pass'] = 'Mot de passe pour l\'acc<63>s root <20> MySQL';
$lng['install']['admin_account'] = 'Acc<63>s administratif'; $lng['install']['admin_account'] = 'Acc<63>s administratif';
$lng['install']['admin_user'] = 'Login de l\'administrateur'; $lng['install']['admin_user'] = 'Login de l\'administrateur';
$lng['install']['admin_pass'] = 'Mot de passe de l\'administrateur'; $lng['install']['admin_pass'] = 'Mot de passe de l\'administrateur';
$lng['install']['admin_pass_confirm'] = 'Mot de passe de l\'administrateur (confirmation)'; $lng['install']['admin_pass_confirm'] = 'Mot de passe de l\'administrateur (confirmation)';
@@ -41,39 +41,32 @@ $lng['install']['servername'] = 'Nom du serveur (FQDN)';
$lng['install']['serverip'] = 'Adresse IP du serveur'; $lng['install']['serverip'] = 'Adresse IP du serveur';
$lng['install']['apacheversion'] = 'Version du serveur Apache'; $lng['install']['apacheversion'] = 'Version du serveur Apache';
$lng['install']['next'] = 'Continuer'; $lng['install']['next'] = 'Continuer';
$lng['install']['installdata'] = 'Installation - Data';
/** /**
* Progress * Progress
*/ */
$lng['install']['testing_mysql'] = 'V<>rification du login root de MySQL ...'; $lng['install']['testing_mysql'] = 'V<>rification du login root de MySQL ...';
$lng['install']['erasing_old_db'] = 'Effacement de l\'ancienne base de donn<6E>es ...'; $lng['install']['erasing_old_db'] = 'Effacement de l\'ancienne base de donn<6E>es ...';
$lng['install']['create_mysqluser_and_db'] = 'Cr<43>ation de la base de donn<6E>es puis des utilisateurs ...'; $lng['install']['create_mysqluser_and_db'] = 'Cr<43>ation de la base de donn<6E>es puis des utilisateurs ...';
$lng['install']['testing_new_db'] = 'V<>rification de la base de donn<6E>es et des utilisateurs ...'; $lng['install']['testing_new_db'] = 'V<>rification de la base de donn<6E>es et des utilisateurs ...';
$lng['install']['importing_data'] = 'Importation des informations dans la base de donn<6E>es ...'; $lng['install']['importing_data'] = 'Importation des informations dans la base de donn<6E>es ...';
$lng['install']['changing_data'] = 'Modification des donn<6E>es import<72>s ...'; $lng['install']['changing_data'] = 'Modification des donn<6E>es import<72>s ...';
$lng['install']['adding_admin_user'] = 'Ajout de l\'utilisateur administrateur ...'; $lng['install']['adding_admin_user'] = 'Ajout de l\'utilisateur administrateur ...';
$lng['install']['creating_configfile'] = 'Cr<43>ation du fichier de configuration ...'; $lng['install']['creating_configfile'] = 'Cr<43>ation du fichier de configuration ...';
$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php a <20>t<EFBFBD> sauvegard<72> dans le dossier lib/ de Froxlor.'; $lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php a <20>t<EFBFBD> sauvegard<72> dans le dossier lib/ de Froxlor.';
$lng['install']['creating_configfile_temp'] = 'Le fichier a <20>t<EFBFBD> sauvegard<72> dans /tmp/userdata.inc.php, veuillez le d<>placer / copier dans le dossier lib/ de Froxlor.'; $lng['install']['creating_configfile_temp'] = 'Le fichier a <20>t<EFBFBD> sauvegard<72> dans /tmp/userdata.inc.php, veuillez le d<>placer / copier dans le dossier lib/ de Froxlor.';
$lng['install']['creating_configfile_failed'] = 'Erreur en cr<63>ant le fichier lib/userdata.inc.php, veuillez le cr<63>er avec le contenu ci-dessous :'; $lng['install']['creating_configfile_failed'] = 'Erreur en cr<63>ant le fichier lib/userdata.inc.php, veuillez le cr<63>er avec le contenu ci-dessous :';
$lng['install']['froxlor_succ_installed'] = 'Froxlor a <20>t<EFBFBD> install<6C> correctement.'; $lng['install']['froxlor_succ_installed'] = 'Froxlor a <20>t<EFBFBD> install<6C> correctement.';
$lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'invite de connexion.'; $lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'invite de connexion.';
$lng['install']['httpuser'] = 'Nom du utilisateur du HTTP'; $lng['install']['httpuser'] = 'Nom du utilisateur du HTTP';
$lng['install']['httpgroup'] = 'Nom du la group du HTTP'; $lng['install']['httpgroup'] = 'Nom du la group du HTTP';
/**
* ADDED IN 1.2.19-svn7
*/
$lng['install']['servername_should_be_fqdn'] = 'Le nom du serveur doit être un nom FQDN, pas une adresse IP';
/** /**
* Renamed in 1.2.19-svn40 * Renamed in 1.2.19-svn40
*/ */
$lng['install']['webserver'] = 'Version du serveur'; $lng['install']['webserver'] = 'Version du serveur';
$lng['install']['phpxml'] = 'Tester si PHP XML-extension est install<6C>e...'; $lng['install']['phpxml'] = 'Tester si PHP XML-extension est install<6C>e...';
?> ?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor Team <team@froxlor.org> (2010-) * @author Froxlor Team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
/** /**
@@ -40,7 +40,6 @@ $lng['install']['servername'] = 'Servername (FQDN)';
$lng['install']['serverip'] = 'Server-IP'; $lng['install']['serverip'] = 'Server-IP';
$lng['install']['apacheversion'] = 'Apacheversion'; $lng['install']['apacheversion'] = 'Apacheversion';
$lng['install']['next'] = 'Fortfahren'; $lng['install']['next'] = 'Fortfahren';
$lng['install']['installdata'] = 'Installation - Daten';
/** /**
* Progress * Progress
@@ -73,12 +72,6 @@ $lng['install']['openbasedirenabled'] = 'aktiviert. Froxlor wird mit aktiviertem
$lng['install']['httpuser'] = 'HTTP Username'; $lng['install']['httpuser'] = 'HTTP Username';
$lng['install']['httpgroup'] = 'HTTP Gruppenname'; $lng['install']['httpgroup'] = 'HTTP Gruppenname';
/**
* ADDED IN 1.2.19-svn7
*/
$lng['install']['servername_should_be_fqdn'] = 'Der Servername sollte eine FQDN sein und keine IP Adresse sein';
/** /**
* Renamed in 1.2.19-svn40 * Renamed in 1.2.19-svn40
*/ */

View File

@@ -12,7 +12,7 @@
* @author Michael Duergner <michael@duergner.com> * @author Michael Duergner <michael@duergner.com>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt * @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package System * @package System
* * @version $Id$
*/ */
if(@php_sapi_name() != 'cli' if(@php_sapi_name() != 'cli'

View File

@@ -12,7 +12,7 @@
* @author Martin Burchert <eremit@syscp.org> * @author Martin Burchert <eremit@syscp.org>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt * @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package System * @package System
* * @version $Id$
*/ */
// some configs // some configs

View File

@@ -1,124 +0,0 @@
#!/usr/bin/php
<?php
/**
* tsmarty2c.php - rips gettext strings from smarty template
*
* ------------------------------------------------------------------------- *
* This library is free software; you can redistribute it and/or *
* modify it under the terms of the GNU Lesser General Public *
* License as published by the Free Software Foundation; either *
* version 2.1 of the License, or (at your option) any later version. *
* *
* This library is distributed in the hope that it will be useful, *
* but WITHOUT ANY WARRANTY; without even the implied warranty of *
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU *
* Lesser General Public License for more details. *
* *
* You should have received a copy of the GNU Lesser General Public *
* License along with this library; if not, write to the Free Software *
* Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA *
* ------------------------------------------------------------------------- *
*
* This command line script rips gettext strings from smarty file,
* and prints them to stdout in C format, that can later be used with the
* standard gettext tools.
*
* Usage:
* ./tsmarty2c.php <filename or directory> <file2> <..> > smarty.c
*
* If a parameter is a directory, the template files within will be parsed.
*
* @package smarty-gettext
* @version $Id: tsmarty2c.php,v 1.3 2005/07/27 17:59:39 sagi Exp $
* @link http://smarty-gettext.sf.net/
* @author Sagi Bashari <sagi@boom.org.il>
* @copyright 2004-2005 Sagi Bashari
*/
// smarty open tag
$ldq = preg_quote('{');
// smarty close tag
$rdq = preg_quote('}');
// smarty command
$cmd = preg_quote('t');
// extensions of smarty files, used when going through a directory
$extensions = array('tpl');
// "fix" string - strip slashes, escape and convert new lines to \n
function fs($str)
{
$str = stripslashes($str);
$str = str_replace('"', '\"', $str);
$str = str_replace("\n", '\n', $str);
return $str;
}
// rips gettext strings from $file and prints them in C format
function do_file($file)
{
$content = @file_get_contents($file);
if (empty($content)) {
return;
}
global $ldq, $rdq, $cmd;
preg_match_all(
"/{$ldq}\s*({$cmd})\s*([^{$rdq}]*){$rdq}([^{$ldq}]*){$ldq}\/\\1{$rdq}/",
$content,
$matches
);
for ($i=0; $i < count($matches[0]); $i++) {
// TODO: add line number
echo "/* $file */\n"; // credit: Mike van Lammeren 2005-02-14
if (preg_match('/plural\s*=\s*["\']?\s*(.[^\"\']*)\s*["\']?/', $matches[2][$i], $match)) {
echo 'ngettext("'.fs($matches[3][$i]).'","'.fs($match[1]).'",x);'."\n";
} else {
echo 'gettext("'.fs($matches[3][$i]).'");'."\n";
}
echo "\n";
}
}
// go through a directory
function do_dir($dir)
{
$d = dir($dir);
while (false !== ($entry = $d->read())) {
if ($entry == '.' || $entry == '..') {
continue;
}
$entry = $dir.'/'.$entry;
if (is_dir($entry)) { // if a directory, go through it
do_dir($entry);
} else { // if file, parse only if extension is matched
$pi = pathinfo($entry);
if (isset($pi['extension']) && in_array($pi['extension'], $GLOBALS['extensions'])) {
do_file($entry);
}
}
}
$d->close();
}
for ($ac=1; $ac < $_SERVER['argc']; $ac++) {
if (is_dir($_SERVER['argv'][$ac])) { // go through directory
do_dir($_SERVER['argv'][$ac]);
} else { // do file
do_file($_SERVER['argv'][$ac]);
}
}
?>

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1,60 @@
<?php
/*
if(isFroxlorVersion('0.9'))
{
showUpdateStep("Updating from 0.9 to 1.0", false);
showUpdateStep("Converting database tables to UTF-8");
// Convert all data to UTF-8 to have a sane standard across all data
$result = $db->query("SHOW TABLES");
while($table = $db->fetch_array($result, 'num'))
{
$db->query("ALTER TABLE " . $table[0] . " CONVERT TO CHARACTER SET utf8 COLLATE utf8_general_ci;");
$db->query("ALTER TABLE " . $table[0] . " DEFAULT CHARACTER SET utf8 COLLATE utf8_general_ci");
$affected_columns = array();
$primarykey = "";
$columns = $db->query("SHOW COLUMNS FROM ".$table[0]);
while ($column = $db->fetch_array($columns))
{
if (!(strpos($column['Type'], "char") === false) || !(strpos($column['Type'], "text") === false))
{
$affected_columns[] = $column['Field'];
}
if ($column['Key'] == 'PRI') {
$primarykey = $column['Field'];
}
}
$count_cols = count($affected_columns);
if ($count_cols > 0)
{
$load = "";
foreach($affected_columns as $col)
{
$load .= ", `" . $col . "`";
}
$rows = $db->query("SELECT $primarykey" . $load . " FROM `" . $table[0] . "`");
while ($row = $db->fetch_array($rows))
{
$changes = "";
for ($i = 0; $i < $count_cols; $i++)
{
$base = "`" . $affected_columns[$i] . "` = '" . convertUtf8($row[$affected_columns[$i]]) . "'";
$changes .= ($i == ($count_cols-1)) ? $base : $base . ", ";
}
$db->query("UPDATE `" . $table[0] . "` SET " . $changes . " WHERE `$primarykey` = '" . $db->escape($row[$primarykey]) . "';");
}
}
}
lastStepStatus(0);
}
*/
?>

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
$updateto = '0.9-r0'; $updateto = '0.9-r0';

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
/** /**
@@ -49,6 +49,14 @@ function versionInUpdate($current_version, $version_to_check)
if (!isFroxlor()) { if (!isFroxlor()) {
return true; return true;
} }
$pos_a = strpos($current_version, '-svn');
$pos_b = strpos($version_to_check, '-svn');
// if we compare svn-versions, we have to add -svn0 to the version
// to compare it correctly
if($pos_a === false && $pos_b !== false)
{
$current_version.= '-svn9999';
}
return (version_compare2($current_version, $version_to_check) == -1 ? true : false); return version_compare($current_version, $version_to_check, '<');
} }

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
/** /**
@@ -26,7 +26,7 @@
*/ */
function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version) function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
{ {
global $settings, $lng, $db, $theme; global $settings, $lng, $db;
if(versionInUpdate($current_version, '0.9.4-svn2')) if(versionInUpdate($current_version, '0.9.4-svn2'))
{ {
@@ -73,9 +73,9 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
$description = 'You can define a default support-ticket priority level which is pre-selected for new support-tickets.'; $description = 'You can define a default support-ticket priority level which is pre-selected for new support-tickets.';
$question = '<strong>Which should be the default ticket-priority?:</strong>&nbsp;'; $question = '<strong>Which should be the default ticket-priority?:</strong>&nbsp;';
$question .= '<select name="update_deftic_priority">'; $question .= '<select name="update_deftic_priority">';
$priorities = makeoption($lng['ticket']['high'], '1', '2'); $priorities = makeoption($lng['ticket']['unf_high'], '1', '2');
$priorities.= makeoption($lng['ticket']['normal'], '2', '2'); $priorities.= makeoption($lng['ticket']['unf_normal'], '2', '2');
$priorities.= makeoption($lng['ticket']['low'], '3', '2'); $priorities.= makeoption($lng['ticket']['unf_low'], '3', '2');
$question .= $priorities.'</select>'; $question .= $priorities.'</select>';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";"); eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
} }
@@ -171,7 +171,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
$has_nouser = true; $has_nouser = true;
$guessed_user = 'www-data'; $guessed_user = 'www-data';
if(function_exists('posix_getuid') if(function_exists('posix_getuid')
&& function_exists('posix_getpwuid') && function_exists('posix_getpwuid')
) { ) {
$_httpuser = posix_getpwuid(posix_getuid()); $_httpuser = posix_getpwuid(posix_getuid());
$guessed_user = $_httpuser['name']; $guessed_user = $_httpuser['name'];
@@ -185,7 +185,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
$has_nogroup = true; $has_nogroup = true;
$guessed_group = 'www-data'; $guessed_group = 'www-data';
if(function_exists('posix_getgid') if(function_exists('posix_getgid')
&& function_exists('posix_getgrgid') && function_exists('posix_getgrgid')
) { ) {
$_httpgroup = posix_getgrgid(posix_getgid()); $_httpgroup = posix_getgrgid(posix_getgid());
$guessed_group = $_httpgroup['name']; $guessed_group = $_httpgroup['name'];
@@ -415,130 +415,4 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
$question.= '<input type="text" class="text" name="update_system_report_trafficmax" value="90" /><br />'; $question.= '<input type="text" class="text" name="update_system_report_trafficmax" value="90" /><br />';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";"); eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
} }
if(versionInUpdate($current_version, '0.9.18-svn2'))
{
$has_preconfig = true;
$description = 'As you can (obviously) see, Froxlor now comes with a new theme. You also have the possibility to switch back to "Classic" if you want to.';
$question = '<strong>Select default panel theme:</strong>&nbsp;';
$question.= '<select name="update_default_theme">';
$themes = getThemes();
foreach($themes as $cur_theme) // $theme is already in use
{
$question.= makeoption($cur_theme, $cur_theme, 'Froxlor');
}
$question.= '</select>';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
if(versionInUpdate($current_version, '0.9.28-svn4'))
{
$has_preconfig = true;
$description = 'This version introduces a lot of profound changes:';
$description .= '<br /><ul><li>Improving the whole template system</li><li>Full UTF-8 support</li><li><strong>Removing support for the former default theme \'Classic\'</strong></li></ul>';
$description .= '<br /><br />Notice: This update will <strong>alter your Froxlor database to use UTF-8</strong> as default charset. ';
$description .= 'Even though this is already tested, we <span style="color:#ff0000;font-weight:bold;">strongly recommend</span> to ';
$description .= 'test this update in a testing environment using your existing data.<br /><br />';
$question = '<strong>Select your preferred Classic Theme replacement:</strong>&nbsp;';
$question.= '<select name="classic_theme_replacement">';
$themes = getThemes();
foreach($themes as $cur_theme)
{
$question.= makeoption($cur_theme, $cur_theme, 'Froxlor');
}
$question.= '</select>';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
if (versionInUpdate($current_version, '0.9.28-svn6')) {
if ($settings['system']['webserver'] == 'apache2') {
$has_preconfig = true;
$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in ordner to use it.<br />';
$description.= '<pre>LoadModule authz_core_module modules/mod_authz_core.so
LoadModule authz_host_module modules/mod_authz_host.so</pre><br />';
$question = '<strong>Do you want to enable the Apache-2.4 modification?:</strong>&nbsp;';
$question.= makeyesno('update_system_apache24', '1', '0', '0');
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
} elseif ($settings['system']['webserver'] == 'nginx') {
$has_preconfig = true;
$description = 'The path to nginx\'s fastcgi_params file is now customizable.<br /><br />';
$question = '<strong>Please enter full path to you nginx/fastcgi_params file (including filename):</strong>&nbsp;';
$question.= '<input type="text" class="text" name="nginx_fastcgi_params" value="/etc/nginx/fastcgi_params" />';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
}
if (versionInUpdate($current_version, '0.9.28-rc2')) {
$has_preconfig = true;
$description = 'This version adds an option to append the domain-name to the document-root for domains and subdomains.<br />';
$description .= 'You can enable or disable this feature anytime from settings -> system settings.<br />';
$question = '<strong>Do you want to automatically append the domain-name to the documentroot of newly created domains?:</strong>&nbsp;';
$question.= makeyesno('update_system_documentroot_use_default_value', '1', '0', '0');
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
if (versionInUpdate($current_version, '0.9.28')) {
$has_preconfig = true;
// just an information about the new sendmail parameter (#1134)
$description = 'Froxlor changed the default parameter-set of sendmail (php.ini)<br />';
$description .= 'sendmail_path = "/usr/sbin/sendmail -t <strong>-i</strong> -f {CUSTOMER_EMAIL}"<br /><br />';
$description .= 'If you don\'t have any problems with sending mails, you don\'t need to change this';
if ($settings['system']['mod_fcgid'] == '1'
|| $settings['phpfpm']['enabled'] == '1'
) {
// information about removal of php's safe_mode
$description .= '<br /><br />The php safe_mode flag has been removed as current versions of PHP<br />';
$description .= 'do not support it anymore.<br /><br />';
$description .= 'Please check your php-configurations and remove safe_mode-directives to avoid php notices/warnings.';
}
$question = '';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
if (versionInUpdate($current_version, '0.9.29-dev1')) {
// we only need to ask if fcgid|php-fpm is enabled
if ($settings['system']['mod_fcgid'] == '1'
|| $settings['phpfpm']['enabled'] == '1'
) {
$has_preconfig = true;
$description = 'Standard-subdomains can now be hidden from the php-configuration overview.<br />';
$question = '<strong>Do you want to hide the standard-subdomains (this can be changed in the settings any time)?:</strong>&nbsp;';
$question.= makeyesno('hide_stdsubdomains', '1', '0', '0');
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
}
if (versionInUpdate($current_version, '0.9.29-dev2')) {
$has_preconfig = true;
$description = 'You can now decide whether admins/customers are able to change the theme<br />';
$question = '<strong>If you want to disallow theme-changing, select "no" from the dropdowns:</strong>&nbsp;';
$question.= "Admins: ". makeyesno('allow_themechange_a', '1', '0', '1').'&nbsp;&nbsp;';
$question.= "Customers: ".makeyesno('allow_themechange_c', '1', '0', '1');
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
if (versionInUpdate($current_version, '0.9.29-dev3')) {
$has_preconfig = true;
$description = 'There is now a possibility to specify AFXR servers for your bind zone-configuration<br />';
$question = '<strong>Enter a comma-separated list of AFXR servers or leave empty (default):</strong>&nbsp;';
$question.= '<input type="text" class="text" name="system_afxrservers" value="" />';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
if (versionInUpdate($current_version, '0.9.29-dev4')) {
$has_preconfig = true;
$description = 'As customers can now specify ssl-certificate data for their domains, you need to specify where the generated files are stored<br />';
$question = '<strong>Specify the directory for customer ssl-certificates:</strong>&nbsp;';
$question.= '<input type="text" class="text" name="system_customersslpath" value="/etc/apache2/ssl/" />';
eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
}
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
/** /**
@@ -31,7 +31,7 @@ if($settings['panel']['version'] == '1.0.10')
{ {
// Drop/Rename postfix_ tables // Drop/Rename postfix_ tables
$db->query("DROP TABLE IF EXISTS `" . TABLE_POSTFIX_TRANSPORT . "`"); $db->query("DROP TABLE `" . TABLE_POSTFIX_TRANSPORT . "`");
$db->query("ALTER TABLE `" . TABLE_POSTFIX_USERS . "` RENAME `" . TABLE_MAIL_USERS . "` "); $db->query("ALTER TABLE `" . TABLE_POSTFIX_USERS . "` RENAME `" . TABLE_MAIL_USERS . "` ");
$db->query("ALTER TABLE `" . TABLE_POSTFIX_VIRTUAL . "` RENAME `" . TABLE_MAIL_VIRTUAL . "` "); $db->query("ALTER TABLE `" . TABLE_POSTFIX_VIRTUAL . "` RENAME `" . TABLE_MAIL_VIRTUAL . "` ");

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
define('TABLE_POSTFIX_TRANSPORT', 'postfix_transport'); define('TABLE_POSTFIX_TRANSPORT', 'postfix_transport');

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
if($settings['panel']['version'] == '1.2-beta1' if($settings['panel']['version'] == '1.2-beta1'

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
if($settings['panel']['version'] == '1.2.19') if($settings['panel']['version'] == '1.2.19')
@@ -803,7 +803,7 @@ else
`description` varchar(50) NOT NULL, `description` varchar(50) NOT NULL,
PRIMARY KEY (`id`) PRIMARY KEY (`id`)
) ENGINE=MyISAM"); ) ENGINE=MyISAM");
$db->query("INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` (`id`, `phpsettings`, `description`) VALUES(1, 'short_open_tag = On\r\nasp_tags = Off\r\nprecision = 14\r\noutput_buffering = 4096\r\nallow_call_time_pass_reference = Off\r\nsafe_mode = {SAFE_MODE}\r\nsafe_mode_gid = Off\r\nsafe_mode_include_dir = \"{PEAR_DIR}\"\r\nsafe_mode_allowed_env_vars = PHP_\r\nsafe_mode_protected_env_vars = LD_LIBRARY_PATH\r\n{OPEN_BASEDIR_C}open_basedir = \"{OPEN_BASEDIR}\"\r\ndisable_functions = exec,passthru,shell_exec,system,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate\r\ndisable_classes =\r\nexpose_php = Off\r\nmax_execution_time = 30\r\nmax_input_time = 60\r\nmemory_limit = 16M\r\npost_max_size = 16M\r\nerror_reporting = E_ALL & ~E_NOTICE\r\ndisplay_errors = On\r\ndisplay_startup_errors = Off\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\nreport_memleaks = On\r\ntrack_errors = Off\r\nhtml_errors = Off\r\nvariables_order = \"GPCS\"\r\nregister_globals = Off\r\nregister_argc_argv = Off\r\ngpc_order = \"GPC\"\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\ninclude_path = \".:{PEAR_DIR}\"\r\nenable_dl = Off\r\nfile_uploads = On\r\nupload_tmp_dir = \"{TMP_DIR}\"\r\nupload_max_filesize = 32M\r\nallow_url_fopen = Off\r\nsendmail_path = \"/usr/sbin/sendmail -t -f {CUSTOMER_EMAIL}\"\r\nsession.save_handler = files\r\nsession.save_path = \"{TMP_DIR}\"\r\nsession.use_cookies = 1\r\nsession.name = PHPSESSID\r\nsession.auto_start = 0\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.cookie_domain =\r\nsession.serialize_handler = php\r\nsession.gc_probability = 1\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.referer_check =\r\nsession.entropy_length = 16\r\nsession.entropy_file = /dev/urandom\r\nsession.cache_limiter = nocache\r\nsession.cache_expire = 180\r\nsession.use_trans_sid = 0\r\nsuhosin.simulation = Off\r\nsuhosin.mail.protect = 1\r\n', 'Default Config')"); $db->query("INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` (`id`, `phpsettings`, `description`) VALUES(1, 'short_open_tag = On\r\nasp_tags = Off\r\nprecision = 14\r\noutput_buffering = 4096\r\nallow_call_time_pass_reference = Off\r\nsafe_mode = {SAFE_MODE}\r\nsafe_mode_gid = Off\r\nsafe_mode_include_dir = \"{PEAR_DIR}\"\r\nsafe_mode_allowed_env_vars = PHP_\r\nsafe_mode_protected_env_vars = LD_LIBRARY_PATH\r\nopen_basedir = \"{OPEN_BASEDIR}\"\r\ndisable_functions = exec,passthru,shell_exec,system,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate\r\ndisable_classes =\r\nexpose_php = Off\r\nmax_execution_time = 30\r\nmax_input_time = 60\r\nmemory_limit = 16M\r\npost_max_size = 16M\r\nerror_reporting = E_ALL & ~E_NOTICE\r\ndisplay_errors = On\r\ndisplay_startup_errors = Off\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\nreport_memleaks = On\r\ntrack_errors = Off\r\nhtml_errors = Off\r\nvariables_order = \"GPCS\"\r\nregister_globals = Off\r\nregister_argc_argv = Off\r\ngpc_order = \"GPC\"\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\ninclude_path = \".:{PEAR_DIR}\"\r\nenable_dl = Off\r\nfile_uploads = On\r\nupload_tmp_dir = \"{TMP_DIR}\"\r\nupload_max_filesize = 32M\r\nallow_url_fopen = Off\r\nsendmail_path = \"/usr/sbin/sendmail -t -f {CUSTOMER_EMAIL}\"\r\nsession.save_handler = files\r\nsession.save_path = \"{TMP_DIR}\"\r\nsession.use_cookies = 1\r\nsession.name = PHPSESSID\r\nsession.auto_start = 0\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.cookie_domain =\r\nsession.serialize_handler = php\r\nsession.gc_probability = 1\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.referer_check =\r\nsession.entropy_length = 16\r\nsession.entropy_file = /dev/urandom\r\nsession.cache_limiter = nocache\r\nsession.cache_expire = 180\r\nsession.use_trans_sid = 0\r\nsuhosin.simulation = Off\r\nsuhosin.mail.protect = 1\r\n', 'Default Config')");
$db->query("ALTER TABLE `" . TABLE_PANEL_DOMAINS . "` ADD `phpsettingid` INT( 11 ) UNSIGNED NOT NULL DEFAULT '1'"); $db->query("ALTER TABLE `" . TABLE_PANEL_DOMAINS . "` ADD `phpsettingid` INT( 11 ) UNSIGNED NOT NULL DEFAULT '1'");
$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES('system', 'mod_fcgid_wrapper', '0')"); $db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES('system', 'mod_fcgid_wrapper', '0')");
$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES('system', 'mod_fcgid_starter', '0')"); $db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES('system', 'mod_fcgid_starter', '0')");

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
if($settings['panel']['version'] == '1.4') if($settings['panel']['version'] == '1.4')

Some files were not shown because too many files have changed in this diff Show More