Compare commits

..

1 Commits

Author SHA1 Message Date
Michael Kaufmann (d00p)
8d1e4889b3 tagging froxlor-0.9 2010-02-01 10:49:31 +00:00
2229 changed files with 24973 additions and 125554 deletions

10
.gitignore vendored
View File

@@ -1,10 +0,0 @@
packages/*
lib/classes/htmlpurifier/library/HTMLPurifier/DefinitionCache/Serializer/*/
temp/*
templates/*
install/update.log
.buildpath
.project
.settings/
*.diff
*~

11
COPYING
View File

@@ -2,7 +2,7 @@
Version 2, June 1991 Version 2, June 1991
Copyright (C) 1989, 1991 Free Software Foundation, Inc. Copyright (C) 1989, 1991 Free Software Foundation, Inc.
51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA 675 Mass Ave, Cambridge, MA 02139, USA
Everyone is permitted to copy and distribute verbatim copies Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed. of this license document, but changing it is not allowed.
@@ -55,7 +55,7 @@ patent must be licensed for everyone's free use or not licensed at all.
The precise terms and conditions for copying, distribution and The precise terms and conditions for copying, distribution and
modification follow. modification follow.
GNU GENERAL PUBLIC LICENSE GNU GENERAL PUBLIC LICENSE
TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
@@ -110,7 +110,7 @@ above, provided that you also meet all of these conditions:
License. (Exception: if the Program itself is interactive but License. (Exception: if the Program itself is interactive but
does not normally print such an announcement, your work based on does not normally print such an announcement, your work based on
the Program is not required to print an announcement.) the Program is not required to print an announcement.)
These requirements apply to the modified work as a whole. If These requirements apply to the modified work as a whole. If
identifiable sections of that work are not derived from the Program, identifiable sections of that work are not derived from the Program,
and can be reasonably considered independent and separate works in and can be reasonably considered independent and separate works in
@@ -168,7 +168,7 @@ access to copy from a designated place, then offering equivalent
access to copy the source code from the same place counts as access to copy the source code from the same place counts as
distribution of the source code, even though third parties are not distribution of the source code, even though third parties are not
compelled to copy the source along with the object code. compelled to copy the source along with the object code.
4. You may not copy, modify, sublicense, or distribute the Program 4. You may not copy, modify, sublicense, or distribute the Program
except as expressly provided under this License. Any attempt except as expressly provided under this License. Any attempt
otherwise to copy, modify, sublicense or distribute the Program is otherwise to copy, modify, sublicense or distribute the Program is
@@ -225,7 +225,7 @@ impose that choice.
This section is intended to make thoroughly clear what is believed to This section is intended to make thoroughly clear what is believed to
be a consequence of the rest of this License. be a consequence of the rest of this License.
8. If the distribution and/or use of the Program is restricted in 8. If the distribution and/or use of the Program is restricted in
certain countries either by patents or by copyrighted interfaces, the certain countries either by patents or by copyrighted interfaces, the
original copyright holder who places the Program under this License original copyright holder who places the Program under this License
@@ -278,3 +278,4 @@ PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
POSSIBILITY OF SUCH DAMAGES. POSSIBILITY OF SUCH DAMAGES.
END OF TERMS AND CONDITIONS END OF TERMS AND CONDITIONS

126
TODO Normal file
View File

@@ -0,0 +1,126 @@
FIXED 0001282 Homedirs von Dovecot identisch
FIXED 0001283 SysCP creating broken lighttpd config files
FIXED 0001213 APS class_apsinstaller.php on line 510 - error installing different apps
FIXED 0001272 Default Config for libnss incomplete (debian/lenny)
FIXED 0001281 Wrong open_basedir directive
FIXED 0001279 incorrect usage of escapeshellcmd
FIXED 0001269 AWStats RewriteRule is wrong
FIXED 0001277 Apache Redirect => permanent 301
FIXED 0001276 Bind Zones Not Updated on Nameserver Change
FIXED 0001275 Setting up Traffic limit is limited to 999 GB
FIXED 0001273 APS-Installer
FIXED 0001271 cant install the package magento
FIXED 0001270 xinet reltime update mistake
FIXED 0001268 SysCP Funktion: aktualisierung in Real-Time
FIXED 0001267 Domain-Aliases also create a HOST-entry
FIXED 0001266 Lighttpd has a internal limit of regex-hits which limits max amount of domain-aliases
FIXED 0001263 Cosmettic Change
FIXED 0001255 Wrong path to usage statistics under domain settings
FIXED 0001236 the cron doesnt delete user directories
FIXED 0001254 Installation no next button
FIXED 0001253 admin_customers.php line 803 / 804 contain the same
FIXED 0001250 Apache redirect to Umlautdomains does not work
FIXED 0001249 SysCP SVN(!) settings loader doesn't load some settings
FIXED 0001247 tab order problems at email forward mask
FIXED 0001246 wrong variable assigned in /templates/admin/customers/customers_add.tpl
FIXED 0001239 awstats configs get cluttered up after domain deletion
FIXED 0001228 Domain deletion fails
FIXED 0001233 Display errors when amount of FTP or Mail Traffic is larger than HTTP traffic
FIXED 0001122 Field members of table ftp_groups not updated correctly when customer deletes ftp user
FIXED 0001215 php.ini: open_basedir error
FIXED 0001223 Postfix proposed SQL-query in mysql-virtual_alias_maps.cf: use TRIM()
FIXED 0001221 syscp xinet.d - no need to edit /etc/services
FIXED 0001217 SysCP Realtime Support
FIXED 0001209 APS crashs when installing magento
FIXED 0001210 Add start- and endtime to autoresponder
FIXED 0001185 Autoreponder - send mails via sendmail to set correct Return-Path header
FIXED 0001201 Virtualusers conflict with local users when using libnss-mysql
FIXED 0001203 Add check for PHP version and required PHP modules in install script
FIXED 0001013 lighttpd - every customer should have his own php.ini
FIXED 0001113 realtime functionality broken
FIXED 0001080 host of third level gets overridden by second-level when wwwserveralias is not set on lighttpd
FIXED 0001159 serveral errors for lighttpd
FIXED 0001181 lighttpd cronjob config for subdomains is empty
FIXED 0001176 libnss-mysql and conflicting usernames/groups
FIXED 0001154 Wrong configuration set with AWstats an fcgi
FIXED 0001149 Create a Configuration-Option for SPF Records in Zonefiles
FIXED 0001095 lighttpd - redirection - "/" slash is added to end of url
FIXED 0001148 Show info for inactive modifications
FIXED 0001051 include_shell issue in lighttpd 1.4.20
--------------------------------------------------------------------------------------------------------------
WONFIX 0001278 Customer and domain directories are not created
WONTFIX 0001056 Need extra payment methods
WONTFIX 0001262 Currency type modification.
WONTFIX 0001257 Fee is recalculated with current contract data although interval is over
WONTFIX 0001260 2x F5 causes bigger fonts
WONTFIX 0001259 contract-changes optional with cron to the end of the interval
WONTFIX 0001258 Make invoices immediately
WONTFIX 0001252 Backup Cronjob for Customers
WONTFIX 0001248 blog.syscp.org
WONTFIX 0001243 Wrong uid and gid for php-fcgi-starter
WONTIFX 0001241 Patch for facilate customizing syscp
WONTFIX 0001227 Error on fixing invoices with credit notes
WONTFIX 0001039 Additional text field for infos in customers "Contact Data"
WONTFIX 0001187 additional Invoices
WONTFIX 0001059 Billing - Create contract - Filename should contain customername
WONTFIX 0001112 customers should be able to create custom cronjobs
WONTFIX 0001136 Configuration of "dead" mail adresses
WONTFIX 0001134 Allow selection of a default apache page / provide access to syscp
WONTFIX 0001104 Listen Configuration should contain a warning for debian
WONTFIX 0001098 Possibillity to dissable "Catchall" for mails
WONTFIX 0001033 Cron-Tasks: creating of php.ini
--------------------------------------------------------------------------------------------------------------
0001274 Option to mark a Domain as Subdomain possible or not
0001280 deb packet 1.4.2.1-2 fu*ked
0001041 Customer should have access to his webserver logs.
0001261 No e-mail on 90% traffic
0001120 Missing function to calculate the mail traffic
0001244 customer view too wide for 1024x768 resolutions
0001229 subdomains and Own vHost-Settings
0001251 possibility to manage WebDAV config in SysCP
0001042 Webalizer dir should not be deletable
0001245 Password Protect /awstats/ when using awstats and fcgid
0001156 Repairing use of awstats and awstats-icons with fcgi
0001242 When email qouta is enabled, you cannot add more resources to a client.
0001240 Wrong php.ini for subdomains with fastCGI
0001224 APS installer not installing the aps applications properly, such as WordPress and WebCalender
0001017 Proftpd - Quota should be added
0001016 Pureftpd - quota should be added
0001206 crontabs not terminating
0001212 retain form input
0001211 Generated MySQL username too long
0001208 HTML Tags in Support Tickets
0001207 FTP Passw<73>rter mit Umlauten
0001204 php5-suhosin
0001198 More online help wanted
0001189 Autoresponder: support for multiline "From:" headers
0001186 subdomains and php configuration
0001079 Protected dir only works only after a force-reload on lighttpd
0001034 Cron-Tasks: apache-logfiles directory
0001150 Wrong configuration of awstats
0001083 awstats.model.conf.syscp should include awstats.conf
0001152 apache certificate is not generated
0001151 When cronjob generates new dkim files a mail is sent to root
0001005 Force user to add POP3 Account before he can add e-mail adresses
0001142 Default index.html should be placed in a sub-directory of a domain.
0001140 Replace variables in defaut_vhost config
0001138 old db-data is lost when mysqldump is not within open_basedir
0001135 dkim refers to non-existing domainkey entry in DNS zone file.
0001133 Default Configuration doesn't allow Exim4 to forward Mails to the outside world
0001128 More targets for "Write a message" tool
0001131 Add FreeBSD configuration files to the base tarball.
0001130 Wrong number format in e.g. traffic display.
0001129 Allow selection of automatic creation of a webmail.<domain>.<tld>, phpmyadmin. ..., webftp. ...
0001127 Versioning of configuration templates.
0001116 Please add tooltips to adminCP
0001114 Password query for Awstats statistics
0001111 add login for e-mail and ftp users to let them change their own settings
0001109 no mail traffic is shown and calculated without third party module
0001101 Default mail qouta - possibillity to set new accounts to amount of webspace
0001084 Add select box to change special logfile setting on domain edit
0001058 Add id/class attributs in <img> tag (left navigation)
0001043 When creating customer it should also be possible to add domains (merge customer & domain menu)
0001035 PHP-Error-Log | Adminpanel & CronTask
0001010 Send info mail to customer if webspace is exceeded
0001004 Ressources / Domains - Standard subdomains should be separrated from normal Domains
9999999 Write a complete statement about what froxlor is and why we do this (atari)

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
return array( return array(
@@ -32,32 +32,6 @@ return array(
'option_options_method' => 'getLanguages', 'option_options_method' => 'getLanguages',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_default_theme' => array(
'label' => array('title' => $lng['panel']['theme'], 'description' => $lng['serversettings']['default_theme']),
'settinggroup' => 'panel',
'varname' => 'default_theme',
'type' => 'option',
'default' => 'Froxlor',
'option_mode' => 'one',
'option_options_method' => 'getThemes',
'save_method' => 'storeSettingDefaultTheme',
),
'panel_allow_theme_change_customer' => array(
'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_customer',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'panel_allow_theme_change_admin' => array(
'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_admin',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField'
),
'panel_natsorting' => array( 'panel_natsorting' => array(
'label' => $lng['serversettings']['natsorting'], 'label' => $lng['serversettings']['natsorting'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -90,24 +64,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => 'Manual', 'default' => 'Manual',
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']), 'option_options' => array('Manual' => 'Manual', 'Dropdown' => 'Dropdown'),
'save_method' => 'storeSettingField',
),
'use_webfonts' => array(
'label' => $lng['serversettings']['enablewebfonts'],
'settinggroup' => 'panel',
'varname' => 'use_webfonts',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'webfont' => array(
'label' => $lng['serversettings']['definewebfont']['title'],
'settinggroup' => 'panel',
'varname' => 'webfont',
'type' => 'string',
'default' => 'Numans',
'string_emptyallowed' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_adminmail' => array( 'panel_adminmail' => array(
@@ -120,24 +77,6 @@ return array(
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_adminmail_defname' => array(
'label' => $lng['serversettings']['adminmail_defname'],
'settinggroup' => 'panel',
'varname' => 'adminmail_defname',
'type' => 'string',
'default' => 'Froxlor Administrator',
'save_method' => 'storeSettingField',
),
'panel_adminmail_return' => array(
'label' => $lng['serversettings']['adminmail_return'],
'settinggroup' => 'panel',
'varname' => 'adminmail_return',
'type' => 'string',
'string_type' => 'mail',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'panel_decimal_places' => array( 'panel_decimal_places' => array(
'label' => $lng['serversettings']['decimal_places'], 'label' => $lng['serversettings']['decimal_places'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -194,6 +133,14 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'admin_froxlor_graphic' => array(
'label' => $lng['admin']['froxlor_graphic'],
'settinggroup' => 'admin',
'varname' => 'froxlor_graphic',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'panel_allow_domain_change_admin' => array( 'panel_allow_domain_change_admin' => array(
'label' => $lng['serversettings']['panel_allow_domain_change_admin'], 'label' => $lng['serversettings']['panel_allow_domain_change_admin'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -210,14 +157,6 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_phpconfigs_hidestdsubdomain' => array(
'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
'settinggroup' => 'panel',
'varname' => 'phpconfigs_hidestdsubdomain',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
), ),
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -38,14 +38,6 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'login_domain_login' => array(
'label' => $lng['serversettings']['login_domain_login'],
'settinggroup' => 'login',
'varname' => 'domain_login',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
'login_maxloginattempts' => array( 'login_maxloginattempts' => array(
'label' => $lng['serversettings']['maxloginattempts'], 'label' => $lng['serversettings']['maxloginattempts'],
'settinggroup' => 'login', 'settinggroup' => 'login',
@@ -62,23 +54,6 @@ return array(
'default' => 900, 'default' => 900,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_password_min_length' => array(
'label' => $lng['serversettings']['panel_password_min_length'],
'settinggroup' => 'panel',
'varname' => 'password_min_length',
'type' => 'int',
'default' => 0,
'save_method' => 'storeSettingField',
),
'panel_password_regex' => array(
'label' => $lng['serversettings']['panel_password_regex'],
'settinggroup' => 'panel',
'varname' => 'password_regex',
'type' => 'string',
'default' => '',
/* 'plausibility_check_method' => 'checkValidRegEx', */
'save_method' => 'storeSettingField',
),
'customer_accountprefix' => array( 'customer_accountprefix' => array(
'label' => $lng['serversettings']['accountprefix'], 'label' => $lng['serversettings']['accountprefix'],
'settinggroup' => 'customer', 'settinggroup' => 'customer',
@@ -120,14 +95,6 @@ return array(
'type' => 'bool', 'type' => 'bool',
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'dependency' => array(
'fieldname' => 'panel_allow_preset_admin',
'fielddata' => array(
'settinggroup' => 'panel',
'varname' => 'allow_preset_admin',
),
'onlyif' => 0
)
), ),
'panel_allow_preset_admin' => array( 'panel_allow_preset_admin' => array(
'label' => $lng['serversettings']['allow_password_reset_admin'], 'label' => $lng['serversettings']['allow_password_reset_admin'],
@@ -136,14 +103,6 @@ return array(
'type' => 'bool', 'type' => 'bool',
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'dependency' => array(
'fieldname' => 'panel_allow_preset',
'fielddata' => array(
'settinggroup' => 'panel',
'varname' => 'allow_preset',
),
'onlyif' => 1
)
), ),
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -27,18 +27,8 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'documentroot_prefix', 'varname' => 'documentroot_prefix',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/webs/', 'default' => '/var/customers/webs/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'plausibility_check_method' => 'checkPathConflicts'
),
'system_documentroot_use_default_value' => array(
'label' => $lng['serversettings']['documentroot_use_default_value'],
'settinggroup' => 'system',
'varname' => 'documentroot_use_default_value',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
), ),
'system_ipaddress' => array( 'system_ipaddress' => array(
'label' => $lng['serversettings']['ipaddress'], 'label' => $lng['serversettings']['ipaddress'],
@@ -67,31 +57,6 @@ return array(
'type' => 'string', 'type' => 'string',
'default' => '', 'default' => '',
'save_method' => 'storeSettingHostname', 'save_method' => 'storeSettingHostname',
'plausibility_check_method' => 'checkHostname',
),
'system_froxlordirectlyviahostname' => array(
'label' => $lng['serversettings']['froxlordirectlyviahostname'],
'settinggroup' => 'system',
'varname' => 'froxlordirectlyviahostname',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
'system_validatedomain' => array(
'label' => $lng['serversettings']['validate_domain'],
'settinggroup' => 'system',
'varname' => 'validate_domain',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'system_stdsubdomain' => array(
'label' => $lng['serversettings']['stdsubdomainhost'],
'settinggroup' => 'system',
'varname' => 'stdsubdomain',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingHostname',
), ),
'system_mysql_access_host' => array( 'system_mysql_access_host' => array(
'label' => $lng['serversettings']['mysql_access_host'], 'label' => $lng['serversettings']['mysql_access_host'],
@@ -102,6 +67,15 @@ return array(
'plausibility_check_method' => 'checkMysqlAccessHost', 'plausibility_check_method' => 'checkMysqlAccessHost',
'save_method' => 'storeSettingMysqlAccessHost', 'save_method' => 'storeSettingMysqlAccessHost',
), ),
'system_realtime_port' => array(
'label' => $lng['serversettings']['system_realtime_port'],
'settinggroup' => 'system',
'varname' => 'realtime_port',
'type' => 'int',
'int_max' => 65535,
'default' => 0,
'save_method' => 'storeSettingField',
),
'system_index_file_extension' => array( 'system_index_file_extension' => array(
'label' => $lng['serversettings']['index_file_extension'], 'label' => $lng['serversettings']['index_file_extension'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -111,14 +85,6 @@ return array(
'default' => 'html', 'default' => 'html',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_store_index_file_subs' => array(
'label' => $lng['serversettings']['system_store_index_file_subs'],
'settinggroup' => 'system',
'varname' => 'store_index_file_subs',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'system_httpuser' => array( 'system_httpuser' => array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'httpuser', 'varname' => 'httpuser',
@@ -131,35 +97,6 @@ return array(
'type' => 'hidden', 'type' => 'hidden',
'default' => 'www-data', 'default' => 'www-data',
), ),
'system_report_enable' => array(
'label' => $lng['serversettings']['report']['report'],
'settinggroup' => 'system',
'varname' => 'report_enable',
'type' => 'bool',
'default' => true,
'cronmodule' => 'froxlor/reports',
'save_method' => 'storeSettingField',
),
'system_report_webmax' => array(
'label' => $lng['serversettings']['report']['webmax'],
'settinggroup' => 'system',
'varname' => 'report_webmax',
'type' => 'int',
'int_min' => 1,
'int_max' => 150,
'default' => 90,
'save_method' => 'storeSettingField',
),
'system_report_trafficmax' => array(
'label' => $lng['serversettings']['report']['trafficmax'],
'settinggroup' => 'system',
'varname' => 'report_trafficmax',
'type' => 'int',
'int_min' => 1,
'int_max' => 150,
'default' => 90,
'save_method' => 'storeSettingField',
),
'system_debug_cron' => array( 'system_debug_cron' => array(
'label' => $lng['serversettings']['cron']['debug'], 'label' => $lng['serversettings']['cron']['debug'],
'settinggroup' => 'system', 'settinggroup' => 'system',

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -27,35 +27,9 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'webserver', 'varname' => 'webserver',
'type' => 'option', 'type' => 'option',
'default' => 'apache2', 'default' => 'Apache2',
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array('apache2' => 'Apache 2', 'lighttpd' => 'ligHTTPd', 'nginx' => 'Nginx'), 'option_options' => array('apache2' => 'Apache 2', 'lighttpd' => 'ligHTTPd'),
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_apache_24' => array(
'label' => $lng['serversettings']['apache_24'],
'settinggroup' => 'system',
'varname' => 'apache24',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_httpuser' => array(
'label' => $lng['admin']['webserver_user'],
'settinggroup' => 'system',
'varname' => 'httpuser',
'type' => 'string',
'default' => 'www-data',
'save_method' => 'storeSettingField',
),
'system_httpgroup' => array(
'label' => $lng['admin']['webserver_group'],
'settinggroup' => 'system',
'varname' => 'httpgroup',
'type' => 'string',
'default' => 'www-data',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_apacheconf_vhost' => array( 'system_apacheconf_vhost' => array(
@@ -85,6 +59,22 @@ return array(
'default' => '/etc/apache2/htpasswd/', 'default' => '/etc/apache2/htpasswd/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_apachereload_command' => array(
'label' => $lng['serversettings']['apachereload_command'],
'settinggroup' => 'system',
'varname' => 'apachereload_command',
'type' => 'string',
'default' => '/etc/init.d/apache2 reload',
'save_method' => 'storeSettingField',
),
'system_mod_log_sql' => array(
'label' => $lng['serversettings']['mod_log_sql'],
'settinggroup' => 'system',
'varname' => 'mod_log_sql',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
'system_logfiles_directory' => array( 'system_logfiles_directory' => array(
'label' => $lng['serversettings']['logfiles_directory'], 'label' => $lng['serversettings']['logfiles_directory'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -94,15 +84,6 @@ return array(
'default' => '/var/customers/logs/', 'default' => '/var/customers/logs/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_customersslpath' => array(
'label' => $lng['serversettings']['customerssl_directory'],
'settinggroup' => 'system',
'varname' => 'customer_ssl_path',
'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/apache2/ssl/',
'save_method' => 'storeSettingField',
),
'system_phpappendopenbasedir' => array( 'system_phpappendopenbasedir' => array(
'label' => $lng['serversettings']['phpappendopenbasedir'], 'label' => $lng['serversettings']['phpappendopenbasedir'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -130,106 +111,60 @@ return array(
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_apachereload_command' => array( ),
'label' => $lng['serversettings']['apachereload_command'], ),
'ssl' => array(
'title' => $lng['admin']['sslsettings'],
'fields' => array(
'system_ssl_enabled' => array(
'label' => $lng['serversettings']['ssl']['use_ssl'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'apachereload_command', 'varname' => 'use_ssl',
'type' => 'string', 'type' => 'bool',
'default' => '/etc/init.d/apache2 reload', 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_phpreload_command' => array( 'system_ssl_cert_file' => array(
'label' => $lng['serversettings']['phpreload_command'], 'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'phpreload_command', 'varname' => 'ssl_cert_file',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx')
),
'system_nginx_php_backend' => array(
'label' => $lng['serversettings']['nginx_php_backend'],
'settinggroup' => 'system',
'varname' => 'nginx_php_backend',
'type' => 'string',
'default' => '127.0.0.1:8888',
'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx')
),
'nginx_fastcgiparams' => array(
'label' => $lng['serversettings']['nginx_fastcgiparams'],
'settinggroup' => 'nginx',
'varname' => 'fastcgiparams',
'type' => 'string', 'type' => 'string',
'string_type' => 'file', 'string_type' => 'file',
'default' => '/etc/nginx/fastcgi_params', 'string_emptyallowed' => true,
'save_method' => 'storeSettingField', 'default' => '/etc/apache2/apache2.pem',
'websrv_avail' => array('nginx')
),
'defaultwebsrverrhandler_enabled' => array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
'settinggroup' => 'defaultwebsrverrhandler',
'varname' => 'enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'defaultwebsrverrhandler_err401' => array( 'system_ssl_key_file' => array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err401'], 'label' => $lng['serversettings']['ssl']['ssl_key_file'],
'settinggroup' => 'defaultwebsrverrhandler', 'settinggroup' => 'system',
'varname' => 'err401', 'varname' => 'ssl_key_file',
'type' => 'string', 'type' => 'string',
'default' => '', 'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.key',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2', 'nginx')
), ),
'defaultwebsrverrhandler_err403' => array( 'system_ssl_ca_file' => array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err403'], 'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
'settinggroup' => 'defaultwebsrverrhandler', 'settinggroup' => 'system',
'varname' => 'err403', 'varname' => 'ssl_ca_file',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2', 'nginx')
),
'defaultwebsrverrhandler_err404' => array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err404'],
'settinggroup' => 'defaultwebsrverrhandler',
'varname' => 'err404',
'type' => 'string', 'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'defaultwebsrverrhandler_err500' => array( 'system_ssl_openssl_cnf' => array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_err500'], 'label' => $lng['serversettings']['ssl']['openssl_cnf'],
'settinggroup' => 'defaultwebsrverrhandler', 'settinggroup' => 'system',
'varname' => 'err500', 'varname' => 'openssl_cnf',
'type' => 'string', 'type' => 'text',
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2', 'nginx')
), ),
'customredirect_enabled' => array( ),
'label' => $lng['serversettings']['customredirect_enabled'], ),
'settinggroup' => 'customredirect', ),
'varname' => 'enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2', 'lighttpd')
),
'customredirect_default' => array(
'label' => $lng['serversettings']['customredirect_default'],
'settinggroup' => 'customredirect',
'varname' => 'default',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => 'getRedirectCodes',
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2', 'lighttpd')
)
)
)
)
); );
?>

View File

@@ -1,77 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'ssl' => array(
'title' => $lng['admin']['sslsettings'],
'fields' => array(
'system_ssl_enabled' => array(
'label' => $lng['serversettings']['ssl']['use_ssl'],
'settinggroup' => 'system',
'varname' => 'use_ssl',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_ssl_cert_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.pem',
'save_method' => 'storeSettingField',
),
'system_ssl_key_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_key_file'],
'settinggroup' => 'system',
'varname' => 'ssl_key_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.key',
'save_method' => 'storeSettingField',
),
'system_ssl_ca_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
'settinggroup' => 'system',
'varname' => 'ssl_ca_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_ssl_cert_chainfile' => array(
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_chainfile',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
)
)
)
)
);

View File

@@ -1,151 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'fcgid' => array(
'title' => $lng['admin']['fcgid_settings'],
'websrv_avail' => array('apache2', 'lighttpd'),
'fields' => array(
'system_mod_fcgid_enabled' => array(
'label' => $lng['serversettings']['mod_fcgid'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'plausibility_check_method' => 'checkFcgidPhpFpm',
'overview_option' => true
),
'system_mod_fcgid_configdir' => array(
'label' => $lng['serversettings']['mod_fcgid']['configdir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_configdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/www/php-fcgi-scripts/',
'plausibility_check_method' => 'checkPathConflicts',
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_tmpdir' => array(
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_tmpdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/tmp/',
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_peardir' => array(
'label' => $lng['serversettings']['mod_fcgid']['peardir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_peardir',
'type' => 'string',
'string_type' => 'dir',
'string_delimiter' => ':',
'string_emptyallowed' => true,
'default' => '/usr/share/php/:/usr/share/php5/',
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_wrapper' => array(
'label' => $lng['serversettings']['mod_fcgid']['wrapper'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_wrapper',
'type' => 'option',
'option_options' => array(0 => 'ScriptAlias', 1=> 'FcgidWrapper'),
'default' => 1,
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_mod_fcgid_starter' => array(
'label' => $lng['serversettings']['mod_fcgid']['starter'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_starter',
'type' => 'int',
'default' => 0,
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_maxrequests' => array(
'label' => $lng['serversettings']['mod_fcgid']['maxrequests'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_maxrequests',
'type' => 'int',
'default' => 250,
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_defaultini' => array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_defaultini',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_enabled_ownvhost' => array(
'label' => $lng['serversettings']['mod_fcgid_ownvhost'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_ownvhost',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_mod_fcgid_httpuser' => array(
'label' => $lng['admin']['mod_fcgid_user'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_httpuser',
'type' => 'string',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_mod_fcgid_httpgroup' => array(
'label' => $lng['admin']['mod_fcgid_group'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_httpgroup',
'type' => 'string',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_mod_fcgid_defaultini_ownvhost' => array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_defaultini_ownvhost',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_mod_fcgid_idle_timeout' => array(
'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_idle_timeout',
'type' => 'int',
'default' => 30,
'save_method' => 'storeSettingField'
),
)
)
)
);
?>

View File

@@ -1,184 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'phpfpm' => array(
'title' => $lng['admin']['phpfpm_settings'],
'fields' => array(
'system_phpfpm_enabled' => array(
'label' => $lng['serversettings']['phpfpm'],
'settinggroup' => 'phpfpm',
'varname' => 'enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'plausibility_check_method' => 'checkFcgidPhpFpm',
'overview_option' => true
),
'system_phpfpm_enabled_ownvhost' => array(
'label' => $lng['phpfpm']['ownvhost'],
'settinggroup' => 'phpfpm',
'varname' => 'enabled_ownvhost',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField'
),
'system_phpfpm_httpuser' => array(
'label' => $lng['phpfpm']['vhost_httpuser'],
'settinggroup' => 'phpfpm',
'varname' => 'vhost_httpuser',
'type' => 'string',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingField'
),
'system_phpfpm_httpgroup' => array(
'label' => $lng['phpfpm']['vhost_httpgroup'],
'settinggroup' => 'phpfpm',
'varname' => 'vhost_httpgroup',
'type' => 'string',
'default' => 'froxlorlocal',
'save_method' => 'storeSettingField'
),
'system_phpfpm_defaultini' => array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
'settinggroup' => 'phpfpm',
'varname' => 'defaultini',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField',
),
'system_phpfpm_defaultini_ownvhost' => array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
'settinggroup' => 'phpfpm',
'varname' => 'vhost_defaultini',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField',
),
'system_phpfpm_configdir' => array(
'label' => $lng['serversettings']['phpfpm_settings']['configdir'],
'settinggroup' => 'phpfpm',
'varname' => 'configdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/php-fpm.d/',
'save_method' => 'storeSettingField',
),
'system_phpfpm_aliasconfigdir' => array(
'label' => $lng['serversettings']['phpfpm_settings']['aliasconfigdir'],
'settinggroup' => 'phpfpm',
'varname' => 'aliasconfigdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/www/php-fpm/',
'save_method' => 'storeSettingField',
),
'system_phpfpm_tmpdir' => array(
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
'settinggroup' => 'phpfpm',
'varname' => 'tmpdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/tmp/',
'save_method' => 'storeSettingField',
),
'system_phpfpm_peardir' => array(
'label' => $lng['serversettings']['mod_fcgid']['peardir'],
'settinggroup' => 'phpfpm',
'varname' => 'peardir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/usr/share/php/:/usr/share/php5/',
'save_method' => 'storeSettingField',
),
'system_phpfpm_reload' => array(
'label' => $lng['serversettings']['phpfpm_settings']['reload'],
'settinggroup' => 'phpfpm',
'varname' => 'reload',
'type' => 'string',
'default' => '/etc/init.d/php-fpm restart',
'save_method' => 'storeSettingField',
),
'system_phpfpm_pm' => array(
'label' => $lng['serversettings']['phpfpm_settings']['pm'],
'settinggroup' => 'phpfpm',
'varname' => 'pm',
'type' => 'option',
'default' => 'static',
'option_mode' => 'one',
'option_options' => array('static' => 'static', 'dynamic' => 'dynamic', 'ondemand' => 'ondemand'),
'save_method' => 'storeSettingField',
),
'system_phpfpm_max_children' => array(
'label' => $lng['serversettings']['phpfpm_settings']['max_children'],
'settinggroup' => 'phpfpm',
'varname' => 'max_children',
'type' => 'int',
'default' => 1,
'save_method' => 'storeSettingField',
),
'system_phpfpm_start_servers' => array(
'label' => $lng['serversettings']['phpfpm_settings']['start_servers'],
'settinggroup' => 'phpfpm',
'varname' => 'start_servers',
'type' => 'int',
'default' => 20,
'save_method' => 'storeSettingField',
),
'system_phpfpm_min_spare_servers' => array(
'label' => $lng['serversettings']['phpfpm_settings']['min_spare_servers'],
'settinggroup' => 'phpfpm',
'varname' => 'min_spare_servers',
'type' => 'int',
'default' => 5,
'save_method' => 'storeSettingField',
),
'system_phpfpm_max_spare_servers' => array(
'label' => $lng['serversettings']['phpfpm_settings']['max_spare_servers'],
'settinggroup' => 'phpfpm',
'varname' => 'max_spare_servers',
'type' => 'int',
'default' => 35,
'save_method' => 'storeSettingField',
),
'system_phpfpm_max_requests' => array(
'label' => $lng['serversettings']['phpfpm_settings']['max_requests'],
'settinggroup' => 'phpfpm',
'varname' => 'max_requests',
'type' => 'int',
'default' => 0,
'save_method' => 'storeSettingField',
),
'system_phpfpm_idle_timeout' => array(
'label' => $lng['serversettings']['phpfpm_settings']['idle_timeout'],
'settinggroup' => 'phpfpm',
'varname' => 'idle_timeout',
'type' => 'int',
'default' => 30,
'save_method' => 'storeSettingField'
),
),
),
),
);
?>

View File

@@ -1,65 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'perl' => array(
'title' => $lng['admin']['perl_settings'],
'fields' => array(
'perl_path' => array(
'label' => $lng['serversettings']['perl_path'],
'settinggroup' => 'system',
'varname' => 'perl_path',
'type' => 'string',
'default' => '/usr/bin/perl',
'save_method' => 'storeSettingField',
'websrv_avail' => array('lighttpd')
),
'system_perl_suexecworkaround' => array(
'label' => $lng['serversettings']['perl']['suexecworkaround'],
'settinggroup' => 'perl',
'varname' => 'suexecworkaround',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_perl_suexeccgipath' => array(
'label' => $lng['serversettings']['perl']['suexeccgipath'],
'settinggroup' => 'perl',
'varname' => 'suexecpath',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/www/cgi-bin/',
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'perl_server' => array(
'label' => $lng['serversettings']['perl_server'],
'settinggroup' => 'serversettings',
'varname' => 'perl_server',
'type' => 'string',
'default' => 'unix:/var/run/nginx/cgiwrap-dispatch.sock',
'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx')
),
),
),
),
);
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -40,45 +40,45 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_awstats_domain_file' => array(
'label' => $lng['serversettings']['awstats_domain_file'],
'settinggroup' => 'system',
'varname' => 'awstats_domain_file',
'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/awstats/',
'save_method' => 'storeSettingField',
),
'system_awstats_model_file' => array(
'label' => $lng['serversettings']['awstats_model_file'],
'settinggroup' => 'system',
'varname' => 'awstats_model_file',
'type' => 'string',
'string_type' => 'file',
'default' => '/etc/awstats/awstats.model.conf.syscp',
'save_method' => 'storeSettingField',
),
'system_awstats_path' => array( 'system_awstats_path' => array(
'label' => $lng['serversettings']['awstats_path'], 'label' => $lng['serversettings']['awstats_path'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'awstats_path', 'varname' => 'awstats_path',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir', 'string_type' => 'dir',
'default' => '/usr/bin/', 'default' => '/usr/share/awstats/VERSION/webroot/cgi-bin/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_awstats_awstatspath' => array( 'system_awstats_updateall_command' => array(
'label' => $lng['serversettings']['awstats_awstatspath'], 'label' => $lng['serversettings']['awstats_updateall_command'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'awstats_awstatspath', 'varname' => 'awstats_updateall_command',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir', 'string_type' => 'file',
'default' => '/usr/bin/', 'default' => '/usr/bin/awstats_updateall.pl',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_awstats_conf' => array( ),
'label' => $lng['serversettings']['awstats_conf'], ),
'settinggroup' => 'system', ),
'varname' => 'awstats_conf',
'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/awstats/',
'save_method' => 'storeSettingField',
),
'system_awstats_icons' => array(
'label' => $lng['serversettings']['awstats_icons'],
'settinggroup' => 'system',
'varname' => 'awstats_icons',
'type' => 'string',
'string_type' => 'dir',
'default' => '/usr/share/awstats/icon/',
'save_method' => 'storeSettingField',
)
)
)
)
); );
?> ?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -51,16 +51,6 @@ return array(
'default' => '/var/customers/mail/', 'default' => '/var/customers/mail/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_vmail_maildirname' => array(
'label' => $lng['serversettings']['vmail_maildirname'],
'settinggroup' => 'system',
'varname' => 'vmail_maildirname',
'type' => 'string',
'string_type' => 'dir',
'default' => 'Maildir',
'string_emptyallowed' => true,
'save_method' => 'storeSettingField',
),
'panel_sendalternativemail' => array( 'panel_sendalternativemail' => array(
'label' => $lng['serversettings']['sendalternativemail'], 'label' => $lng['serversettings']['sendalternativemail'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -85,7 +75,7 @@ return array(
'default' => 100, 'default' => 100,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_autoresponder_enabled' => array( 'systen_autoresponder_enabled' => array(
'label' => $lng['serversettings']['autoresponder_active'], 'label' => $lng['serversettings']['autoresponder_active'],
'settinggroup' => 'autoresponder', 'settinggroup' => 'autoresponder',
'varname' => 'autoresponder_active', 'varname' => 'autoresponder_active',
@@ -94,20 +84,12 @@ return array(
'cronmodule' => 'froxlor/autoresponder', 'cronmodule' => 'froxlor/autoresponder',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_last_autoresponder_run' => array( 'systen_last_autoresponder_run' => array(
'settinggroup' => 'autoresponder', 'settinggroup' => 'autoresponder',
'varname' => 'last_autoresponder_run', 'varname' => 'last_autoresponder_run',
'type' => 'hidden', 'type' => 'hidden',
'default' => 0, 'default' => 0,
), ),
'system_catchall_enabled' => array(
'label' => $lng['serversettings']['catchall_enabled'],
'settinggroup' => 'catchall',
'varname' => 'catchall_enabled',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingResetCatchall',
),
), ),
), ),
), ),

View File

@@ -1,40 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'ftpserver' => array(
'title' => $lng['admin']['ftpserversettings'],
'fields' => array(
'ftpserver' => array(
'label' => $lng['admin']['ftpserver'],
'settinggroup' => 'system',
'varname' => 'ftpserver',
'type' => 'option',
'default' => 'proftpd',
'option_mode' => 'one',
'option_options' => array('proftpd' => 'Proftpd', 'pureftpd' => 'Pureftpd'),
'save_method' => 'storeSettingField',
),
),
),
)
);
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -22,15 +22,6 @@ return array(
'nameserver' => array( 'nameserver' => array(
'title' => $lng['admin']['nameserversettings'], 'title' => $lng['admin']['nameserversettings'],
'fields' => array( 'fields' => array(
'nameserver_enable' => array(
'label' => $lng['serversettings']['bindenable'],
'settinggroup' => 'system',
'varname' => 'bind_enable',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_bindconf_directory' => array( 'system_bindconf_directory' => array(
'label' => $lng['serversettings']['bindconf_directory'], 'label' => $lng['serversettings']['bindconf_directory'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -68,34 +59,6 @@ return array(
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_axfrservers' => array(
'label' => $lng['serversettings']['axfrservers'],
'settinggroup' => 'system',
'varname' => 'axfrservers',
'type' => 'string',
'string_type' => 'validate_ip',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_dns_createmailentry' => array(
'label' => $lng['serversettings']['mail_also_with_mxservers'],
'settinggroup' => 'system',
'varname' => 'dns_createmailentry',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField'
),
'system_defaultttl' => array(
'label' => $lng['serversettings']['defaultttl'],
'settinggroup' => 'system',
'varname' => 'defaultttl',
'type' => 'int',
'default' => 604800, /* 1 week */
'int_min' => 3600, /* 1 hour */
'int_max' => 2147483647, /* integer max */
'save_method' => 'storeSettingField',
),
), ),
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -29,7 +29,6 @@ return array(
'type' => 'bool', 'type' => 'bool',
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'overview_option' => true
), ),
'logger_severity' => array( 'logger_severity' => array(
'label' => $lng['serversettings']['logger']['severity'], 'label' => $lng['serversettings']['logger']['severity'],

View File

@@ -14,11 +14,9 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
global $settings;
return array( return array(
'groups' => array( 'groups' => array(
'dkim' => array( 'dkim' => array(
@@ -30,15 +28,13 @@ return array(
'varname' => 'use_dkim', 'varname' => 'use_dkim',
'type' => 'bool', 'type' => 'bool',
'default' => false, 'default' => false,
'save_method' => 'storeSettingFieldInsertBindTask', 'save_method' => 'storeSettingField',
'overview_option' => true
), ),
'dkim_prefix' => array( 'dkim_prefix' => array(
'label' => $lng['dkim']['dkim_prefix'], 'label' => $lng['dkim']['dkim_prefix'],
'settinggroup' => 'dkim', 'settinggroup' => 'dkim',
'varname' => 'dkim_prefix', 'varname' => 'dkim_prefix',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/postfix/dkim/', 'default' => '/etc/postfix/dkim/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
@@ -60,66 +56,6 @@ return array(
'default' => 'dkim-keys.conf', 'default' => 'dkim-keys.conf',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'dkim_algorithm' => array(
'label' => $lng['dkim']['dkim_algorithm'],
'settinggroup' => 'dkim',
'varname' => 'dkim_algorithm',
'type' => 'option',
'default' => 'all',
'option_mode' => 'multiple',
'option_options' => array('all' => 'All', 'sha1' => 'SHA1', 'sha256' => 'SHA256'),
'save_method' => 'storeSettingFieldInsertBindTask',
),
'dkim_servicetype' => array(
'label' => $lng['dkim']['dkim_servicetype'],
'settinggroup' => 'dkim',
'varname' => 'dkim_servicetype',
'type' => 'option',
'default' => '0',
'option_mode' => 'one',
'option_options' => array('0' => 'All', '1' => 'E-Mail'),
'save_method' => 'storeSettingFieldInsertBindTask',
),
'dkim_keylength' => array(
'label' => array(
'title' => $lng['dkim']['dkim_keylength']['title'],
'description' => sprintf($lng['dkim']['dkim_keylength']['description'],$settings['dkim']['dkim_prefix'])
),
'settinggroup' => 'dkim',
'varname' => 'dkim_keylength',
'type' => 'option',
'default' => '1024',
'option_mode' => 'one',
'option_options' => array('1024' => '1024 Bit', '2048' => '2048 Bit'),
'save_method' => 'storeSettingFieldInsertBindTask',
),
'dkim_notes' => array(
'label' => $lng['dkim']['dkim_notes'],
'settinggroup' => 'dkim',
'varname' => 'dkim_notes',
'type' => 'string',
'string_regexp' => '/^[a-z0-9\._]+$/i',
'default' => '',
'save_method' => 'storeSettingFieldInsertBindTask',
),
'dkim_add_adsp' => array(
'label' => $lng['dkim']['dkim_add_adsp'],
'settinggroup' => 'dkim',
'varname' => 'dkim_add_adsp',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingFieldInsertBindTask',
),
'dkim_add_adsppolicy' => array(
'label' => $lng['dkim']['dkim_add_adsppolicy'],
'settinggroup' => 'dkim',
'varname' => 'dkim_add_adsppolicy',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options' => array('0' => 'Unknown', '1' => 'All', '2' => 'Discardable'),
'save_method' => 'storeSettingFieldInsertBindTask',
),
'dkimrestart_command' => array( 'dkimrestart_command' => array(
'label' => $lng['dkim']['dkimrestart_command'], 'label' => $lng['dkim']['dkimrestart_command'],
'settinggroup' => 'dkim', 'settinggroup' => 'dkim',

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -26,8 +26,7 @@ return array(
'varname' => 'use_spf', 'varname' => 'use_spf',
'type' => 'bool', 'type' => 'bool',
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField'
'overview_option' => true
), ),
'spf_entry' => array( 'spf_entry' => array(
'label' => $lng['spf']['spf_entry'], 'label' => $lng['spf']['spf_entry'],

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -30,7 +30,6 @@ return array(
'default' => false, 'default' => false,
'cronmodule' => 'froxlor/ticket', 'cronmodule' => 'froxlor/ticket',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'overview_option' => true
), ),
'ticket_noreply_email' => array( 'ticket_noreply_email' => array(
'label' => $lng['serversettings']['ticket']['noreply_email'], 'label' => $lng['serversettings']['ticket']['noreply_email'],
@@ -58,7 +57,6 @@ return array(
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array(0 => html_entity_decode($lng['admin']['tickets']['daily']), 1 => html_entity_decode($lng['admin']['tickets']['weekly']), 2 => html_entity_decode($lng['admin']['tickets']['monthly']), 3 => html_entity_decode($lng['admin']['tickets']['yearly'])), 'option_options' => array(0 => html_entity_decode($lng['admin']['tickets']['daily']), 1 => html_entity_decode($lng['admin']['tickets']['weekly']), 2 => html_entity_decode($lng['admin']['tickets']['monthly']), 3 => html_entity_decode($lng['admin']['tickets']['yearly'])),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'plausibility_check_method' => 'setCycleOfCronjob',
), ),
'ticket_concurrently_open' => array( 'ticket_concurrently_open' => array(
'label' => $lng['serversettings']['ticket']['concurrentlyopen'], 'label' => $lng['serversettings']['ticket']['concurrentlyopen'],
@@ -126,16 +124,6 @@ return array(
'type' => 'hidden', 'type' => 'hidden',
'default' => '', 'default' => '',
), ),
'ticket_default_priority' => array(
'label' => $lng['serversettings']['ticket']['default_priority'],
'settinggroup' => 'ticket',
'varname' => 'default_priority',
'type' => 'option',
'default' => 2,
'option_mode' => 'one',
'option_options' => array(1 => $lng['ticket']['high'], 2 => $lng['ticket']['normal'], 3 => $lng['ticket']['low']),
'save_method' => 'storeSettingField',
),
), ),
), ),
) )

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -30,7 +30,6 @@ return array(
'default' => false, 'default' => false,
'cronmodule' => 'froxlor/aps', 'cronmodule' => 'froxlor/aps',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'overview_option' => true
), ),
'aps_items_per_page' => array( 'aps_items_per_page' => array(
'label' => $lng['aps']['packages_per_page'], 'label' => $lng['aps']['packages_per_page'],
@@ -59,7 +58,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => '', 'default' => '',
'option_mode' => 'multiple', 'option_mode' => 'multiple',
'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring', 'Zend Optimizer' => 'Zend Guard'), 'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap'),
'save_method' => 'storeSettingApsPhpExtensions', 'save_method' => 'storeSettingApsPhpExtensions',
), ),
'aps_php-function' => array( 'aps_php-function' => array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -38,17 +38,71 @@ return array(
'default' => true, 'default' => true,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_passwordcryptfunc' => array( 'system_mod_fcgid_enabled' => array(
'label' => $lng['serversettings']['passwordcryptfunc'], 'label' => $lng['serversettings']['mod_fcgid'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'passwordcryptfunc', 'varname' => 'mod_fcgid',
'type' => 'option', 'type' => 'bool',
'default' => 0, 'default' => false,
'option_mode' => 'one',
'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
) ),
) 'system_mod_fcgid_configdir' => array(
) 'label' => $lng['serversettings']['mod_fcgid']['configdir'],
) 'settinggroup' => 'system',
'varname' => 'mod_fcgid_configdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/www/php-fcgi-scripts/',
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_tmpdir' => array(
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_tmpdir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/tmp/',
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_peardir' => array(
'label' => $lng['serversettings']['mod_fcgid']['peardir'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_peardir',
'type' => 'string',
'string_type' => 'dir',
'string_delimiter' => ':',
'string_emptyallowed' => true,
'default' => '/usr/share/php/:/usr/share/php5/',
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_wrapper' => array(
'label' => $lng['serversettings']['mod_fcgid']['wrapper'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_wrapper',
'type' => 'option',
'option_options' => array(0 => 'ScriptAlias', 1=> 'FCGIWrapper'),
'default' => 0,
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_starter' => array(
'label' => $lng['serversettings']['mod_fcgid']['starter'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_starter',
'type' => 'int',
'default' => 0,
'save_method' => 'storeSettingField',
),
'system_mod_fcgid_maxrequests' => array(
'label' => $lng['serversettings']['mod_fcgid']['maxrequests'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_maxrequests',
'type' => 'int',
'default' => 250,
'save_method' => 'storeSettingField',
),
),
),
),
); );
?>

View File

@@ -1,118 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'backup' => array(
'title' => $lng['backup'],
'fields' => array(
'backup_enabled' => array(
'label' => $lng['serversettings']['backup_enabled'],
'settinggroup' => 'system',
'varname' => 'backup_enabled',
'type' => 'bool',
'default' => false,
'cronmodule' => 'froxlor/backup',
'save_method' => 'storeSettingField',
'overview_option' => true
),
'backup_dir' => array(
'label' => $lng['serversettings']['backupdir']['description'],
'settinggroup' => 'system',
'varname' => 'backup_dir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/backups/',
'string_regexp' => '#^/.*/$#',
'save_method' => 'storeSettingField',
),
'backup_mysqldump_path' => array(
'label' => $lng['serversettings']['mysqldump_path']['description'],
'settinggroup' => 'system',
'varname' => 'backup_mysqldump_path',
'type' => 'string',
'default' => '/usr/bin/mysqldump',
'save_method' => 'storeSettingField',
),
'backup_count' => array(
'label' => $lng['serversettings']['backup_count'],
'settinggroup' => 'system',
'varname' => 'backup_count',
'type' => 'bool',
'default' => 'true',
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_bigfile' => array(
'label' => $lng['serversettings']['backup_bigfile'],
'settinggroup' => 'system',
'varname' => 'backup_bigfile',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_ftp_enabled_' => array(
'label' => $lng['serversettings']['backup_ftp_enabled'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_server' => array(
'label' => $lng['serversettings']['backup_ftp_server'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_server',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_user' => array(
'label' => $lng['serversettings']['backup_ftp_user'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_user',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_pass' => array(
'label' => $lng['serversettings']['backup_ftp_pass'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_pass',
'type' => 'hiddenstring',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_passive_mode' => array(
'label' => $lng['serversettings']['backup_ftp_passive_mode'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_passive',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
'overview_option' => false,
),
),
),
),
);
?>

View File

@@ -1,60 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2011- the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2011-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'diskquota' => array(
'title' => $lng['diskquota'],
'fields' => array(
'diskquota_enabled' => array(
'label' => $lng['serversettings']['diskquota_enabled'],
'settinggroup' => 'system',
'varname' => 'diskquota_enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'diskquota_repquota_path' => array(
'label' => $lng['serversettings']['diskquota_repquota_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_repquota_path',
'type' => 'string',
'default' => '/usr/sbin/repquota',
'save_method' => 'storeSettingField',
),
'diskquota_quotatool_path' => array(
'label' => $lng['serversettings']['diskquota_quotatool_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_quotatool_path',
'type' => 'string',
'default' => '/usr/bin/quotatool',
'save_method' => 'storeSettingField',
),
'diskquota_customer_partition' => array(
'label' => $lng['serversettings']['diskquota_customer_partition']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_customer_partition',
'type' => 'string',
'default' => '/dev/root',
'save_method' => 'storeSettingField',
),
),
),
),
);
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -47,6 +47,22 @@ if($page == 'admins'
'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')', 'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
'traffic' => $lng['customer']['traffic'], 'traffic' => $lng['customer']['traffic'],
'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')', 'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
'mysqls' => $lng['customer']['mysqls'],
'mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
'ftps' => $lng['customer']['ftps'],
'ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
'tickets' => $lng['customer']['tickets'],
'tickets_used' => $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')',
'subdomains' => $lng['customer']['subdomains'],
'subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
'emails' => $lng['customer']['emails'],
'emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
'email_accounts' => $lng['customer']['accounts'],
'email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
'email_forwarders' => $lng['customer']['forwarders'],
'email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
'email_quota' => $lng['customer']['email_quota'],
'email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
'deactivated' => $lng['admin']['deactivated'] 'deactivated' => $lng['admin']['deactivated']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
@@ -68,30 +84,7 @@ if($page == 'admins'
$row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']); $row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
$row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']); $row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']); $row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps subdomains tickets');
/**
* percent-values for progressbar
*/
//For Disk usage
if ($row['diskspace'] > 0) {
$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
$disk_doublepercent = round($disk_percent*2, 2);
} else {
$disk_percent = 0;
$disk_doublepercent = 0;
}
//For Traffic usage
if ($row['traffic'] > 0) {
$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
$traffic_doublepercent = round($traffic_percent*2, 2);
} else {
$traffic_percent = 0;
$traffic_doublepercent = 0;
}
/* */
$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets');
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";"); eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";");
$count++; $count++;
@@ -100,7 +93,6 @@ if($page == 'admins'
$i++; $i++;
} }
$admincount = $db->num_rows($result);
eval("echo \"" . getTemplate("admins/admins") . "\";"); eval("echo \"" . getTemplate("admins/admins") . "\";");
} }
elseif($action == 'su') elseif($action == 'su')
@@ -162,7 +154,6 @@ if($page == 'admins'
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$password = validate($_POST['admin_password'], 'password'); $password = validate($_POST['admin_password'], 'password');
$password = validatePassword($password);
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$customers = intval_ressource($_POST['customers']); $customers = intval_ressource($_POST['customers']);
@@ -220,20 +211,6 @@ if($page == 'admins'
$email_quota = - 1; $email_quota = - 1;
} }
if($settings['autoresponder']['autoresponder_active'] == '1')
{
$email_autoresponder = intval_ressource($_POST['email_autoresponder']);
if(isset($_POST['email_autoresponder_ul']))
{
$email_autoresponder = - 1;
}
}
else
{
$email_autoresponder = 0;
}
$ftps = intval_ressource($_POST['ftps']); $ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['ftps_ul'])) if(isset($_POST['ftps_ul']))
@@ -241,18 +218,12 @@ if($page == 'admins'
$ftps = - 1; $ftps = - 1;
} }
if($settings['ticket']['enabled'] == 1) $tickets = intval_ressource($_POST['tickets']);
{
$tickets = intval_ressource($_POST['tickets']);
if(isset($_POST['tickets_ul'])) if(isset($_POST['tickets_ul'])
{ && $settings['ticket']['enabled'] == '1')
$tickets = - 1;
}
}
else
{ {
$tickets = 0; $tickets = - 1;
} }
$mysqls = intval_ressource($_POST['mysqls']); $mysqls = intval_ressource($_POST['mysqls']);
@@ -271,7 +242,7 @@ if($page == 'admins'
$number_of_aps_packages = - 1; $number_of_aps_packages = - 1;
} }
$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0; $can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
} }
else else
{ {
@@ -279,21 +250,10 @@ if($page == 'admins'
$can_manage_aps_packages = 0; $can_manage_aps_packages = 0;
} }
$customers_see_all = 0; $customers_see_all = intval($_POST['customers_see_all']);
if(isset($_POST['customers_see_all'])) $domains_see_all = intval($_POST['domains_see_all']);
$customers_see_all = intval($_POST['customers_see_all']); $caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = intval($_POST['change_serversettings']);
$domains_see_all = 0;
if(isset($_POST['domains_see_all']))
$domains_see_all = intval($_POST['domains_see_all']);
$caneditphpsettings = 0;
if(isset($_POST['caneditphpsettings']))
$caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = 0;
if(isset($_POST['change_serversettings']))
$change_serversettings = intval($_POST['change_serversettings']);
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
@@ -309,10 +269,6 @@ if($page == 'admins'
$traffic = - 1; $traffic = - 1;
} }
$tickets_see_all = 0;
if(isset($_POST['tickets_see_all']))
$tickets_see_all = intval($_POST['tickets_see_all']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
$ipaddress = intval_ressource($_POST['ipaddress']); $ipaddress = intval_ressource($_POST['ipaddress']);
@@ -380,43 +336,8 @@ if($page == 'admins'
$change_serversettings = '0'; $change_serversettings = '0';
} }
if ($tickets_see_all != '1') { $result = $db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` (`loginname`, `password`, `name`, `email`, `def_language`, `change_serversettings`, `customers`, `customers_see_all`, `domains`, `domains_see_all`, `caneditphpsettings`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `ip`, `can_manage_aps_packages`, `aps_packages`)
$tickets_see_all = '0'; VALUES ('" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($email) . "','" . $db->escape($def_language) . "', '" . $db->escape($change_serversettings) . "', '" . $db->escape($customers) . "', '" . $db->escape($customers_see_all) . "', '" . $db->escape($domains) . "', '" . $db->escape($domains_see_all) . "', '" . (int)$caneditphpsettings . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '" . (int)$ipaddress . "', " . (int)$can_manage_aps_packages . ", " . (int)$number_of_aps_packages . ")");
}
$_theme = $settings['panel']['default_theme'];
$result = $db->query("INSERT INTO
`" . TABLE_PANEL_ADMINS . "`
SET
`loginname` = '" . $db->escape($loginname) . "',
`password` = '" . md5($password) . "',
`name` = '" . $db->escape($name) . "',
`email` = '" . $db->escape($email) . "',
`def_language` = '" . $db->escape($def_language) . "',
`change_serversettings` = '" . $db->escape($change_serversettings) . "',
`customers` = '" . $db->escape($customers) . "',
`customers_see_all` = '" . $db->escape($customers_see_all) . "',
`domains` = '" . $db->escape($domains) . "',
`domains_see_all` = '" . $db->escape($domains_see_all) . "',
`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
`diskspace` = '" . $db->escape($diskspace) . "',
`traffic` = '" . $db->escape($traffic) . "',
`subdomains` = '" . $db->escape($subdomains) . "',
`emails` = '" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders` = '" . $db->escape($email_forwarders) . "',
`email_quota` = '" . $db->escape($email_quota) . "',
`ftps` = '" . $db->escape($ftps) . "',
`tickets` = '" . $db->escape($tickets) . "',
`tickets_see_all` = '" . $db->escape($tickets_see_all) . "',
`mysqls` = '" . $db->escape($mysqls) . "',
`ip` = '" . (int)$ipaddress . "',
`can_manage_aps_packages` = '" . (int)$can_manage_aps_packages . "',
`aps_packages` = '" . (int)$number_of_aps_packages . "',
`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
`theme` = '".$db->escape($_theme)."';
");
$adminid = $db->insert_id(); $adminid = $db->insert_id();
$log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -458,25 +379,16 @@ if($page == 'admins'
$email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
/*
$change_serversettings = makeyesno('change_serversettings', '1', '0', '0'); $change_serversettings = makeyesno('change_serversettings', '1', '0', '0');
$customers_see_all = makeyesno('customers_see_all', '1', '0', '0'); $customers_see_all = makeyesno('customers_see_all', '1', '0', '0');
$domains_see_all = makeyesno('domains_see_all', '1', '0', '0'); $domains_see_all = makeyesno('domains_see_all', '1', '0', '0');
$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0'); $caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0');
$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0'); $can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0');
*/
$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$admin_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_add.php';
$admin_add_form = htmlform::genHTMLForm($admin_add_data);
$title = $admin_add_data['admin_add']['title'];
$image = $admin_add_data['admin_add']['image'];
eval("echo \"" . getTemplate("admins/admins_add") . "\";"); eval("echo \"" . getTemplate("admins/admins_add") . "\";");
} }
} }
@@ -505,11 +417,9 @@ if($page == 'admins'
$email_accounts = $result['email_accounts']; $email_accounts = $result['email_accounts'];
$email_forwarders = $result['email_forwarders']; $email_forwarders = $result['email_forwarders'];
$email_quota = $result['email_quota']; $email_quota = $result['email_quota'];
$email_autoresponder = $result['email_autoresponder'];
$ftps = $result['ftps']; $ftps = $result['ftps'];
$tickets = $result['tickets']; $tickets = $result['tickets'];
$mysqls = $result['mysqls']; $mysqls = $result['mysqls'];
$tickets_see_all = $result['tickets_see_all'];
$customers_see_all = $result['customers_see_all']; $customers_see_all = $result['customers_see_all'];
$domains_see_all = $result['domains_see_all']; $domains_see_all = $result['domains_see_all'];
$caneditphpsettings = $result['caneditphpsettings']; $caneditphpsettings = $result['caneditphpsettings'];
@@ -524,113 +434,109 @@ if($page == 'admins'
{ {
$password = validate($_POST['admin_password'], 'new password'); $password = validate($_POST['admin_password'], 'new password');
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$deactivated = isset($_POST['deactivated']) ? 1 : 0; $deactivated = intval($_POST['deactivated']);
$customers = intval_ressource($_POST['customers']); $customers = intval_ressource($_POST['customers']);
if (isset($_POST['customers_ul'])) {
$customers = -1; if(isset($_POST['customers_ul']))
{
$customers = - 1;
} }
$domains = intval_ressource($_POST['domains']); $domains = intval_ressource($_POST['domains']);
if (isset($_POST['domains_ul'])) {
$domains = -1; if(isset($_POST['domains_ul']))
{
$domains = - 1;
} }
$subdomains = intval_ressource($_POST['subdomains']); $subdomains = intval_ressource($_POST['subdomains']);
if (isset($_POST['subdomains_ul'])) {
$subdomains = -1; if(isset($_POST['subdomains_ul']))
{
$subdomains = - 1;
} }
$emails = intval_ressource($_POST['emails']); $emails = intval_ressource($_POST['emails']);
if (isset($_POST['emails_ul'])) {
$emails = -1; if(isset($_POST['emails_ul']))
{
$emails = - 1;
} }
$email_accounts = intval_ressource($_POST['email_accounts']); $email_accounts = intval_ressource($_POST['email_accounts']);
if (isset($_POST['email_accounts_ul'])) {
$email_accounts = -1; if(isset($_POST['email_accounts_ul']))
{
$email_accounts = - 1;
} }
$email_forwarders = intval_ressource($_POST['email_forwarders']); $email_forwarders = intval_ressource($_POST['email_forwarders']);
if (isset($_POST['email_forwarders_ul'])) {
$email_forwarders = -1; if(isset($_POST['email_forwarders_ul']))
{
$email_forwarders = - 1;
} }
if ($settings['system']['mail_quota_enabled'] == '1') { if($settings['system']['mail_quota_enabled'] == '1')
{
$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', '')); $email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
if (isset($_POST['email_quota_ul'])) {
$email_quota = -1;
}
} else {
$email_quota = -1;
}
if ($settings['autoresponder']['autoresponder_active'] == '1') { if(isset($_POST['email_quota_ul']))
$email_autoresponder = intval_ressource($_POST['email_autoresponder']); {
if (isset($_POST['email_autoresponder_ul'])) { $email_quota = - 1;
$email_autoresponder = -1;
} }
} else { }
$email_autoresponder = 0; else
{
$email_quota = - 1;
} }
$ftps = intval_ressource($_POST['ftps']); $ftps = intval_ressource($_POST['ftps']);
if (isset($_POST['ftps_ul'])) {
$ftps = -1; if(isset($_POST['ftps_ul']))
{
$ftps = - 1;
} }
if ($settings['ticket']['enabled'] == 1) { $tickets = intval_ressource($_POST['tickets']);
$tickets = intval_ressource($_POST['tickets']);
if (isset($_POST['tickets_ul'])) { if(isset($_POST['tickets_ul']))
$tickets = -1; {
} $tickets = - 1;
} else {
$tickets = 0;
} }
$mysqls = intval_ressource($_POST['mysqls']); $mysqls = intval_ressource($_POST['mysqls']);
if (isset($_POST['mysqls_ul'])) {
if(isset($_POST['mysqls_ul']))
{
$mysqls = - 1; $mysqls = - 1;
} }
if ($settings['aps']['aps_active'] == '1') { $number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
if (isset($_POST['number_of_aps_packages_ul'])) { if(isset($_POST['number_of_aps_packages_ul']))
$number_of_aps_packages = -1; {
} $number_of_aps_packages = - 1;
$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
} else {
$number_of_aps_packages = 0;
} }
$customers_see_all = 0; $customers_see_all = intval($_POST['customers_see_all']);
if(isset($_POST['customers_see_all'])) $domains_see_all = intval($_POST['domains_see_all']);
$customers_see_all = intval($_POST['customers_see_all']); $caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = intval($_POST['change_serversettings']);
$domains_see_all = 0; $can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
if(isset($_POST['domains_see_all']))
$domains_see_all = intval($_POST['domains_see_all']);
$caneditphpsettings = 0;
if(isset($_POST['caneditphpsettings']))
$caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = 0;
if(isset($_POST['change_serversettings']))
$change_serversettings = isset($_POST['change_serversettings']) ? 1 : 0;
$tickets_see_all = 0;
if (isset($_POST['tickets_see_all']))
$tickets_see_all = intval($_POST['tickets_see_all']);
$diskspace = intval($_POST['diskspace']); $diskspace = intval($_POST['diskspace']);
if (isset($_POST['diskspace_ul'])) {
$diskspace = -1; if(isset($_POST['diskspace_ul']))
{
$diskspace = - 1;
} }
$traffic = doubleval_ressource($_POST['traffic']); $traffic = doubleval_ressource($_POST['traffic']);
if (isset($_POST['traffic_ul'])) {
$traffic = -1; if(isset($_POST['traffic_ul']))
{
$traffic = - 1;
} }
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
@@ -654,7 +560,6 @@ if($page == 'admins'
{ {
if($password != '') if($password != '')
{ {
$password = validatePassword($password);
$password = md5($password); $password = md5($password);
} }
else else
@@ -687,88 +592,7 @@ if($page == 'admins'
$change_serversettings = '0'; $change_serversettings = '0';
} }
if ($tickets_see_all != '1') { $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `name`='" . $db->escape($name) . "', `email`='" . $db->escape($email) . "', `def_language`='" . $db->escape($def_language) . "', `change_serversettings` = '" . $db->escape($change_serversettings) . "', `customers` = '" . $db->escape($customers) . "', `customers_see_all` = '" . $db->escape($customers_see_all) . "', `domains` = '" . $db->escape($domains) . "', `domains_see_all` = '" . $db->escape($domains_see_all) . "', `caneditphpsettings` = '" . (int)$caneditphpsettings . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `email_quota`='" . $db->escape($email_quota) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `ip`='" . (int)$ipaddress . "', `deactivated`='" . $db->escape($deactivated) . "', `can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ", `aps_packages`=" . (int)$number_of_aps_packages . " WHERE `adminid`='" . $db->escape($id) . "'");
$tickets_see_all = '0';
}
// check if a resource was set to something lower
// than actually used by the admin/reseller
$res_warning = "";
if ($customers != $result['customers'] && $customers < $result['customers_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'customers');
}
if ($domains != $result['domains'] && $domains < $result['domains_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'domains');
}
if ($diskspace != $result['diskspace'] && ($diskspace / 1024) != -1 && $diskspace < $result['diskspace_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'diskspace');
}
if ($traffic != $result['traffic'] && ($traffic / 1024 / 1024) != -1 && $traffic < $result['traffic_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'traffic');
}
if ($emails != $result['emails'] && $emails < $result['emails_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'emails');
}
if ($email_accounts != $result['email_accounts'] && $email_accounts < $result['email_accounts_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email accounts');
}
if ($email_forwarders != $result['email_forwarders'] && $email_forwarders < $result['email_forwarders_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email forwarders');
}
if ($email_quota != $result['email_quota'] && $email_quota < $result['email_quota_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email quota');
}
if ($email_autoresponder != $result['email_autoresponder'] && $email_autoresponder < $result['email_autoresponder_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email autoresponder');
}
if ($ftps != $result['ftps'] && $ftps < $result['ftps_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'ftps');
}
if ($tickets != $result['tickets'] && $tickets < $result['tickets_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'tickets');
}
if ($mysqls != $result['mysqls'] && $mysqls < $result['mysqls_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'mysqls');
}
if ($number_of_aps_packages != $result['aps_packages'] && $number_of_aps_packages < $result['aps_packages_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'aps packages');
}
if ($res_warning != "") {
$link = '';
$error = $res_warning;
eval("echo \"" . getTemplate('misc/error', '1') . "\";");
exit;
}
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET
`name`='" . $db->escape($name) . "',
`email`='" . $db->escape($email) . "',
`def_language`='" . $db->escape($def_language) . "',
`change_serversettings` = '" . $db->escape($change_serversettings) . "',
`customers` = '" . $db->escape($customers) . "',
`customers_see_all` = '" . $db->escape($customers_see_all) . "',
`domains` = '" . $db->escape($domains) . "',
`domains_see_all` = '" . $db->escape($domains_see_all) . "',
`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
`password` = '" . $password . "',
`diskspace`='" . $db->escape($diskspace) . "',
`traffic`='" . $db->escape($traffic) . "',
`subdomains`='" . $db->escape($subdomains) . "',
`emails`='" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders`='" . $db->escape($email_forwarders) . "',
`email_quota`='" . $db->escape($email_quota) . "',
`email_autoresponder`='" . $db->escape($email_autoresponder) . "',
`ftps`='" . $db->escape($ftps) . "',
`tickets`='" . $db->escape($tickets) . "',
`tickets_see_all`='".$db->escape($tickets_see_all) . "',
`mysqls`='" . $db->escape($mysqls) . "',
`ip`='" . (int)$ipaddress . "',
`deactivated`='" . $db->escape($deactivated) . "',
`can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ",
`aps_packages`=" . (int)$number_of_aps_packages . "
WHERE `adminid`='" . $db->escape($id) . "'");
$log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'");
$redirect_props = Array( $redirect_props = Array(
'page' => $page, 'page' => $page,
@@ -846,13 +670,6 @@ if($page == 'admins'
$result['email_quota'] = ''; $result['email_quota'] = '';
} }
$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, $result['email_autoresponder'], true, true);
if($result['email_autoresponder'] == '-1')
{
$result['email_autoresponder'] = '';
}
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true); $ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true);
if($result['ftps'] == '-1') if($result['ftps'] == '-1')
@@ -906,22 +723,14 @@ if($page == 'admins'
} }
} }
/*
$change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']); $change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']);
$customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']); $customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']);
$domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']); $domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']);
$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']); $caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']);
$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']); $deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']); $can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']);
*/
$result = htmlentities_array($result); $result = htmlentities_array($result);
$admin_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_edit.php';
$admin_edit_form = htmlform::genHTMLForm($admin_edit_data);
$title = $admin_edit_data['admin_edit']['title'];
$image = $admin_edit_data['admin_edit']['image'];
eval("echo \"" . getTemplate("admins/admins_edit") . "\";"); eval("echo \"" . getTemplate("admins/admins_edit") . "\";");
} }
} }

View File

@@ -14,13 +14,14 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
// Required code // Required code
define('AREA', 'admin'); define('AREA', 'admin');
require ("./lib/init.php"); require ("./lib/init.php");
require ("./lib/class_apsparser.php");
$Id = 0; $Id = 0;
if(isset($_GET['id']))$Id = (int)$_GET['id']; if(isset($_GET['id']))$Id = (int)$_GET['id'];

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -95,12 +95,9 @@ if($userinfo['change_serversettings'] == '1')
'<VIRTUAL_MAILBOX_BASE>' => $settings['system']['vmail_homedir'], '<VIRTUAL_MAILBOX_BASE>' => $settings['system']['vmail_homedir'],
'<VIRTUAL_UID_MAPS>' => $settings['system']['vmail_uid'], '<VIRTUAL_UID_MAPS>' => $settings['system']['vmail_uid'],
'<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'], '<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'],
'<AWSTATS_PATH>' => $settings['system']['awstats_path'],
'<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '', '<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '',
'<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? makeCorrectDir($settings['system']['mod_fcgid_tmpdir']) : '/tmp/', '<REALTIME_PORT>' => $settings['system']['realtime_port']
'<BASE_PATH>' => makeCorrectDir(dirname(__FILE__)),
'<BIND_CONFIG_PATH>' => makeCorrectDir($settings['system']['bindconf_directory']),
'<WEBSERVER_RELOAD_CMD>' => $settings['system']['apachereload_command'],
'<CUSTOMER_LOGS>' => makeCorrectDir($settings['system']['logfiles_directory'])
); );
$files = ''; $files = '';
$configpage = ''; $configpage = '';
@@ -113,7 +110,6 @@ if($userinfo['change_serversettings'] == '1')
if(is_array($value)) if(is_array($value))
{ {
$commands = implode("\n", $value); $commands = implode("\n", $value);
$commands = str_replace("\n\n", "\n", $commands);
if($commands != '') if($commands != '')
{ {

View File

@@ -12,21 +12,28 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
require_once('./lib/init.php');
if (isset($_POST['id'])) { require_once("./lib/init.php");
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'cronjobs' || $page == 'overview') { if($page == 'cronjobs'
if ($action == '') { || $page == 'overview')
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs'); {
if($action == '')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_cronjobs");
$fields = array( $fields = array(
'c.lastrun' => $lng['cron']['lastrun'], 'c.lastrun' => $lng['cron']['lastrun'],
@@ -49,81 +56,61 @@ if ($page == 'cronjobs' || $page == 'overview') {
$i = 0; $i = 0;
$count = 0; $count = 0;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($paging->checkDisplay($i)) { {
if($paging->checkDisplay($i))
{
$row = htmlentities_array($row); $row = htmlentities_array($row);
$row['lastrun'] = date('d.m.Y H:i', $row['lastrun']); $row['lastrun'] = date('d.m.Y H:i', $row['lastrun']);
$row['isactive'] = ((int)$row['isactive'] == 1) ? $lng['panel']['yes'] : $lng['panel']['no'];
if((int)$row['isactive'] == 1)
{
$row['isactive'] = $lng['panel']['yes'];
}
else
{
$row['isactive'] = $lng['panel']['no'];
}
$description = $lng['crondesc'][$row['desc_lng_key']]; $description = $lng['crondesc'][$row['desc_lng_key']];
eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjob') . "\";"); /*
* don't allow deletion of 'froxlor' cronjobs
*/
$vendor_a = explode('/', $row['module']);
$vendor = $vendor_a[0];
eval("\$crons.=\"" . getTemplate("cronjobs/cronjobs_cronjob") . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate('cronjobs/cronjobs') . "\";"); eval("echo \"" . getTemplate("cronjobs/cronjobs") . "\";");
} elseif ($action == 'new') {
/*
* @TODO later
*/
} elseif ($action == 'edit' && $id != 0) {
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'");
if ($result['cronfile'] != '') {
if (isset($_POST['send']) && $_POST['send'] == 'send') {
$isactive = isset($_POST['isactive']) ? 1 : 0;
$interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty');
$interval_interval = validate($_POST['interval_interval'], 'interval_interval');
if ($isactive != 1) {
$isactive = 0;
}
$interval = $interval_value . ' ' . strtoupper($interval_interval);
$db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "`
SET `isactive` = '".(int)$isactive."',
`interval` = '".$interval."'
WHERE `id` = '" . (int)$id . "'");
redirectTo($filename, Array('page' => $page, 's' => $s));
} else {
//$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
// interval
$interval_nfo = explode(' ', $result['interval']);
$interval_value = $interval_nfo[0];
$interval_interval = '';
$interval_interval .= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
// end of interval
$change_cronfile = false;
if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor') {
$change_cronfile = true;
}
$cronjobs_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/cronjobs/formfield.cronjobs_edit.php';
$cronjobs_edit_form = htmlform::genHTMLForm($cronjobs_edit_data);
$title = $cronjobs_edit_data['cronjobs_edit']['title'];
$image = $cronjobs_edit_data['cronjobs_edit']['image'];
eval("echo \"" . getTemplate('cronjobs/cronjob_edit') . "\";");
}
}
} }
elseif ($action == 'delete' && $id != 0) { elseif($action == 'new')
{
/* /*
* @TODO later * @TODO Finish me
*/
}
elseif($action == 'edit'
&& $id != 0)
{
/*
* @TODO Finish me
*/
}
elseif($action == 'delete'
&& $id != 0)
{
/*
* @TODO Finish me
*/ */
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -40,30 +40,44 @@ if($page == 'customers'
{ {
if($action == '') if($action == '')
{ {
// clear request data
unset($_SESSION['requestData']);
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers"); $log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers");
$fields = array( $fields = array(
'c.loginname' => $lng['login']['username'], 'c.loginname' => $lng['login']['username'],
'a.loginname' => $lng['admin']['admin'], 'a.loginname' => $lng['admin']['admin'],
'c.name' => $lng['customer']['name'], 'c.name' => $lng['customer']['name'],
'c.email' => $lng['customer']['email'],
'c.firstname' => $lng['customer']['firstname'], 'c.firstname' => $lng['customer']['firstname'],
'c.company' => $lng['customer']['company'], 'c.company' => $lng['customer']['company'],
'c.diskspace' => $lng['customer']['diskspace'], 'c.diskspace' => $lng['customer']['diskspace'],
'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')', 'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
'c.traffic' => $lng['customer']['traffic'], 'c.traffic' => $lng['customer']['traffic'],
'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')' 'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
'c.mysqls' => $lng['customer']['mysqls'],
'c.mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
'c.ftps' => $lng['customer']['ftps'],
'c.ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
'c.subdomains' => $lng['customer']['subdomains'],
'c.subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
'c.emails' => $lng['customer']['emails'],
'c.emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
'c.email_accounts' => $lng['customer']['accounts'],
'c.email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
'c.email_forwarders' => $lng['customer']['forwarders'],
'c.email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
'c.email_quota' => $lng['customer']['email_quota'],
'c.email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
'c.deactivated' => $lng['admin']['deactivated'],
'c.phpenabled' => $lng['admin']['phpenabled']
); );
if ($settings['system']['backup_enabled'] == '1') { if($settings['ticket']['enabled'] == 1)
$field['c.backup_allowed'] = $lng['backup_allowed']; {
$fields['c.tickets'] = $lng['customer']['tickets'];
$fields['c.tickets_used'] = $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')';
} }
$paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$customers = ''; $customers = '';
$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy($settings['panel']['natsorting']) . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng, true); $sortcode = $paging->getHtmlSortCode($lng, true);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -82,36 +96,7 @@ if($page == 'customers'
$row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']); $row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
$row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']); $row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']); $row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
$last_login = ((int)$row['lastlogin_succ'] == 0) ? $lng['panel']['neverloggedin'] : date('d.m.Y', $row['lastlogin_succ']); $row = str_replace_array('-1', 'UL', $row, 'diskspace traffic mysqls emails email_accounts email_forwarders ftps tickets subdomains');
/**
* percent-values for progressbar
*/
//For Disk usage
if ($row['diskspace'] > 0) {
$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
$disk_doublepercent = round($disk_percent*2, 2);
} else {
$disk_percent = 0;
$disk_doublepercent = 0;
}
if ($row['traffic'] > 0) {
$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
$traffic_doublepercent = round($traffic_percent*2, 2);
} else {
$traffic_percent = 0;
$traffic_doublepercent = 0;
}
$islocked = 0;
if($row['loginfail_count'] >= $settings['login']['maxloginattempts']
&& $row['lastlogin_fail'] > (time() - $settings['login']['deactivatetime'])
) {
$islocked = 1;
}
$row = str_replace_array('-1', 'UL', $row, 'diskspace traffic mysqls emails email_accounts email_forwarders ftps tickets subdomains email_autoresponder');
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$customers.=\"" . getTemplate("customers/customers_customer") . "\";"); eval("\$customers.=\"" . getTemplate("customers/customers_customer") . "\";");
$count++; $count++;
@@ -120,7 +105,6 @@ if($page == 'customers'
$i++; $i++;
} }
$customercount = $db->num_rows($result);
eval("echo \"" . getTemplate("customers/customers") . "\";"); eval("echo \"" . getTemplate("customers/customers") . "\";");
} }
elseif($action == 'su' elseif($action == 'su'
@@ -131,45 +115,17 @@ if($page == 'customers'
if($destination_user != '') if($destination_user != '')
{ {
if ($result['deactivated'] == '1') {
standard_error("usercurrentlydeactivated", $destination_user);
}
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'");
$s = md5(uniqid(microtime(), 1)); $s = md5(uniqid(microtime(), 1));
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')"); $db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
$log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'");
redirectTo('customer_index.php', Array('s' => $s), true); redirectTo('customer_index.php', Array('s' => $s));
} }
else else
{ {
redirectTo('index.php', Array('action' => 'login')); redirectTo('index.php', Array('action' => 'login'));
} }
} }
elseif($action == 'unlock'
&& $id != 0)
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$id . "' " . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . $db->escape($userinfo['adminid']) . "' "));
if($result['loginname'] != '')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$result = $db->query("UPDATE
`" . TABLE_PANEL_CUSTOMERS . "`
SET
`loginfail_count` = '0'
WHERE
`customerid`= '" . (int)$id . "'"
);
redirectTo($filename, Array('page' => $page, 's' => $s));
}
else
{
ask_yesno('customer_reallyunlock', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['loginname']);
}
}
}
elseif($action == 'delete' elseif($action == 'delete'
&& $id != 0) && $id != 0)
{ {
@@ -182,6 +138,7 @@ if($page == 'customers'
{ {
$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`"); $databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], ''); $db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
unset($db_root->password);
$last_dbserver = 0; $last_dbserver = 0;
while($row_database = $db->fetch_array($databases)) while($row_database = $db->fetch_array($databases))
@@ -191,20 +148,16 @@ if($page == 'customers'
$db_root->query('FLUSH PRIVILEGES;'); $db_root->query('FLUSH PRIVILEGES;');
$db_root->close(); $db_root->close();
$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], ''); $db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
unset($db_root->password);
$last_dbserver = $row_database['dbserver']; $last_dbserver = $row_database['dbserver'];
} }
if(mysql_get_server_info() < '5.0.2') { foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
}
$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($row_database['databasename']) . "'");
while($host = $db_root->fetch_array($host_res))
{ {
// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+) $mysql_access_host = trim($mysql_access_host);
$db_root->query('DROP USER \'' . $db_root->escape($row_database['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true); $db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($row_database['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
} }
$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`'); $db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`');
@@ -217,39 +170,13 @@ if($page == 'customers'
$db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$id . "'");
$domains_deleted = $db->affected_rows(); $domains_deleted = $db->affected_rows();
$db->query("DELETE FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_PANEL_HTACCESS . "` WHERE `customerid`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$id . "' AND `adminsession` = '0'"); $db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$id . "' AND `adminsession` = '0'");
$db->query("DELETE FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$id . "'");
$result2 = $db->query("SELECT `username` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$id . "'");
while($row = $db->fetch_array($result2))
{
$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name`='" . $row['username'] . "'");
}
$db->query("DELETE FROM `" . TABLE_FTP_GROUPS . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_FTP_GROUPS . "` WHERE `customerid`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid`='" . (int)$id . "'");
// Delete all waiting "create user" -tasks for this user, #276
// Note: the WHERE selects part of a serialized array, but it should be safe this way
$db->query("DELETE FROM `" . TABLE_PANEL_TASKS . "` WHERE `type` = '2' AND `data` LIKE '%:\"" . $db->escape($result['loginname']) . "\";%';");
// remove everything APS-related, #216
$apsresult = $db->query("SELECT `ID` FROM `".TABLE_APS_INSTANCES."` WHERE `CustomerID`='".(int)$id."'");
while($apsrow = $db->fetch_array($apsresult))
{
// remove all package related settings
$db->query("DELETE FROM `".TABLE_APS_SETTINGS."` WHERE `InstanceID` = '".(int)$apsrow['ID']."'");
// maybe some leftovers in the tasks
$db->query("DELETE FROM `".TABLE_APS_TASKS."` WHERE `InstanceID` = '".(int)$apsrow['ID']."'");
}
// now remove all user instances
$db->query("DELETE FROM `".TABLE_APS_INSTANCES."` WHERE `CustomerID`='".(int)$id."'");
// eventually some temp-setting-leftovers
$db->query("DELETE FROM `".TABLE_APS_TEMP_SETTINGS."` WHERE `CustomerID`='".(int)$id."'");
// eof APS-related removings, #216
$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` - 1 "; $admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` - 1 ";
$admin_update_query.= ", `domains_used` = `domains_used` - 0" . (int)($domains_deleted - $result['subdomains_used']); $admin_update_query.= ", `domains_used` = `domains_used` - 0" . (int)($domains_deleted - $result['subdomains_used']);
@@ -278,11 +205,6 @@ if($page == 'customers'
$admin_update_query.= ", `email_quota_used` = `email_quota_used` - 0" . (int)$result['email_quota']; $admin_update_query.= ", `email_quota_used` = `email_quota_used` - 0" . (int)$result['email_quota'];
} }
if($result['email_autoresponder'] != '-1')
{
$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` - 0" . (int)$result['email_autoresponder'];
}
if($result['subdomains'] != '-1') if($result['subdomains'] != '-1')
{ {
$admin_update_query.= ", `subdomains_used` = `subdomains_used` - 0" . (int)$result['subdomains']; $admin_update_query.= ", `subdomains_used` = `subdomains_used` - 0" . (int)$result['subdomains'];
@@ -298,11 +220,6 @@ if($page == 'customers'
$admin_update_query.= ", `tickets_used` = `tickets_used` - 0" . (int)$result['tickets']; $admin_update_query.= ", `tickets_used` = `tickets_used` - 0" . (int)$result['tickets'];
} }
if($result['aps_packages'] != '-1')
{
$admin_update_query.= ", `aps_packages_used` = `aps_packages_used` - 0" . (int)$result['aps_packages'];
}
if(($result['diskspace'] / 1024) != '-1') if(($result['diskspace'] / 1024) != '-1')
{ {
$admin_update_query.= ", `diskspace_used` = `diskspace_used` - 0" . (int)$result['diskspace']; $admin_update_query.= ", `diskspace_used` = `diskspace_used` - 0" . (int)$result['diskspace'];
@@ -312,19 +229,14 @@ if($page == 'customers'
$db->query($admin_update_query); $db->query($admin_update_query);
$log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
if (isset($_POST['delete_userfiles']) if(isset($_POST['delete_userfiles'])
&& (int)$_POST['delete_userfiles'] == 1 && (int)$_POST['delete_userfiles'] == 1)
) { {
inserttask('6', $result['loginname']); inserttask('6', $result['loginname']);
} }
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
/* /*
* move old tickets to archive * move old tickets to archive
*/ */
@@ -372,7 +284,6 @@ if($page == 'customers'
$customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di'); $customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di');
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
$gender = intval_ressource($_POST['gender']);
if(isset($_POST['diskspace_ul'])) if(isset($_POST['diskspace_ul']))
{ {
@@ -428,31 +339,9 @@ if($page == 'customers'
$email_quota = - 1; $email_quota = - 1;
} }
if($settings['autoresponder']['autoresponder_active'] == '1') $email_imap = intval_ressource($_POST['email_imap']);
{ $email_pop3 = intval_ressource($_POST['email_pop3']);
$email_autoresponder = intval_ressource($_POST['email_autoresponder']); $ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['email_autoresponder_ul']))
{
$email_autoresponder = - 1;
}
}
else
{
$email_autoresponder = 0;
}
$email_imap = 0;
if(isset($_POST['email_imap']))
$email_imap = intval_ressource($_POST['email_imap']);
$email_pop3 = 0;
if(isset($_POST['email_pop3']))
$email_pop3 = intval_ressource($_POST['email_pop3']);
$ftps = 0;
if(isset($_POST['ftps']))
$ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['ftps_ul'])) if(isset($_POST['ftps_ul']))
{ {
@@ -488,47 +377,10 @@ if($page == 'customers'
$number_of_aps_packages = 0; $number_of_aps_packages = 0;
} }
$createstdsubdomain = 0; $createstdsubdomain = intval($_POST['createstdsubdomain']);
if(isset($_POST['createstdsubdomain'])) $password = validate($_POST['customer_password'], 'password');
$createstdsubdomain = intval($_POST['createstdsubdomain']); $sendpassword = intval($_POST['sendpassword']);
$password = validate($_POST['new_customer_password'], 'password'); $phpenabled = intval($_POST['phpenabled']);
// only check if not empty,
// cause empty == generate password automatically
if($password != '')
{
$password = validatePassword($password);
}
$backup_allowed = 0;
if(isset($_POST['backup_allowed']))
$backup_allowed = intval($_POST['backup_allowed']);
if ($backup_allowed != 0)
{
$backup_allowed = 1;
}
// gender out of range? [0,2]
if ($gender < 0 || $gender > 2) {
$gender = 0;
}
$sendpassword = 0;
if(isset($_POST['sendpassword']))
$sendpassword = intval($_POST['sendpassword']);
$phpenabled = 0;
if(isset($_POST['phpenabled']))
$phpenabled = intval($_POST['phpenabled']);
$perlenabled = 0;
if(isset($_POST['perlenabled']))
$perlenabled = intval($_POST['perlenabled']);
$store_defaultindex = 0;
if(isset($_POST['store_defaultindex']))
$store_defaultindex = intval($_POST['store_defaultindex']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
@@ -538,7 +390,6 @@ if($page == 'customers'
|| ((($userinfo['email_accounts_used'] + $email_accounts) > $userinfo['email_accounts']) && $userinfo['email_accounts'] != '-1') || ((($userinfo['email_accounts_used'] + $email_accounts) > $userinfo['email_accounts']) && $userinfo['email_accounts'] != '-1')
|| ((($userinfo['email_forwarders_used'] + $email_forwarders) > $userinfo['email_forwarders']) && $userinfo['email_forwarders'] != '-1') || ((($userinfo['email_forwarders_used'] + $email_forwarders) > $userinfo['email_forwarders']) && $userinfo['email_forwarders'] != '-1')
|| ((($userinfo['email_quota_used'] + $email_quota) > $userinfo['email_quota']) && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1') || ((($userinfo['email_quota_used'] + $email_quota) > $userinfo['email_quota']) && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
|| ((($userinfo['email_autoresponder_used'] + $email_autoresponder) > $userinfo['email_autoresponder']) && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
|| ((($userinfo['ftps_used'] + $ftps) > $userinfo['ftps']) && $userinfo['ftps'] != '-1') || ((($userinfo['ftps_used'] + $ftps) > $userinfo['ftps']) && $userinfo['ftps'] != '-1')
|| ((($userinfo['tickets_used'] + $tickets) > $userinfo['tickets']) && $userinfo['tickets'] != '-1') || ((($userinfo['tickets_used'] + $tickets) > $userinfo['tickets']) && $userinfo['tickets'] != '-1')
|| ((($userinfo['subdomains_used'] + $subdomains) > $userinfo['subdomains']) && $userinfo['subdomains'] != '-1') || ((($userinfo['subdomains_used'] + $subdomains) > $userinfo['subdomains']) && $userinfo['subdomains'] != '-1')
@@ -549,7 +400,6 @@ if($page == 'customers'
|| ($email_accounts == '-1' && $userinfo['email_accounts'] != '-1') || ($email_accounts == '-1' && $userinfo['email_accounts'] != '-1')
|| ($email_forwarders == '-1' && $userinfo['email_forwarders'] != '-1') || ($email_forwarders == '-1' && $userinfo['email_forwarders'] != '-1')
|| ($email_quota == '-1' && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1') || ($email_quota == '-1' && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
|| ($email_autoresponder == '-1' && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
|| ($ftps == '-1' && $userinfo['ftps'] != '-1') || ($ftps == '-1' && $userinfo['ftps'] != '-1')
|| ($tickets == '-1' && $userinfo['tickets'] != '-1') || ($tickets == '-1' && $userinfo['tickets'] != '-1')
|| ($subdomains == '-1' && $userinfo['subdomains'] != '-1') || ($subdomains == '-1' && $userinfo['subdomains'] != '-1')
@@ -581,11 +431,11 @@ if($page == 'customers'
} }
else else
{ {
if(isset($_POST['new_loginname']) if(isset($_POST['loginname'])
&& $_POST['new_loginname'] != '') && $_POST['loginname'] != '')
{ {
$accountnumber = intval($settings['system']['lastaccountnumber']); $accountnumber = intval($settings['system']['lastaccountnumber']);
$loginname = validate($_POST['new_loginname'], 'loginname', '/^[a-z0-9\-_]+$/i'); $loginname = validate($_POST['loginname'], 'loginname', '/^[a-z0-9\-_]+$/i');
// Accounts which match systemaccounts are not allowed, filtering them // Accounts which match systemaccounts are not allowed, filtering them
@@ -593,11 +443,6 @@ if($page == 'customers'
{ {
standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']); standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
} }
//Additional filtering for Bug #962
if(function_exists('posix_getpwnam') && !in_array("posix_getpwnam",explode(",",ini_get('disable_functions'))) && posix_getpwnam($loginname)) {
standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
}
} }
else else
{ {
@@ -638,57 +483,12 @@ if($page == 'customers'
$phpenabled = '1'; $phpenabled = '1';
} }
if($perlenabled != '0')
{
$perlenabled = '1';
}
if($password == '') if($password == '')
{ {
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} }
$_theme = $settings['panel']['default_theme']; $result = $db->query("INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` (`adminid`, `loginname`, `password`, `name`, `firstname`, `company`, `street`, `zipcode`, `city`, `phone`, `fax`, `email`, `customernumber`, `def_language`, `documentroot`, `guid`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `standardsubdomain`, `phpenabled`, `imap`, `pop3`, `aps_packages`) VALUES ('" . (int)$userinfo['adminid'] . "', '" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($firstname) . "', '" . $db->escape($company) . "', '" . $db->escape($street) . "', '" . $db->escape($zipcode) . "', '" . $db->escape($city) . "', '" . $db->escape($phone) . "', '" . $db->escape($fax) . "', '" . $db->escape($email) . "', '" . $db->escape($customernumber) . "','" . $db->escape($def_language) . "', '" . $db->escape($documentroot) . "', '" . $db->escape($guid) . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '0', '" . $db->escape($phpenabled) . "', '" . $db->escape($email_imap) . "', '" . $db->escape($email_pop3) . "', '" . (int)$number_of_aps_packages . "')");
$result = $db->query(
"INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` SET
`adminid` = '" . (int)$userinfo['adminid'] . "',
`loginname` = '" . $db->escape($loginname) . "',
`password` = '" . md5($password) . "',
`name` = '" . $db->escape($name) . "',
`firstname` = '" . $db->escape($firstname) . "',
`gender` = '" . (int)$gender . "',
`company` = '" . $db->escape($company) . "',
`street` = '" . $db->escape($street) . "',
`zipcode` = '" . $db->escape($zipcode) . "',
`city` = '" . $db->escape($city) . "',
`phone` = '" . $db->escape($phone) . "',
`fax` = '" . $db->escape($fax) . "',
`email` = '" . $db->escape($email) . "',
`customernumber` = '" . $db->escape($customernumber) . "',
`def_language` = '" . $db->escape($def_language) . "',
`documentroot` = '" . $db->escape($documentroot) . "',
`guid` = '" . $db->escape($guid) . "',
`diskspace` = '" . $db->escape($diskspace) . "',
`traffic` = '" . $db->escape($traffic) . "',
`subdomains` = '" . $db->escape($subdomains) . "',
`emails` = '" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders` = '" . $db->escape($email_forwarders) . "',
`email_quota` = '" . $db->escape($email_quota) . "',
`ftps` = '" . $db->escape($ftps) . "',
`tickets` = '" . $db->escape($tickets) . "',
`mysqls` = '" . $db->escape($mysqls) . "',
`standardsubdomain` = '0',
`phpenabled` = '" . $db->escape($phpenabled) . "',
`imap` = '" . $db->escape($email_imap) . "',
`pop3` = '" . $db->escape($email_pop3) . "',
`aps_packages` = '" . (int)$number_of_aps_packages . "',
`perlenabled` = '" . $db->escape($perlenabled) . "',
`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
`backup_allowed` = '" . $db->escape($backup_allowed) . "',
`theme` = '" . $db->escape($_theme) . "'"
);
$customerid = $db->insert_id(); $customerid = $db->insert_id();
$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1"; $admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1";
@@ -717,12 +517,6 @@ if($page == 'customers'
$admin_update_query.= ", `email_quota_used` = `email_quota_used` + 0" . (int)$email_quota; $admin_update_query.= ", `email_quota_used` = `email_quota_used` + 0" . (int)$email_quota;
} }
if($email_autoresponder != '-1'
&& $settings['autoresponder']['autoresponder_active'] == 1)
{
$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` + 0" . (int)$email_autoresponder;
}
if($subdomains != '-1') if($subdomains != '-1')
{ {
$admin_update_query.= ", `subdomains_used` = `subdomains_used` + 0" . (int)$subdomains; $admin_update_query.= ", `subdomains_used` = `subdomains_used` + 0" . (int)$subdomains;
@@ -759,12 +553,10 @@ if($page == 'customers'
} }
$log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'");
inserttask('2', $loginname, $guid, $guid, $store_defaultindex); inserttask('2', $loginname, $guid, $guid);
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
// Add htpasswd for the webalizer stats // Add htpasswd for the webalizer stats
if(CRYPT_STD_DES == 1) if(CRYPT_STD_DES == 1)
{ {
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2); $saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
@@ -775,56 +567,37 @@ if($page == 'customers'
$htpasswdPassword = crypt($password); $htpasswdPassword = crypt($password);
} }
$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` " . "(`customerid`, `username`, `password`, `path`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($htpasswdPassword) . "', '" . $db->escape(makeCorrectDir($documentroot . '/webalizer/')) . "')");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added webalizer htpasswd for user '" . $loginname . "'");
if($settings['system']['awstats_enabled'] == '1') if($settings['system']['awstats_enabled'] == '1')
{ {
$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` " . "(`customerid`, `username`, `password`, `path`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($htpasswdPassword) . "', '" . $db->escape(makeCorrectDir($documentroot . '/awstats/')) . "')"); $db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` " . "(`customerid`, `username`, `password`, `path`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($htpasswdPassword) . "', '" . $db->escape(makeCorrectDir($documentroot . '/awstats/')) . "')");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added awstats htpasswd for user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added awstats htpasswd for user '" . $loginname . "'");
} }
else
{
$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` " . "(`customerid`, `username`, `password`, `path`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($htpasswdPassword) . "', '" . $db->escape(makeCorrectDir($documentroot . '/webalizer/')) . "')");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added webalizer htpasswd for user '" . $loginname . "'");
}
inserttask('1'); inserttask('1');
$cryptPassword = makeCryptPassword($password); $result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')"); $result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'");
if($createstdsubdomain == '1') if($createstdsubdomain == '1')
{ {
if (isset($settings['system']['stdsubdomain'])
&& $settings['system']['stdsubdomain'] != ''
) {
$_stdsubdomain = $loginname . '.' . $settings['system']['stdsubdomain'];
}
else
{
$_stdsubdomain = $loginname . '.' . $settings['system']['hostname'];
}
$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET " . $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET " .
"`domain` = '". $db->escape($_stdsubdomain) . "', " . "`domain` = '". $db->escape($loginname . '.' . $settings['system']['hostname']) . "', " .
"`customerid` = '" . (int)$customerid . "', " . "`customerid` = '" . (int)$customerid . "', " .
"`adminid` = '" . (int)$userinfo['adminid'] . "', " . "`adminid` = '" . (int)$userinfo['adminid'] . "', " .
"`parentdomainid` = '-1', " . "`parentdomainid` = '-1', " .
"`ipandport` = '" . $db->escape($settings['system']['defaultip']) . "', " .
"`documentroot` = '" . $db->escape($documentroot) . "', " . "`documentroot` = '" . $db->escape($documentroot) . "', " .
"`zonefile` = '', " . "`zonefile` = '', " .
"`isemaildomain` = '0', " . "`isemaildomain` = '0', " .
"`caneditdomain` = '0', " . "`caneditdomain` = '0', " .
"`openbasedir` = '1', " . "`openbasedir` = '1', " .
"`safemode` = '1', " .
"`speciallogfile` = '0', " . "`speciallogfile` = '0', " .
"`specialsettings` = '', " . "`specialsettings` = ''");
"`add_date` = '".date('Y-m-d')."'");
$domainid = $db->insert_id(); $domainid = $db->insert_id();
// set ip <-> domain connection
$db->query("INSERT INTO `".TABLE_DOMAINTOIP."` SET
`id_domain` = '".$domainid."',
`id_ipandports` = '".(int)$settings['system']['defaultip']."'"
);
$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$customerid . '\''); $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$customerid . '\'');
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $loginname . "'");
inserttask('1'); inserttask('1');
@@ -835,6 +608,7 @@ if($page == 'customers'
$replace_arr = array( $replace_arr = array(
'FIRSTNAME' => $firstname, 'FIRSTNAME' => $firstname,
'NAME' => $name, 'NAME' => $name,
'TITLE' => $title,
'COMPANY' => $company, 'COMPANY' => $company,
'SALUTATION' => getCorrectUserSalutation(array('firstname' => $firstname, 'name' => $name, 'company' => $company)), 'SALUTATION' => getCorrectUserSalutation(array('firstname' => $firstname, 'name' => $name, 'company' => $company)),
'USERNAME' => $loginname, 'USERNAME' => $loginname,
@@ -848,22 +622,23 @@ if($page == 'customers'
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'createcustomer_mailbody\''); $result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'createcustomer_mailbody\'');
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['createcustomer']['mailbody']), $replace_arr)); $mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['createcustomer']['mailbody']), $replace_arr));
$_mailerror = false; $mail->From = $userinfo['email'];
try { $mail->FromName = $userinfo['name'];
$mail->Subject = $mail_subject; $mail->Subject = $mail_subject;
$mail->AltBody = $mail_body; $mail->Body = $mail_body;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body)); $mail->AddAddress($email, getCorrectUserSalutation(array('firstname' => $firstname, 'name' => $name, 'company' => $company)));
$mail->AddAddress($email, getCorrectUserSalutation(array('firstname' => $firstname, 'name' => $name, 'company' => $company)));
$mail->Send(); if(!$mail->Send())
} catch(phpmailerException $e) { {
$mailerr_msg = $e->errorMessage(); if($mail->ErrorInfo != '')
$_mailerror = true; {
} catch (Exception $e) { $mailerr_msg = $mail->ErrorInfo;
$mailerr_msg = $e->getMessage(); }
$_mailerror = true; else
} {
$mailerr_msg = $email;
}
if ($_mailerror) {
$log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg); $log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error('errorsendingmail', $email); standard_error('errorsendingmail', $email);
} }
@@ -881,7 +656,7 @@ if($page == 'customers'
while(list($language_file, $language_name) = each($languages)) while(list($language_file, $language_name) = each($languages))
{ {
$language_options.= makeoption($language_name, $language_file, $settings['panel']['standardlanguage'], true); $language_options.= makeoption($language_name, $language_file, $userinfo['def_language'], true);
} }
$diskspace_ul = makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $diskspace_ul = makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
@@ -891,22 +666,15 @@ if($page == 'customers'
$email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', '1');
$gender_options = makeoption($lng['gender']['undef'], 0, true, true, true); $email_imap = makeyesno('email_imap', '1', '0', '1');
$gender_options .= makeoption($lng['gender']['male'], 1, null, true, true); $email_pop3 = makeyesno('email_pop3', '1', '0', '1');
$gender_options .= makeoption($lng['gender']['female'], 2, null, true, true); $sendpassword = makeyesno('sendpassword', '1', '0', '1');
$phpenabled = makeyesno('phpenabled', '1', '0', '1');
$customer_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_add.php';
$customer_add_form = htmlform::genHTMLForm($customer_add_data);
$title = $customer_add_data['customer_add']['title'];
$image = $customer_add_data['customer_add']['image'];
eval("echo \"" . getTemplate("customers/customers_add") . "\";"); eval("echo \"" . getTemplate("customers/customers_add") . "\";");
} }
} }
@@ -932,9 +700,8 @@ if($page == 'customers'
$email = $idna_convert->encode(validate($_POST['email'], 'email')); $email = $idna_convert->encode(validate($_POST['email'], 'email'));
$customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di'); $customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di');
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$password = validate($_POST['new_customer_password'], 'new password'); $password = validate($_POST['customer_password'], 'new password');
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
$gender = intval_ressource($_POST['gender']);
if(isset($_POST['diskspace_ul'])) if(isset($_POST['diskspace_ul']))
{ {
@@ -990,31 +757,9 @@ if($page == 'customers'
$email_quota = - 1; $email_quota = - 1;
} }
if($settings['autoresponder']['autoresponder_active'] == '1') $email_imap = intval_ressource($_POST['email_imap']);
{ $email_pop3 = intval_ressource($_POST['email_pop3']);
$email_autoresponder = intval_ressource($_POST['email_autoresponder']); $ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['email_autoresponder_ul']))
{
$email_autoresponder = - 1;
}
}
else
{
$email_autoresponder = 0;
}
$email_imap = 0;
if(isset($_POST['email_imap']))
$email_imap = intval_ressource($_POST['email_imap']);
$email_pop3 = 0;
if(isset($_POST['email_pop3']))
$email_pop3 = intval_ressource($_POST['email_pop3']);
$ftps = 0;
if(isset($_POST['ftps']))
$ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['ftps_ul'])) if(isset($_POST['ftps_ul']))
{ {
@@ -1029,57 +774,23 @@ if($page == 'customers'
$tickets = - 1; $tickets = - 1;
} }
$backup_allowed = 0; $mysqls = intval_ressource($_POST['mysqls']);
if (isset($_POST['backup_allowed']))
$backup_allowed = intval($_POST['backup_allowed']);
if($backup_allowed != '0'){
$backup_allowed = 1;
}
// gender out of range? [0,2]
if ($gender < 0 || $gender > 2) {
$gender = 0;
}
$mysqls = 0;
if(isset($_POST['mysqls']))
$mysqls = intval_ressource($_POST['mysqls']);
if(isset($_POST['mysqls_ul'])) if(isset($_POST['mysqls_ul']))
{ {
$mysqls = - 1; $mysqls = - 1;
} }
if($settings['aps']['aps_active'] == '1') $number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
{
$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
if(isset($_POST['number_of_aps_packages_ul'])) if(isset($_POST['number_of_aps_packages_ul']))
{
$number_of_aps_packages = - 1;
}
}
else
{ {
$number_of_aps_packages = 0; $number_of_aps_packages = - 1;
} }
$createstdsubdomain = 0; $createstdsubdomain = intval($_POST['createstdsubdomain']);
if(isset($_POST['createstdsubdomain'])) $deactivated = intval($_POST['deactivated']);
$createstdsubdomain = intval($_POST['createstdsubdomain']); $phpenabled = intval($_POST['phpenabled']);
$deactivated = 0;
if(isset($_POST['deactivated']))
$deactivated = intval($_POST['deactivated']);
$phpenabled = 0;
if(isset($_POST['phpenabled']))
$phpenabled = intval($_POST['phpenabled']);
$perlenabled = 0;
if(isset($_POST['perlenabled']))
$perlenabled = intval($_POST['perlenabled']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
@@ -1089,7 +800,6 @@ if($page == 'customers'
|| ((($userinfo['email_accounts_used'] + $email_accounts - $result['email_accounts']) > $userinfo['email_accounts']) && $userinfo['email_accounts'] != '-1') || ((($userinfo['email_accounts_used'] + $email_accounts - $result['email_accounts']) > $userinfo['email_accounts']) && $userinfo['email_accounts'] != '-1')
|| ((($userinfo['email_forwarders_used'] + $email_forwarders - $result['email_forwarders']) > $userinfo['email_forwarders']) && $userinfo['email_forwarders'] != '-1') || ((($userinfo['email_forwarders_used'] + $email_forwarders - $result['email_forwarders']) > $userinfo['email_forwarders']) && $userinfo['email_forwarders'] != '-1')
|| ((($userinfo['email_quota_used'] + $email_quota - $result['email_quota']) > $userinfo['email_quota']) && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1') || ((($userinfo['email_quota_used'] + $email_quota - $result['email_quota']) > $userinfo['email_quota']) && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
|| ((($userinfo['email_autoresponder_used'] + $email_autoresponder - $result['email_autoresponder']) > $userinfo['email_autoresponder']) && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
|| ((($userinfo['ftps_used'] + $ftps - $result['ftps']) > $userinfo['ftps']) && $userinfo['ftps'] != '-1') || ((($userinfo['ftps_used'] + $ftps - $result['ftps']) > $userinfo['ftps']) && $userinfo['ftps'] != '-1')
|| ((($userinfo['tickets_used'] + $tickets - $result['tickets']) > $userinfo['tickets']) && $userinfo['tickets'] != '-1') || ((($userinfo['tickets_used'] + $tickets - $result['tickets']) > $userinfo['tickets']) && $userinfo['tickets'] != '-1')
|| ((($userinfo['subdomains_used'] + $subdomains - $result['subdomains']) > $userinfo['subdomains']) && $userinfo['subdomains'] != '-1') || ((($userinfo['subdomains_used'] + $subdomains - $result['subdomains']) > $userinfo['subdomains']) && $userinfo['subdomains'] != '-1')
@@ -1100,7 +810,6 @@ if($page == 'customers'
|| ($email_accounts == '-1' && $userinfo['email_accounts'] != '-1') || ($email_accounts == '-1' && $userinfo['email_accounts'] != '-1')
|| ($email_forwarders == '-1' && $userinfo['email_forwarders'] != '-1') || ($email_forwarders == '-1' && $userinfo['email_forwarders'] != '-1')
|| ($email_quota == '-1' && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1') || ($email_quota == '-1' && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
|| ($email_autoresponder == '-1' && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
|| ($ftps == '-1' && $userinfo['ftps'] != '-1') || ($ftps == '-1' && $userinfo['ftps'] != '-1')
|| ($tickets == '-1' && $userinfo['tickets'] != '-1') || ($tickets == '-1' && $userinfo['tickets'] != '-1')
|| ($subdomains == '-1' && $userinfo['subdomains'] != '-1') || ($subdomains == '-1' && $userinfo['subdomains'] != '-1')
@@ -1134,7 +843,6 @@ if($page == 'customers'
{ {
if($password != '') if($password != '')
{ {
$password = validatePassword($password);
$password = md5($password); $password = md5($password);
} }
else else
@@ -1150,40 +858,9 @@ if($page == 'customers'
if($createstdsubdomain == '1' if($createstdsubdomain == '1'
&& $result['standardsubdomain'] == '0') && $result['standardsubdomain'] == '0')
{ {
if (isset($settings['system']['stdsubdomain']) $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `safemode`, `speciallogfile`, `specialsettings`) " . "VALUES ('" . $db->escape($result['loginname'] . '.' . $settings['system']['hostname']) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '1', '0', '')");
&& $settings['system']['stdsubdomain'] != ''
) {
$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['stdsubdomain'];
}
else
{
$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname'];
}
$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET
`domain` = '" . $db->escape($_stdsubdomain) . "',
`customerid` = '" . (int)$result['customerid'] . "',
`adminid` = '" . (int)$userinfo['adminid'] . "',
`parentdomainid` = '-1',
`documentroot` = '" . $db->escape($result['documentroot']) . "',
`zonefile` = '',
`isemaildomain` = '0',
`caneditdomain` = '0',
`openbasedir` = '1',
`speciallogfile` = '0',
`specialsettings` = '',
`add_date` = '".date('Y-m-d')."'"
);
$domainid = $db->insert_id(); $domainid = $db->insert_id();
// set ip <-> domain connection $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
$db->query("INSERT INTO `".TABLE_DOMAINTOIP."` SET
`id_domain` = '".$domainid."',
`id_ipandports` = '".(int)$settings['system']['defaultip']."'"
);
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET
`standardsubdomain`='" . (int)$domainid . "'
WHERE `customerid`='" . (int)$result['customerid'] . "'"
);
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
} }
@@ -1191,12 +868,8 @@ if($page == 'customers'
if($createstdsubdomain == '0' if($createstdsubdomain == '0'
&& $result['standardsubdomain'] != '0') && $result['standardsubdomain'] != '0')
{ {
$db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` $db->query('DELETE FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `id`=\'' . (int)$result['standardsubdomain'] . '\'');
WHERE `id`='" . (int)$result['standardsubdomain'] . "'"); $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'0\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
$db->query("DELETE FROM `" . TABLE_DOMAINTOIP . "`
WHERE `id_domain`='" . (int)$result['standardsubdomain'] . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET
`standardsubdomain`= '0' WHERE `customerid`= '" . (int)$result['customerid'] . "'");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically deleted standardsubdomain for user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically deleted standardsubdomain for user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
} }
@@ -1211,61 +884,16 @@ if($page == 'customers'
$phpenabled = '1'; $phpenabled = '1';
} }
if($perlenabled != '0') if($phpenabled != $result['phpenabled'])
{
$perlenabled = '1';
}
if($phpenabled != $result['phpenabled']
|| $perlenabled != $result['perlenabled'])
{ {
inserttask('1'); inserttask('1');
} }
if($deactivated != $result['deactivated']) if($deactivated != $result['deactivated'])
{ {
$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : (int)$result['pop3']) . "', `imap`='" . (($deactivated) ? '0' : (int)$result['imap']) . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : '1') . "', `imap`='" . (($deactivated) ? '0' : '1') . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'");
/* Retrieve customer's databases */
$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
$last_dbserver = 0;
/* For each of them */
while($row_database = $db->fetch_array($databases))
{
if($last_dbserver != $row_database['dbserver'])
{
$db_root->query('FLUSH PRIVILEGES;');
$db_root->close();
$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
$last_dbserver = $row_database['dbserver'];
}
foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$mysql_access_host = trim($mysql_access_host);
/* Prevent access, if deactivated */
if($deactivated)
{
// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
}
else /* Otherwise grant access */
{
$db_root->query('GRANT ALL PRIVILEGES ON `' . $db_root->escape($row_database['databasename']) .'`.* TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
}
}
}
/* At last flush the new privileges */
$db_root->query('FLUSH PRIVILEGES;');
$db_root->close();
$log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
} }
@@ -1284,13 +912,9 @@ if($page == 'customers'
$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'");
} }
// $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `gender`='" . $db->escape($gender) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `backup_allowed`='" . $db->escape($backup_allowed) . "' WHERE `customerid`='" . (int)$id . "'");
$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` "; $admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` ";
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
if($mysqls != '-1' if($mysqls != '-1'
|| $result['mysqls'] != '-1') || $result['mysqls'] != '-1')
{ {
@@ -1371,22 +995,6 @@ if($page == 'customers'
} }
} }
if($email_autoresponder != '-1'
|| $result['email_autoresponder'] != '-1')
{
$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` ";
if($email_autoresponder != '-1')
{
$admin_update_query.= " + 0" . (int)$email_autoresponder . " ";
}
if($result['email_autoresponder'] != '-1')
{
$admin_update_query.= " - 0" . (int)$result['email_autoresponder'] . " ";
}
}
if($subdomains != '-1' if($subdomains != '-1'
|| $result['subdomains'] != '-1') || $result['subdomains'] != '-1')
{ {
@@ -1539,13 +1147,6 @@ if($page == 'customers'
$result['email_quota'] = ''; $result['email_quota'] = '';
} }
$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, $result['email_autoresponder'], true, true);
if($result['email_autoresponder'] == '-1')
{
$result['email_autoresponder'] = '';
}
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true); $ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true);
if($result['ftps'] == '-1') if($result['ftps'] == '-1')
@@ -1574,18 +1175,13 @@ if($page == 'customers'
$result['aps_packages'] = ''; $result['aps_packages'] = '';
} }
$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', (($result['standardsubdomain'] != '0') ? '1' : '0'));
$phpenabled = makeyesno('phpenabled', '1', '0', $result['phpenabled']);
$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
$email_imap = makeyesno('email_imap', '1', '0', $result['imap']);
$email_pop3 = makeyesno('email_pop3', '1', '0', $result['pop3']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$gender_options = makeoption($lng['gender']['undef'], 0, ($result['gender'] == '0' ? true : false), true, true);
$gender_options .= makeoption($lng['gender']['male'], 1, ($result['gender'] == '1' ? true : false), true, true);
$gender_options .= makeoption($lng['gender']['female'], 2, ($result['gender'] == '2' ? true : false), true, true);
$customer_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_edit.php';
$customer_edit_form = htmlform::genHTMLForm($customer_edit_data);
$title = $customer_edit_data['customer_edit']['title'];
$image = $customer_edit_data['customer_edit']['image'];
eval("echo \"" . getTemplate("customers/customers_edit") . "\";"); eval("echo \"" . getTemplate("customers/customers_edit") . "\";");
} }
} }

File diff suppressed because it is too large Load Diff

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -61,7 +61,6 @@ if($page == 'overview')
SUM(`email_accounts_used`) AS `email_accounts_used`, SUM(`email_accounts_used`) AS `email_accounts_used`,
SUM(`email_forwarders_used`) AS `email_forwarders_used`, SUM(`email_forwarders_used`) AS `email_forwarders_used`,
SUM(`email_quota_used`) AS `email_quota_used`, SUM(`email_quota_used`) AS `email_quota_used`,
SUM(`email_autoresponder_used`) AS `email_autoresponder_used`,
SUM(`ftps_used`) AS `ftps_used`, SUM(`ftps_used`) AS `ftps_used`,
SUM(`tickets_used`) AS `tickets_used`, SUM(`tickets_used`) AS `tickets_used`,
SUM(`subdomains_used`) AS `subdomains_used`, SUM(`subdomains_used`) AS `subdomains_used`,
@@ -85,40 +84,26 @@ if($page == 'overview')
$webserverinterface = strtoupper(@php_sapi_name()); $webserverinterface = strtoupper(@php_sapi_name());
if((isset($_GET['lookfornewversion']) && $_GET['lookfornewversion'] == 'yes') if((isset($_GET['lookfornewversion']) && $_GET['lookfornewversion'] == 'yes')
|| (isset($lookfornewversion) && $lookfornewversion == 'yes')) || (isset($lookfornewversion) && $lookfornewversion == 'yes'))
{ {
$update_check_uri = 'http://version.froxlor.org/Froxlor/legacy/' . $version; $update_check_uri = 'http://version.froxlor.org/Froxlor/legacy/' . $version;
if(ini_get('allow_url_fopen')) if(strtolower(ini_get('allow_url_fopen')) == 'on')
{ {
$latestversion = @file($update_check_uri); $latestversion = @file($update_check_uri);
if (isset($latestversion[0])) $latestversion = explode(':', $latestversion);
if(is_array($latestversion)
&& count($latestversion) >= 2)
{ {
$latestversion = explode('|', $latestversion[0]); $lookfornewversion_lable = $latestversion[0];
$lookfornewversion_link = $latestversion[1];
$lookfornewversion_addinfo = '';
if(is_array($latestversion) if(count($latestversion) >= 3)
&& count($latestversion) >= 1)
{ {
$_version = $latestversion[0]; $lookfornewversion_addinfo = $latestversion[2];
$_message = isset($latestversion[1]) ? $latestversion[1] : '';
$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
// add the branding so debian guys are not gettings confused
// about their version-number
$lookfornewversion_lable = $_version.$branding;
$lookfornewversion_link = $_link;
$lookfornewversion_addinfo = $_message;
if (version_compare2($version, $_version) == -1) {
$isnewerversion = 1;
} else {
$isnewerversion = 0;
}
}
else
{
redirectTo($update_check_uri.'/pretty', NULL);
} }
} }
else else
@@ -136,14 +121,13 @@ if($page == 'overview')
$lookfornewversion_lable = $lng['admin']['lookfornewversion']['clickhere']; $lookfornewversion_lable = $lng['admin']['lookfornewversion']['clickhere'];
$lookfornewversion_link = htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes'); $lookfornewversion_link = htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
$lookfornewversion_addinfo = ''; $lookfornewversion_addinfo = '';
$isnewerversion = 0;
} }
$userinfo['diskspace'] = round($userinfo['diskspace'] / 1024, $settings['panel']['decimal_places']); $userinfo['diskspace'] = round($userinfo['diskspace'] / 1024, $settings['panel']['decimal_places']);
$userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, $settings['panel']['decimal_places']); $userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
$userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']); $userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
$userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']); $userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']);
$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps tickets subdomains aps_packages'); $userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps tickets subdomains aps_packages');
$cron_last_runs = getCronjobsLastRun(); $cron_last_runs = getCronjobsLastRun();
$outstanding_tasks = getOutstandingTasks(); $outstanding_tasks = getOutstandingTasks();
@@ -188,13 +172,13 @@ if($page == 'overview')
} }
// Try to get the uptime // Try to get the uptime
// First: With exec (let's hope it's enabled for the Froxlor - vHost) // First: With exec (let's hope it's enabled for the SysCP - vHost)
$uptime_array = explode(" ", @file_get_contents("/proc/uptime")); $uptime_array = explode(" ", @file_get_contents("/proc/uptime"));
if(is_array($uptime_array) if(is_array($uptime_array)
&& isset($uptime_array[0]) && isset($uptime_array[0])
&& is_numeric($uptime_array[0])) && is_numeric($uptime_array[0]))
{ {
// Some calculatioon to get a nicly formatted display // Some calculatioon to get a nicly formatted display
@@ -223,7 +207,7 @@ if($page == 'overview')
elseif($page == 'change_password') elseif($page == 'change_password')
{ {
if(isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$old_password = validate($_POST['old_password'], 'old password'); $old_password = validate($_POST['old_password'], 'old password');
@@ -267,7 +251,7 @@ elseif($page == 'change_password')
elseif($page == 'change_language') elseif($page == 'change_language')
{ {
if(isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
@@ -284,47 +268,13 @@ elseif($page == 'change_language')
{ {
$language_options = ''; $language_options = '';
$default_lang = $settings['panel']['standardlanguage'];
if($userinfo['def_language'] != '') {
$default_lang = $userinfo['def_language'];
}
while(list($language_file, $language_name) = each($languages)) while(list($language_file, $language_name) = each($languages))
{ {
$language_options.= makeoption($language_name, $language_file, $default_lang, true); $language_options.= makeoption($language_name, $language_file, $userinfo['def_language'], true);
} }
eval("echo \"" . getTemplate("index/change_language") . "\";"); eval("echo \"" . getTemplate("index/change_language") . "\";");
} }
} }
elseif($page == 'change_theme')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send'
) {
$theme = validate($_POST['theme'], 'theme');
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `adminid`='" . (int)$userinfo['adminid'] . "'"); ?>
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(ADM_ACTION, LOG_NOTICE, "changed his/her theme to '" . $theme . "'");
redirectTo($filename, Array('s' => $s));
}
else
{
$theme_options = '';
$default_theme = $settings['panel']['default_theme'];
if($userinfo['theme'] != '') {
$default_theme = $userinfo['theme'];
}
$themes_avail = getThemes();
foreach($themes_avail as $t)
{
$theme_options.= makeoption($t, $t, $default_theme, true);
}
eval("echo \"" . getTemplate("index/change_theme") . "\";");
}
}

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -83,7 +83,7 @@ if($page == 'ipsandports'
if(isset($result['id']) if(isset($result['id'])
&& $result['id'] == $id) && $result['id'] == $id)
{ {
$result_checkdomain = $db->query_first("SELECT `id_domain` as `id` FROM `" . TABLE_DOMAINTOIP . "` WHERE `id_ipandports`='" . (int)$id . "'"); $result_checkdomain = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `ipandport`='" . (int)$id . "'");
if($result_checkdomain['id'] == '') if($result_checkdomain['id'] == '')
{ {
@@ -102,16 +102,9 @@ if($page == 'ipsandports'
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'");
// also, remove connections to domains (multi-stack)
$db->query("DELETE FROM `".TABLE_DOMAINTOIP."` WHERE `id_ipandports`='".(int)$id."'");
$log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
else else
@@ -143,27 +136,16 @@ if($page == 'ipsandports'
{ {
$ip = validate_ip($_POST['ip']); $ip = validate_ip($_POST['ip']);
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport')); $port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0; $listen_statement = intval($_POST['listen_statement']);
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0; $namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0; $vhostcontainer = intval($_POST['vhostcontainer']);
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/'); $specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0; $vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
$ssl = intval($_POST['ssl']);
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/'); $default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
$docroot = validate($_POST['docroot'], 'docroot');
if((int)$settings['system']['use_ssl'] == 1)
{
$ssl = intval($_POST['ssl']);
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
$ssl_cert_chainfile = validate($_POST['ssl_cert_chainfile'], 'ssl_cert_chainfile');
} else {
$ssl = 0;
$ssl_cert_file = '';
$ssl_key_file = '';
$ssl_ca_file = '';
$ssl_cert_chainfile = '';
}
if($listen_statement != '1') if($listen_statement != '1')
{ {
@@ -205,20 +187,6 @@ if($page == 'ipsandports'
$ssl_ca_file = makeCorrectFile($ssl_ca_file); $ssl_ca_file = makeCorrectFile($ssl_ca_file);
} }
if($ssl_cert_chainfile != '')
{
$ssl_cert_chainfile = makeCorrectFile($ssl_cert_chainfile);
}
if(strlen(trim($docroot)) > 0)
{
$docroot = makeCorrectDir($docroot);
}
else
{
$docroot = '';
}
$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'"); $result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");
if($result_checkfordouble['id'] != '') if($result_checkfordouble['id'] != '')
@@ -227,23 +195,7 @@ if($page == 'ipsandports'
} }
else else
{ {
$db->query("INSERT INTO `" . TABLE_PANEL_IPSANDPORTS . "` $db->query("INSERT INTO `" . TABLE_PANEL_IPSANDPORTS . "` (`ip`, `port`, `listen_statement`, `namevirtualhost_statement`, `vhostcontainer`, `vhostcontainer_servername_statement`, `specialsettings`, `ssl`, `ssl_cert_file`, `ssl_key_file`, `ssl_ca_file`, `default_vhostconf_domain`) VALUES ('" . $db->escape($ip) . "', '" . (int)$port . "', '" . (int)$listen_statement . "', '" . (int)$namevirtualhost_statement . "', '" . (int)$vhostcontainer . "', '" . (int)$vhostcontainer_servername_statement . "', '" . $db->escape($specialsettings) . "', '" . (int)$ssl . "', '" . $db->escape($ssl_cert_file) . "', '" . $db->escape($ssl_key_file) . "', '" . $db->escape($ssl_ca_file) . "', '" . $db->escape($default_vhostconf_domain) . "')");
SET
`ip` = '" . $db->escape($ip) . "',
`port` = '" . (int)$port . "',
`listen_statement` = '" . (int)$listen_statement . "',
`namevirtualhost_statement` = '" . (int)$namevirtualhost_statement . "',
`vhostcontainer` = '" . (int)$vhostcontainer . "',
`vhostcontainer_servername_statement` = '" . (int)$vhostcontainer_servername_statement . "',
`specialsettings` = '" . $db->escape($specialsettings) . "',
`ssl` = '" . (int)$ssl . "',
`ssl_cert_file` = '" . $db->escape($ssl_cert_file) . "',
`ssl_key_file` = '" . $db->escape($ssl_key_file) . "',
`ssl_ca_file` = '" . $db->escape($ssl_ca_file) . "',
`ssl_cert_chainfile` = '" . $db->escape($ssl_cert_chainfile) . "',
`default_vhostconf_domain` = '" . $db->escape($default_vhostconf_domain) . "',
`docroot` = '" . $db->escape($docroot) . "';
");
if(filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)) if(filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6))
{ {
@@ -252,29 +204,17 @@ if($page == 'ipsandports'
$log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
/*
$enable_ssl = makeyesno('ssl', '1', '0', '0'); $enable_ssl = makeyesno('ssl', '1', '0', '0');
$listen_statement = makeyesno('listen_statement', '1', '0', '1'); $listen_statement = makeyesno('listen_statement', '1', '0', '1');
$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1'); $namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1');
$vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1'); $vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1');
$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1'); $vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1');
*/
$ipsandports_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_add.php';
$ipsandports_add_form = htmlform::genHTMLForm($ipsandports_add_data);
$title = $ipsandports_add_data['ipsandports_add']['title'];
$image = $ipsandports_add_data['ipsandports_add']['image'];
eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";"); eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";");
} }
} }
@@ -292,34 +232,16 @@ if($page == 'ipsandports'
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport')); $port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'"); $result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");
$result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'"); $result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'");
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0; $listen_statement = intval($_POST['listen_statement']);
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0; $namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0; $vhostcontainer = intval($_POST['vhostcontainer']);
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/'); $specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0; $vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
$ssl = intval($_POST['ssl']);
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/'); $default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
$docroot = validate($_POST['docroot'], 'docroot');
if((int)$settings['system']['use_ssl'] == 1
/*
* check here if ssl is even checked, cause if not, we don't need
* to validate and set all the $ssl_*_file vars
*/
&& isset($_POST['ssl'])
&& $_POST['ssl'] != 0
) {
$ssl = 1;
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
$ssl_cert_chainfile = validate($_POST['ssl_cert_chainfile'], 'ssl_cert_chainfile');
} else {
$ssl = 0;
$ssl_cert_file = '';
$ssl_key_file = '';
$ssl_ca_file = '';
$ssl_cert_chainfile = '';
}
if($listen_statement != '1') if($listen_statement != '1')
{ {
@@ -361,20 +283,6 @@ if($page == 'ipsandports'
$ssl_ca_file = makeCorrectFile($ssl_ca_file); $ssl_ca_file = makeCorrectFile($ssl_ca_file);
} }
if($ssl_cert_chainfile != '')
{
$ssl_cert_chainfile = makeCorrectFile($ssl_cert_chainfile);
}
if(strlen(trim($docroot)) > 0)
{
$docroot = makeCorrectDir($docroot);
}
else
{
$docroot = '';
}
if($result['ip'] != $ip if($result['ip'] != $ip
&& $result['ip'] == $settings['system']['ipaddress'] && $result['ip'] == $settings['system']['ipaddress']
&& $result_sameipotherport['id'] == '') && $result_sameipotherport['id'] == '')
@@ -388,52 +296,21 @@ if($page == 'ipsandports'
} }
else else
{ {
$db->query("UPDATE `" . TABLE_PANEL_IPSANDPORTS . "` SET `ip`='" . $db->escape($ip) . "', `port`='" . (int)$port . "', `listen_statement`='" . (int)$listen_statement . "', `namevirtualhost_statement`='" . (int)$namevirtualhost_statement . "', `vhostcontainer`='" . (int)$vhostcontainer . "', `vhostcontainer_servername_statement`='" . (int)$vhostcontainer_servername_statement . "', `specialsettings`='" . $db->escape($specialsettings) . "', `ssl`='" . (int)$ssl . "', `ssl_cert_file`='" . $db->escape($ssl_cert_file) . "', `ssl_key_file`='" . $db->escape($ssl_key_file) . "', `ssl_ca_file`='" . $db->escape($ssl_ca_file) . "', `default_vhostconf_domain`='" . $db->escape($default_vhostconf_domain) . "' WHERE `id`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_IPSANDPORTS . "`
SET
`ip` = '" . $db->escape($ip) . "',
`port` = '" . (int)$port . "',
`listen_statement` = '" . (int)$listen_statement . "',
`namevirtualhost_statement` = '" . (int)$namevirtualhost_statement . "',
`vhostcontainer` = '" . (int)$vhostcontainer . "',
`vhostcontainer_servername_statement` = '" . (int)$vhostcontainer_servername_statement . "',
`specialsettings` = '" . $db->escape($specialsettings) . "',
`ssl` = '" . (int)$ssl . "',
`ssl_cert_file` = '" . $db->escape($ssl_cert_file) . "',
`ssl_key_file` = '" . $db->escape($ssl_key_file) . "',
`ssl_ca_file` = '" . $db->escape($ssl_ca_file) . "',
`ssl_cert_chainfile` = '" . $db->escape($ssl_cert_chainfile) . "',
`default_vhostconf_domain` = '" . $db->escape($default_vhostconf_domain) . "',
`docroot` = '" . $db->escape($docroot) . "'
WHERE `id`='" . (int)$id . "'
");
$log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
$result = htmlentities_array($result);
/*
$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']); $enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
$result = htmlentities_array($result);
$listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']); $listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']);
$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']); $namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']);
$vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']); $vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']);
$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']); $vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']);
*/
$ipsandports_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_edit.php';
$ipsandports_edit_form = htmlform::genHTMLForm($ipsandports_edit_data);
$title = $ipsandports_edit_data['ipsandports_edit']['title'];
$image = $ipsandports_edit_data['ipsandports_edit']['image'];
eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";"); eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -22,17 +22,19 @@ define('AREA', 'admin');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if ($page == 'log' require ("./lib/init.php");
&& $userinfo['change_serversettings'] == '1'
) { if($page == 'log'
if ($action == '') { && $userinfo['change_serversettings'] == '1')
{
if($action == '')
{
$fields = array( $fields = array(
'action' => $lng['logger']['action'],
'date' => $lng['logger']['date'], 'date' => $lng['logger']['date'],
'type' => $lng['logger']['type'], 'type' => $lng['logger']['type'],
'user' => $lng['logger']['user'], 'user' => $lng['logger']['user']
'text' => $lng['logger']['action']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$paging->sortfield = 'date'; $paging->sortfield = 'date';
@@ -45,21 +47,24 @@ if ($page == 'log'
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s); $pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
$clog = array(); $clog = array();
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if (!isset($clog[$row['action']]) {
|| !is_array($clog[$row['action']]) if(!isset($clog[$row['action']])
) { || !is_array($clog[$row['action']]))
{
$clog[$row['action']] = array(); $clog[$row['action']] = array();
} }
$clog[$row['action']][$row['logid']] = $row; $clog[$row['action']][$row['logid']] = $row;
} }
if ($paging->sortfield == 'date' if($paging->sortfield == 'date'
&& $paging->sortorder == 'desc' && $paging->sortorder == 'desc')
) { {
krsort($clog); krsort($clog);
} else { }
else
{
ksort($clog); ksort($clog);
} }
@@ -67,15 +72,20 @@ if ($page == 'log'
$count = 0; $count = 0;
$log_count = 0; $log_count = 0;
$log = ''; $log = '';
foreach ($clog as $action => $logrows) { foreach($clog as $action => $logrows)
{
$_action = 0; $_action = 0;
foreach ($logrows as $row) { foreach($logrows as $row)
if ($paging->checkDisplay($i)) { {
if($paging->checkDisplay($i))
{
$row = htmlentities_array($row); $row = htmlentities_array($row);
$row['date'] = date("d.m.y H:i:s", $row['date']); $row['date'] = date("d.m.y H:i:s", $row['date']);
if ($_action != $action) { if($_action != $action)
switch ($action) { {
switch($action)
{
case USR_ACTION: case USR_ACTION:
$_action = $lng['admin']['customer']; $_action = $lng['admin']['customer'];
break; break;
@@ -97,14 +107,15 @@ if ($page == 'log'
} }
$row['action'] = $_action; $row['action'] = $_action;
eval("\$log.=\"" . getTemplate('logger/logger_action') . "\";"); eval("\$log.=\"" . getTemplate("logger/logger_action") . "\";");
} }
$log_count++; $log_count++;
$type = $row['type']; $type = $row['type'];
$_type = 'unknown'; $_type = 'unknown';
switch ($type) { switch($type)
{
case LOG_INFO: case LOG_INFO:
$_type = 'Information'; $_type = 'Information';
break; break;
@@ -126,28 +137,35 @@ if ($page == 'log'
} }
$row['type'] = $_type; $row['type'] = $_type;
eval("\$log.=\"" . getTemplate('logger/logger_log') . "\";"); eval("\$log.=\"" . getTemplate("logger/logger_log") . "\";");
$count++; $count++;
$_action = $action; $_action = $action;
} }
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate('logger/logger') . "\";"); eval("echo \"" . getTemplate("logger/logger") . "\";");
} elseif ($action == 'truncate') { }
if (isset($_POST['send']) elseif($action == 'truncate')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$yesterday = time() - (60 * 10); $yesterday = time() - (60 * 10);
/* (60*60*24); */ /* (60*60*24); */
$db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'");
$log->logAction(ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)'); $log->logAction(ADM_ACTION, LOG_WARNING, "truncated the system-log (mysql)");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
else
{
ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG); ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG);
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -22,60 +22,79 @@ define('AREA', 'admin');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if (isset($_POST['id'])) { require ("./lib/init.php");
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif (isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'message') { if($page == 'message')
if ($action == '') { {
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed panel_message'); if($action == '')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed panel_message");
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
if ($_POST['receipient'] == 0 if($_POST['receipient'] == 0
&& $userinfo['customers_see_all'] == '1' && $userinfo['customers_see_all'] == '1')
) { {
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to admins'); $log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to admins");
$result = $db->query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`"); $result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`");
} elseif ($_POST['receipient'] == 1) { }
if ($userinfo['customers_see_all'] == '1') { elseif($_POST['receipient'] == 1)
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers'); {
if($userinfo['customers_see_all'] == "1")
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to ALL customers");
$result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`"); $result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`");
} else { }
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to customers'); else
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to customers");
$result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'"); $result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'");
} }
} else { }
else
{
standard_error('noreceipientsgiven'); standard_error('noreceipientsgiven');
} }
$subject = $_POST['subject']; $subject = $_POST['subject'];
$message = wordwrap($_POST['message'], 70); $message = wordwrap($_POST['message'], 70);
if (!empty($message)) { if(!empty($message))
{
$mailcounter = 0; $mailcounter = 0;
$mail->Body = $message; $mail->Body = $message;
$mail->Subject = $subject; $mail->Subject = $subject;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
$mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']); {
$mail->AddAddress($row['email'], $row['firstname'] . ' ' . $row['name']);
$mail->From = $userinfo['email']; $mail->From = $userinfo['email'];
$mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name']; $mail->FromName = $userinfo['firstname'] . ' ' . $userinfo['name'];
if (!$mail->Send()) { if(!$mail->Send())
if ($mail->ErrorInfo != '') { {
if($mail->ErrorInfo != '')
{
$mailerr_msg = $mail->ErrorInfo; $mailerr_msg = $mail->ErrorInfo;
} else { }
$mailerr_msg = $row['email']; else
{
$mailerr_msg = $row["email"];
} }
$log->logAction(ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg); $log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error('errorsendingmail', $row['email']); standard_error('errorsendingmail', $row["email"]);
} }
$mailcounter++; $mailcounter++;
@@ -83,34 +102,47 @@ if ($page == 'message') {
} }
redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter)); redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter));
} else { }
else
{
standard_error('nomessagetosend'); standard_error('nomessagetosend');
} }
} }
} }
if ($action == 'showsuccess') { if($action == 'showsuccess')
{
$success = 1; $success = 1;
$sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0; $sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0;
if ($sentitems == 0) { if($sentitems == 0)
{
$successmessage = $lng['message']['noreceipients']; $successmessage = $lng['message']['noreceipients'];
} else { }
else
{
$successmessage = str_replace('%s', $sentitems, $lng['message']['success']); $successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
} }
} else {
$action = '';
}
else
{
$success = 0; $success = 0;
$sentitems = 0; $sentitems = 0;
$successmessage = ''; $successmessage = '';
$action = '';
} }
$action = '';
$receipients = ''; $receipients = '';
if ($userinfo['customers_see_all'] == '1') { if($userinfo['customers_see_all'] == "1")
{
$receipients.= makeoption($lng['panel']['reseller'], 0); $receipients.= makeoption($lng['panel']['reseller'], 0);
} }
$receipients .= makeoption($lng['panel']['customer'], 1); $receipients.= makeoption($lng['panel']['customer'], 1);
eval("echo \"" . getTemplate('message/message') . "\";"); eval("echo \"" . getTemplate("message/message") . "\";");
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -25,58 +25,49 @@ define('AREA', 'admin');
require ("./lib/init.php"); require ("./lib/init.php");
if (isset($_POST['id'])) { if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif (isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
if ($action == '') { if($action == '')
{
$tablecontent = ''; $tablecontent = '';
$count = 0;
$result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`"); $result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$domainresult = false; $domainresult = false;
$query = "SELECT * FROM `".TABLE_PANEL_DOMAINS."` if((int)$userinfo['domains_see_all'] == 0)
WHERE `phpsettingid` = '".(int)$row['id']."' {
AND `parentdomainid` = '0'"; $domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `adminid` = " . (int)$userinfo['userid'] . " AND `phpsettingid` = " . (int)$row['id']);
if ((int)$userinfo['domains_see_all'] == 0) {
$query .= " AND `adminid` = '".(int)$userinfo['userid']."'";
} }
else
if ((int)$settings['panel']['phpconfigs_hidestdsubdomain'] == 1) { {
$query2 = "SELECT DISTINCT `standardsubdomain` $domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `phpsettingid` = " . (int)$row['id']);
FROM `".TABLE_PANEL_CUSTOMERS."`
WHERE `standardsubdomain` > 0 ORDER BY `standardsubdomain` ASC;";
$ssdids_res = $db->query($query2);
$ssdids = array();
while ($ssd = $db->fetch_array($ssdids_res)) {
$ssdids[] = $ssd['standardsubdomain'];
}
if (count($ssdids) > 0) {
$query .= " AND `id` NOT IN (".implode(', ', $ssdids).")";
}
} }
$domainresult = $db->query($query);
$domains = ''; $domains = '';
if ($db->num_rows($domainresult) > 0) {
while ($row2 = $db->fetch_array($domainresult)) { if($db->num_rows($domainresult) > 0)
{
while($row2 = $db->fetch_array($domainresult))
{
$domains.= $row2['domain'] . '<br/>'; $domains.= $row2['domain'] . '<br/>';
} }
} else { }
else
{
$domains = $lng['admin']['phpsettings']['notused']; $domains = $lng['admin']['phpsettings']['notused'];
} }
$count ++;
eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";"); eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";");
} }
@@ -106,19 +97,12 @@ if ($page == 'overview') {
$db->query("INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` SET `description` = '" . $db->escape($description) . "', `binary` = '" . $db->escape($binary) . "', `file_extensions` = '" . $db->escape($file_extensions) . "', `mod_fcgid_starter` = '" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests` = '" . $db->escape($mod_fcgid_maxrequests) . "', `phpsettings` = '" . $db->escape($phpsettings) . "'"); $db->query("INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` SET `description` = '" . $db->escape($description) . "', `binary` = '" . $db->escape($binary) . "', `file_extensions` = '" . $db->escape($file_extensions) . "', `mod_fcgid_starter` = '" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests` = '" . $db->escape($mod_fcgid_maxrequests) . "', `phpsettings` = '" . $db->escape($phpsettings) . "'");
inserttask('1'); inserttask('1');
$log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting with description '" . $description . "' has been created by '" . $userinfo['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting with description '" . $value . "' has been created by '" . $userinfo['loginname'] . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
else else
{ {
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1");
$phpconfig_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_add.php';
$phpconfig_add_form = htmlform::genHTMLForm($phpconfig_add_data);
$title = $phpconfig_add_data['phpconfig_add']['title'];
$image = $phpconfig_add_data['phpconfig_add']['image'];
eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";"); eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";");
} }
} }
@@ -188,12 +172,6 @@ if ($page == 'overview') {
} }
else else
{ {
$phpconfig_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_edit.php';
$phpconfig_edit_form = htmlform::genHTMLForm($phpconfig_edit_data);
$title = $phpconfig_edit_data['phpconfig_edit']['title'];
$image = $phpconfig_edit_data['phpconfig_edit']['image'];
eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";"); eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -31,134 +31,22 @@ if(($page == 'settings' || $page == 'overview')
&& $userinfo['change_serversettings'] == '1') && $userinfo['change_serversettings'] == '1')
{ {
$settings_data = loadConfigArrayDir('./actions/admin/settings/'); $settings_data = loadConfigArrayDir('./actions/admin/settings/');
$settings = loadSettings($settings_data, $db); $settings = loadSettings(&$settings_data, &$db);
if(isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$_part = isset($_GET['part']) ? $_GET['part'] : ''; if(processForm(&$settings_data, &$_POST, array('filename' => $filename, 'action' => $action, 'page' => $page)))
if($_part == '')
{ {
$_part = isset($_POST['part']) ? $_POST['part'] : '';
}
if($_part != '')
{
if($_part == 'all')
{
$settings_all = true;
$settings_part = false;
}
else
{
$settings_all = false;
$settings_part = true;
}
$only_enabledisable = false;
}
else
{
$settings_all = false;
$settings_part = false;
$only_enabledisable = true;
}
// check if the session timeout is too low #815
if (isset($_POST['session_sessiontimeout']) && $_POST['session_sessiontimeout'] <= 60) {
standard_error($lng['error']['session_timeout'], $lng['error']['session_timeout_desc']);
}
if(processFormEx(
$settings_data,
$_POST,
array('filename' => $filename, 'action' => $action, 'page' => $page),
$_part,
$settings_all,
$settings_part,
$only_enabledisable
)
) {
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4');
standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page)); standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page));
} }
} }
else else
{ {
$_part = isset($_GET['part']) ? $_GET['part'] : ''; $fields = buildForm(&$settings_data);
eval("echo \"" . getTemplate("settings/settings") . "\";");
if($_part == '')
{
$_part = isset($_POST['part']) ? $_POST['part'] : '';
}
$fields = buildFormEx($settings_data, $_part);
$settings_page = '';
if($_part == '')
{
eval("\$settings_page .= \"" . getTemplate("settings/settings_overview") . "\";");
}
else
{
eval("\$settings_page .= \"" . getTemplate("settings/settings") . "\";");
}
eval("echo \"" . getTemplate("settings/settings_form_begin") . "\";");
eval("echo \$settings_page;");
eval("echo \"" . getTemplate("settings/settings_form_end") . "\";");
} }
} }
elseif($page == 'phpinfo'
&& $userinfo['change_serversettings'] == '1'
) {
ob_start();
phpinfo();
$phpinfo = array('phpinfo' => array());
if (preg_match_all(
'#(?:<h2>(?:<a name=".*?">)?(.*?)(?:</a>)?</h2>)|(?:<tr(?: class=".*?")?><t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>)?)?</tr>)#s',
ob_get_clean(), $matches, PREG_SET_ORDER
)
) {
foreach ($matches as $match) {
$end = array_keys($phpinfo);
$end = end($end);
if (strlen($match[1])) {
$phpinfo[$match[1]] = array();
} elseif (isset($match[3])) {
$phpinfo[$end][$match[2]] = isset($match[4]) ? array($match[3], $match[4]) : $match[3];
} else {
$phpinfo[$end][] = $match[2];
}
}
$phpinfohtml = '';
foreach ($phpinfo as $name => $section) {
$phpinfoentries = "";
foreach ($section as $key => $val) {
if (is_array($val)) {
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_3") . "\";");
} elseif (is_string($key)) {
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_2") . "\";");
} else {
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_1") . "\";");
}
}
// first header -> show actual php version
if (strtolower($name) == "phpinfo") {
$name = "PHP ".PHP_VERSION;
}
eval("\$phpinfohtml .= \"" . getTemplate("settings/phpinfo/phpinfo_table") . "\";");
}
$phpinfo = $phpinfohtml;
}
eval("echo \"" . getTemplate("settings/phpinfo") . "\";");
}
elseif($page == 'rebuildconfigs' elseif($page == 'rebuildconfigs'
&& $userinfo['change_serversettings'] == '1') && $userinfo['change_serversettings'] == '1')
{ {
@@ -167,11 +55,9 @@ elseif($page == 'rebuildconfigs'
{ {
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles"); $log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles");
inserttask('1'); inserttask('1');
inserttask('10');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
inserttask('5');
standard_success('rebuildingconfigs', '', array('filename' => 'admin_index.php')); redirectTo('admin_index.php', array('s' => $s));
} }
else else
{ {
@@ -271,3 +157,5 @@ elseif($page == 'enforcequotas'
ask_yesno('admin_quotas_reallyenforce', $filename, array('page' => $page)); ask_yesno('admin_quotas_reallyenforce', $filename, array('page' => $page));
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -48,28 +48,13 @@ elseif(isset($_GET['id']))
$available_templates = array( $available_templates = array(
'createcustomer', 'createcustomer',
'pop_success', 'pop_success',
'new_database_by_customer', 'trafficninetypercent',
'new_ftpaccount_by_customer', 'new_ticket_by_customer',
'password_reset' 'new_ticket_for_customer',
'new_ticket_by_staff',
'new_reply_ticket_by_customer',
'new_reply_ticket_by_staff'
); );
// only show templates of features that are enabled #1191
if ((int)$settings['system']['report_enable'] == 1) {
array_push($available_templates,
'trafficmaxpercent',
'diskmaxpercent'
);
}
if ((int)$settings['ticket']['enabled'] == 1) {
array_push($available_templates,
'new_ticket_by_customer',
'new_ticket_for_customer',
'new_ticket_by_staff',
'new_reply_ticket_by_customer',
'new_reply_ticket_by_staff'
);
}
$file_templates = array( $file_templates = array(
'index_html' 'index_html'
); );
@@ -163,7 +148,7 @@ elseif($action == 'delete'
} }
} }
} }
elseif($action == 'deletef' elseif($action == 'delete'
&& $id != 0) && $id != 0)
{ {
//file templates //file templates
@@ -220,12 +205,6 @@ elseif($action == 'add')
$template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true); $template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true);
} }
$template_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_add.php';
$template_add_form = htmlform::genHTMLForm($template_add_data);
$title = $template_add_data['template_add']['title'];
$image = $template_add_data['template_add']['image'];
eval("echo \"" . getTemplate("templates/templates_add_2") . "\";"); eval("echo \"" . getTemplate("templates/templates_add_2") . "\";");
} }
elseif(isset($_POST['send']) elseif(isset($_POST['send'])
@@ -329,12 +308,6 @@ elseif($action == 'add')
$free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true); $free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true);
} }
$filetemplate_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_add.php';
$filetemplate_add_form = htmlform::genHTMLForm($filetemplate_add_data);
$title = $filetemplate_add_data['filetemplate_add']['title'];
$image = $filetemplate_add_data['filetemplate_add']['image'];
eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";"); eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";");
} }
} }
@@ -367,18 +340,11 @@ elseif($action == 'edit'
$result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'"); $result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'");
$result = htmlentities_array($result); $result = htmlentities_array($result);
$mailbody = $result['value']; $mailbody = $result['value'];
$template_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_edit.php';
$template_edit_form = htmlform::genHTMLForm($template_edit_data);
$title = $template_edit_data['template_edit']['title'];
$image = $template_edit_data['template_edit']['image'];
eval("echo \"" . getTemplate("templates/templates_edit") . "\";"); eval("echo \"" . getTemplate("templates/templates_edit") . "\";");
} }
} }
} }
elseif($action == 'editf' elseif($action == 'edit'
&& $id != 0) && $id != 0)
{ {
//file templates //file templates
@@ -402,13 +368,6 @@ elseif($action == 'editf'
else else
{ {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$filetemplate_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_edit.php';
$filetemplate_edit_form = htmlform::genHTMLForm($filetemplate_edit_data);
$title = $filetemplate_edit_data['filetemplate_edit']['title'];
$image = $filetemplate_edit_data['filetemplate_edit']['image'];
eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";"); eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";");
} }
} }
@@ -418,3 +377,5 @@ elseif($action == 'editf'
exit; exit;
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -32,22 +32,6 @@ if(isset($_POST['id']))
elseif(isset($_GET['id'])) elseif(isset($_GET['id']))
{ {
$id = intval($_GET['id']); $id = intval($_GET['id']);
// only check if this is not a category-id
if (!isset($_GET['page']) || (isset($_GET['page']) && $_GET['page'] != 'categories')) {
if (!$userinfo['customers_see_all']) {
/*
* Check if the current user is allowed to see the current ticket.
*/
$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `adminid` = '".$userinfo['admindid']."'";
$result = $db->query_first($sql);
if ($result == null) {
// no rights to see the requested ticket
standard_error(array('ticketnotaccessible'));
}
}
}
} }
if($page == 'tickets' if($page == 'tickets'
@@ -72,7 +56,7 @@ if($page == 'tickets'
$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$paging->sortfield = 'lastchange'; $paging->sortfield = 'lastchange';
$paging->sortorder = 'desc'; $paging->sortorder = 'desc';
$result = $db->query('SELECT `main`.`id`, `main`.`customerid`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" ' . ($userinfo['customers_see_all'] ? '' : ' AND `adminid` = "' . (int)$userinfo['adminid'] . '"') . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query('SELECT `main`.`id`, `main`.`customerid`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `adminid` = "' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -118,20 +102,15 @@ if($page == 'tickets'
if($_cid != $row['customerid']) if($_cid != $row['customerid'])
{ {
$cid = $row['customerid']; $cid = $row['customerid'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '` $usr = $db->query_first('SELECT `firstname`, `name`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'); WHERE `customerid` = "' . (int)$cid . '"');
if(isset($usr['loginname'])) if(isset($usr['loginname'])) {
{ $customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
$customer = getCorrectFullUserDetails($usr); } else {
$customerloginname = $usr['loginname'];
$customerid = $usr['customerid'];
}
else
{
$customer = $lng['ticket']['nonexistingcustomer']; $customer = $lng['ticket']['nonexistingcustomer'];
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
} }
$tickets_count++; $tickets_count++;
@@ -160,13 +139,12 @@ if($page == 'tickets'
$cananswer = 1; $cananswer = 1;
} }
$row['subject'] = html_entity_decode($row['subject']);
if(strlen($row['subject']) > 20) if(strlen($row['subject']) > 20)
{ {
$row['subject'] = substr($row['subject'], 0, 17) . '...'; $row['subject'] = substr($row['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
$count++; $count++;
$_cid = $row['customerid']; $_cid = $row['customerid'];
} }
@@ -175,7 +153,7 @@ if($page == 'tickets'
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/tickets") . "\";"); eval("echo \"" . getTemplate("ticket/tickets") . "\";");
} }
elseif($action == 'new') elseif($action == 'new')
{ {
@@ -189,8 +167,8 @@ if($page == 'tickets'
$newticket->Set('subject', validate($_POST['subject'], 'subject'), true, false); $newticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
$newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false); $newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
$newticket->Set('category', validate($_POST['category'], 'category'), true, false); $newticket->Set('category', validate($_POST['category'], 'category'), true, false);
$newticket->Set('customer', (int)$_POST['customer'], true, false); $newticket->Set('customer', validate($_POST['customer'], 'customer'), true, false);
$newticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false); $newticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
if($newticket->Get('subject') == null) if($newticket->Get('subject') == null)
{ {
@@ -219,16 +197,12 @@ if($page == 'tickets'
else else
{ {
$categories = ''; $categories = '';
$where = ''; $result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `name` ASC');
if ($userinfo['tickets_see_all'] != '1') {
$where = 'WHERE `adminid` = "' . $userinfo['adminid'] . '"';
}
$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');
if(isset($result['name']) if(isset($result['name'])
&& $result['name'] != '') && $result['name'] != '')
{ {
$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC'); $result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `name` ASC');
while($row = $db->fetch_array($result2)) while($row = $db->fetch_array($result2))
{ {
@@ -245,20 +219,28 @@ if($page == 'tickets'
while($row_customer = $db->fetch_array($result_customers)) while($row_customer = $db->fetch_array($result_customers))
{ {
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']); if($row_customer['company'] == '')
{
$customers.= makeoption($row_customer['name'] . ', ' . $row_customer['firstname'] . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
}
else
{
if($row_customer['name'] != ''
&& $row_customer['firstname'] != '')
{
$customers.= makeoption($row_customer['name'] . ', ' . $row_customer['firstname'] . ' | ' . $row_customer['company'] . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
}
else
{
$customers.= makeoption($row_customer['company'] . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
}
}
} }
$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']); $priorities = makeoption($lng['ticket']['unf_high'], '1');
$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_normal'], '2');
$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_low'], '3');
eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
$ticket_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_new.php';
$ticket_new_form = htmlform::genHTMLForm($ticket_new_data);
$title = $ticket_new_data['ticket_new']['title'];
$image = $ticket_new_data['ticket_new']['image'];
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
} }
} }
else else
@@ -275,7 +257,7 @@ if($page == 'tickets'
$replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1); $replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1);
$replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false); $replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
$replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false); $replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
$replyticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false); $replyticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
if($replyticket->Get('message') == null) if($replyticket->Get('message') == null)
{ {
@@ -326,25 +308,18 @@ if($page == 'tickets'
$isclosed = 1; $isclosed = 1;
} }
if ($mainticket->Get('by') == '1') if($mainticket->Get('by') == '1')
{ {
$by = $lng['ticket']['staff']; $by = $lng['ticket']['staff'];
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -361,19 +336,12 @@ if($page == 'tickets'
} }
else else
{ {
$cid = $subticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -383,13 +351,8 @@ if($page == 'tickets'
$ticket_replies_count = $db->num_rows($andere) + 1; $ticket_replies_count = $db->num_rows($andere) + 1;
// don't forget the main-ticket! // don't forget the main-ticket!
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_reply.php';
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
$title = $ticket_reply_data['ticket_reply']['title']; eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
$image = $ticket_reply_data['ticket_reply']['image'];
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
} }
} }
elseif($action == 'close' elseif($action == 'close'
@@ -472,19 +435,13 @@ elseif($page == 'categories'
{ {
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_tickets::categories"); $log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_tickets::categories");
$fields = array( $fields = array(
'name' => $lng['ticket']['category'], 'name' => $lng['ticket']['category']
'logicalorder' => $lng['ticket']['logicalorder']
); );
$where = '1'; // WHERE 1 is like no 'where-clause'
if ($userinfo['tickets_see_all'] != '1') {
$where = " `main`.`adminid` = '" . (int)$userinfo['adminid'] . "'";
}
$paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, ( $result = $db->query("SELECT `main`.`id`, `main`.`name`, (
SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub` SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub`
WHERE `sub`.`category` = `main`.`id` WHERE `sub`.`category` = `main`.`id`
AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "') AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
as `ticketcount`, ( as `ticketcount`, (
SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2` SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2`
WHERE `sub2`.`category` = `main`.`id` WHERE `sub2`.`category` = `main`.`id`
@@ -492,7 +449,7 @@ elseif($page == 'categories'
AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2') AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2')
AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "' AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "'
) as `ticketcountnotclosed` ) as `ticketcountnotclosed`
FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE " . $where . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE `main`.`adminid` = '" . (int)$userinfo['adminid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -509,14 +466,14 @@ elseif($page == 'categories'
{ {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']); $closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']);
eval("\$ticketcategories.=\"" . getTemplate("tickets/tickets_categories") . "\";"); eval("\$ticketcategories.=\"" . getTemplate("ticket/tickets_categories") . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/categories") . "\";"); eval("echo \"" . getTemplate("ticket/categories") . "\";");
} }
elseif($action == 'addcategory') elseif($action == 'addcategory')
{ {
@@ -524,13 +481,6 @@ elseif($page == 'categories'
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$category = validate($_POST['category'], 'category'); $category = validate($_POST['category'], 'category');
$order = validate($_POST['logicalorder'], 'logicalorder');
if($order < 1 || $order >= 1000)
{
// use the latest available
$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1;
}
if($category == '') if($category == '')
{ {
@@ -538,22 +488,14 @@ elseif($page == 'categories'
} }
else else
{ {
ticket::addCategory($db, $category, $userinfo['adminid'], $order); ticket::addCategory($db, $category, $userinfo['adminid']);
$log->logAction(ADM_ACTION, LOG_INFO, "added ticket-category '" . $category . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added ticket-category '" . $category . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1; eval("echo \"" . getTemplate("ticket/tickets_newcategory") . "\";");
$category_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_new.php';
$category_new_form = htmlform::genHTMLForm($category_new_data);
$title = $category_new_data['category_new']['title'];
$image = $category_new_data['category_new']['image'];
eval("echo \"" . getTemplate("tickets/tickets_newcategory") . "\";");
} }
} }
elseif($action == 'editcategory' elseif($action == 'editcategory'
@@ -563,12 +505,6 @@ elseif($page == 'categories'
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$category = validate($_POST['category'], 'category'); $category = validate($_POST['category'], 'category');
$order = validate($_POST['logicalorder'], 'logicalorder');
if($order < 1 || $order >= 1000)
{
$order = 1;
}
if($category == '') if($category == '')
{ {
@@ -576,7 +512,7 @@ elseif($page == 'categories'
} }
else else
{ {
ticket::editCategory($db, $category, $id, $order); ticket::editCategory($db, $category, $id);
$log->logAction(ADM_ACTION, LOG_INFO, "edited ticket-category '" . $category . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "edited ticket-category '" . $category . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
@@ -584,14 +520,7 @@ elseif($page == 'categories'
else else
{ {
$row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"'); $row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"');
eval("echo \"" . getTemplate("ticket/tickets_editcategory") . "\";");
$category_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_edit.php';
$category_edit_form = htmlform::genHTMLForm($category_edit_data);
$title = $category_edit_data['category_edit']['title'];
$image = $category_edit_data['category_edit']['image'];
eval("echo \"" . getTemplate("tickets/tickets_editcategory") . "\";");
} }
} }
elseif($action == 'deletecategory' elseif($action == 'deletecategory'
@@ -640,7 +569,8 @@ elseif($page == 'archive'
{ {
$categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : ''; $categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : '';
} }
$query = ticket::getArchiveSearchStatement($db, $subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
$query = ticket::getArchiveSearchStatement($subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
$fields = array( $fields = array(
'lastchange' => $lng['ticket']['lastchange'], 'lastchange' => $lng['ticket']['lastchange'],
'ticket_answers' => $lng['ticket']['ticket_answers'], 'ticket_answers' => $lng['ticket']['ticket_answers'],
@@ -698,39 +628,24 @@ elseif($page == 'archive'
{ {
if($paging->checkDisplay($i)) if($paging->checkDisplay($i))
{ {
$ticket = htmlentities_array($ticket);
$ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']); $ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']);
if($_cid != $ticket['customerid']) if($_cid != $ticket['customerid'])
{ {
$cid = $ticket['customerid']; $cid = $ticket['customerid'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '` $usr = $db->query_first('SELECT `firstname`, `name`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'); WHERE `customerid` = "' . (int)$cid . '"');
if(isset($usr['loginname'])) if(isset($usr['loginname'])) {
{ $customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
$customer = getCorrectFullUserDetails($usr); } else {
$customerloginname = $usr['loginname'];
$customerid = $usr['customerid'];
}
else
{
$customer = $lng['ticket']['nonexistingcustomer']; $customer = $lng['ticket']['nonexistingcustomer'];
} }
eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
} }
$tickets_count++; $tickets_count++;
switch ($ticket['priority'])
{
case 1: $ticket['display'] = 'high';
break;
case 2: $ticket['display'] = 'normal';
break;
case 3: $ticket['display'] = 'low';
break;
default: $ticket['display'] = 'unknown';
}
$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']); $ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);
if($ticket['lastreplier'] == '1') if($ticket['lastreplier'] == '1')
@@ -746,8 +661,8 @@ elseif($page == 'archive'
{ {
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...'; $ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
} }
$ticket = htmlentities_array($ticket);
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
$count++; $count++;
$_cid = $ticket['customerid']; $_cid = $ticket['customerid'];
} }
@@ -756,7 +671,7 @@ elseif($page == 'archive'
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/archivesearch") . "\";"); eval("echo \"" . getTemplate("ticket/archivesearch") . "\";");
} }
else else
{ {
@@ -785,13 +700,13 @@ elseif($page == 'archive'
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...'; $ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
} }
} }
$priorities_options = makecheckbox('priority1', $lng['ticket']['high'], '1'); $priorities_options = makecheckbox('priority1', $lng['ticket']['unf_high'], '1');
$priorities_options.= makecheckbox('priority2', $lng['ticket']['normal'], '2'); $priorities_options.= makecheckbox('priority2', $lng['ticket']['unf_normal'], '2');
$priorities_options.= makecheckbox('priority3', $lng['ticket']['low'], '3'); $priorities_options.= makecheckbox('priority3', $lng['ticket']['unf_low'], '3');
$category_options = ''; $category_options = '';
$ccount = 0; $ccount = 0;
$result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC'); $result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
@@ -803,14 +718,21 @@ elseif($page == 'archive'
} }
$customers = makeoption($lng['ticket']['nocustomer'], '-1', '-1'); $customers = makeoption($lng['ticket']['nocustomer'], '-1', '-1');
$result_customers = $db->query("SELECT `customerid`, `loginname`, `name`, `firstname`, `company` FROM `" . TABLE_PANEL_CUSTOMERS . "` " . ($userinfo['customers_see_all'] ? '' : " WHERE `adminid` = '" . (int)$userinfo['adminid'] . "' ") . " ORDER BY `name` ASC"); $result = $db->query_first('SELECT `customerid` FROM `' . TABLE_PANEL_CUSTOMERS . '` ' . ($userinfo['customers_see_all'] ? '' : ' WHERE `adminid` = "' . (int)$userinfo['adminid'] . '" ') . 'ORDER BY `name` ASC');
while($row_customer = $db->fetch_array($result_customers)) if(isset($result['customerid'])
&& $result['customerid'] != '')
{ {
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']); $result2 = $db->query('SELECT `customerid`, `loginname`, `firstname`, `name`
FROM `' . TABLE_PANEL_CUSTOMERS . '` ' . ($userinfo['customers_see_all'] ? '' : ' WHERE `adminid` = "' . (int)$userinfo['adminid'] . '" ') . ' ORDER BY `name` ASC');
while($row = $db->fetch_array($result2))
{
$customers.= makeoption($row['name'] . ', ' . $row['firstname'] . ' (' . $row['loginname'] . ')', $row['customerid']);
}
} }
eval("echo \"" . getTemplate("tickets/archive") . "\";"); eval("echo \"" . getTemplate("ticket/archive") . "\";");
} }
} }
elseif($action == 'view' elseif($action == 'view'
@@ -820,7 +742,6 @@ elseif($page == 'archive'
$ticket_replies = ''; $ticket_replies = '';
$mainticket = ticket::getInstanceOf($userinfo, $db, $settings, (int)$id); $mainticket = ticket::getInstanceOf($userinfo, $db, $settings, (int)$id);
$lastchange = date("d.m.Y H:i\h", $mainticket->Get('lastchange')); $lastchange = date("d.m.Y H:i\h", $mainticket->Get('lastchange'));
$dt = date("d.m.Y H:i\h", $mainticket->Get('dt'));
$status = ticket::getStatusText($lng, $mainticket->Get('status')); $status = ticket::getStatusText($lng, $mainticket->Get('status'));
$isclosed = 1; $isclosed = 1;
@@ -830,19 +751,12 @@ elseif($page == 'archive'
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -859,29 +773,23 @@ elseif($page == 'archive'
} }
else else
{ {
$cid = $subticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', htmlentities($mainticket->Get('priority')), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
$priorities.= makeoption($lng['ticket']['normal'], '2', htmlentities($mainticket->Get('priority')), true, true); $priorities.= makeoption($lng['ticket']['normal'], '2', $mainticket->Get('priority'), true, true);
$priorities.= makeoption($lng['ticket']['low'], '3', htmlentities($mainticket->Get('priority')), true, true); $priorities.= makeoption($lng['ticket']['low'], '3', $mainticket->Get('priority'), true, true);
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$ticket_replies_count = $db->num_rows($andere) + 1; $ticket_replies_count = $db->num_rows($andere) + 1;
// don't forget the main-ticket! // don't forget the main-ticket!
eval("echo \"" . getTemplate("tickets/tickets_view") . "\";");
eval("echo \"" . getTemplate("ticket/tickets_view") . "\";");
} }
elseif($action == 'delete' elseif($action == 'delete'
&& $id != 0) && $id != 0)
@@ -900,6 +808,6 @@ elseif($page == 'archive'
ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject')); ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
} }
} }
} else {
standard_error('nocustomerforticket');
} }
?>

View File

@@ -1,148 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Morton Jonuschat <m.jonuschat@chrome-it.de>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package Panel
*
*/
define('AREA', 'admin');
/**
* Include our init.php, which manages Sessions, Language etc.
*/
require ("./lib/init.php");
if($action == 'logout')
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['adminid'] . "' AND `adminsession` = '1'");
redirectTo('index.php');
exit;
}
if(isset($_POST['id']))
{
$id = intval($_POST['id']);
}
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']);
}
$months = array(
'0' => 'empty',
'1' => 'jan',
'2' => 'feb',
'3' => 'mar',
'4' => 'apr',
'5' => 'may',
'6' => 'jun',
'7' => 'jul',
'8' => 'aug',
'9' => 'sep',
'10' => 'oct',
'11' => 'nov',
'12' => 'dec',
);
if($page == 'overview' || $page == 'customers')
{
if($action == 'su' && $id != 0)
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$id . "' " . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' "));
if($result['loginname'] != '')
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "'");
$s = md5(uniqid(microtime(), 1));
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
redirectTo('customer_traffic.php', Array(
's' => $s
));
}
else
{
redirectTo('index.php', Array(
'action' => 'login'
));
}
}
$customerview = 1;
$stats_tables = '';
$minyear = $db->query_first("SELECT `year` FROM `". TABLE_PANEL_TRAFFIC . "` ORDER BY `year` ASC LIMIT 1");
if (!isset($minyear['year']) || $minyear['year'] == 0)
{
$maxyears = 0;
}
else
{
$maxyears = date("Y") - $minyear['year'];
}
for($years = 0; $years<=$maxyears; $years++) {
$overview['year'] = date("Y")-$years;
$overview['type'] = $lng['traffic']['customer'];
$domain_list = '';
$customer_name_list = $db->query("SELECT `customerid`,`company`,`name`,`firstname` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' ") . " ORDER BY name");
$totals = array(
'jan' => 0,
'feb' => 0,
'mar' => 0,
'apr' => 0,
'may' => 0,
'jun' => 0,
'jul' => 0,
'aug' => 0,
'sep' => 0,
'oct' => 0,
'nov' => 0,
'dec' => 0,
);
while($customer_name = $db->fetch_array($customer_name_list)) {
$virtual_host = array(
'name' => ($customer_name['company'] == '' ? $customer_name['name'] . ", " . $customer_name['firstname'] : $customer_name['company']),
'customerid' => $customer_name['customerid'],
'jan' => '-',
'feb' => '-',
'mar' => '-',
'apr' => '-',
'may' => '-',
'jun' => '-',
'jul' => '-',
'aug' => '-',
'sep' => '-',
'oct' => '-',
'nov' => '-',
'dec' => '-',
);
$traffic_list = $db->query("SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE year = " . (date("Y")-$years) . " AND `customerid` = '" . $customer_name['customerid'] . "' GROUP BY month ORDER BY month");
while($traffic_month = $db->fetch_array($traffic_list)) {
$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s');
$totals[$months[(int)$traffic_month['month']]] += $traffic_month['traffic'];
}
eval("\$domain_list .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
}
// sum up totals
$virtual_host = array(
'name' => $lng['traffic']['months']['total'],
);
foreach($totals as $month => $bytes) {
$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s'));
}
$customerview = 0;
eval("\$total_list = sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
eval("\$stats_tables .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table") . "\");");
}
eval("echo \"" . getTemplate("traffic/index") . "\";");
}

View File

@@ -12,100 +12,56 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
require('./lib/init.php'); require ("./lib/init.php");
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates"); $log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates");
/** if(hasUpdates($version))
* this is a dirty hack but syscp 1.4.2.1 does not {
* has any version/dbversion in the database (don't know why) if(isset($_POST['send'])
* so we have to set them both to run a correct upgrade && $_POST['send'] == 'send')
*/ {
if (!isFroxlor()) {
if (!isset($settings['panel']['version']) eval("echo \"" . getTemplate("update/update_start") . "\";");
|| $settings['panel']['version'] == ''
) { include_once('./install/updatesql.php');
$settings['panel']['version'] = '1.4.2.1';
$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')"); $redirect_url = 'admin_index.php';
eval("echo \"" . getTemplate("update/update_end") . "\";");
updateCounters();
inserttask('1');
@chmod('./lib/userdata.inc.php', 0440);
} }
if (!isset($settings['system']['dbversion']) else
|| $settings['system']['dbversion'] == '' {
) {
/**
* for syscp-stable (1.4.2.1) this value has to be 0
* so the required table-fields are added correctly
* and the svn-version has its value in the database
* -> bug #54
*/
$result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'");
if (isset($result['value'])) {
$settings['system']['dbversion'] = (int)$result['value'];
} else {
$settings['system']['dbversion'] = 0;
}
}
}
if (hasUpdates($version)) {
$successful_update = false;
$message = '';
if (isset($_POST['send'])
&& $_POST['send'] == 'send'
) {
if ((isset($_POST['update_preconfig'])
&& isset($_POST['update_changesagreed'])
&& intval($_POST['update_changesagreed']) != 0)
|| !isset($_POST['update_preconfig'])
) {
eval("echo \"" . getTemplate('update/update_start') . "\";");
include_once './install/updatesql.php';
$redirect_url = 'admin_index.php?s=' . $s;
eval("echo \"" . getTemplate('update/update_end') . "\";");
updateCounters();
inserttask('1');
@chmod('./lib/userdata.inc.php', 0440);
$successful_update = true;
} else {
$message = '<br /><strong style="color: red">You have to agree that you have read the update notifications.</strong>';
}
}
if (!$successful_update) {
$current_version = $settings['panel']['version']; $current_version = $settings['panel']['version'];
$new_version = $version; $new_version = $version;
$ui_text = $lng['update']['update_information']['part_a']; $ui_text = $lng['update']['update_information'];
$ui_text = str_replace('%curversion', $current_version, $ui_text); $ui_text = str_replace('%curversion', $current_version, $ui_text);
$ui_text = str_replace('%newversion', $new_version, $ui_text); $ui_text = str_replace('%newversion', $new_version, $ui_text);
$update_information = $ui_text; $update_information = $ui_text;
include_once './install/updates/preconfig.php'; eval("echo \"" . getTemplate("update/index") . "\";");
$preconfig = getPreConfig($current_version);
if ($preconfig != '') {
$update_information .= '<br />' . $preconfig . $message;
}
$update_information .= $lng['update']['update_information']['part_b'];
eval("echo \"" . getTemplate('update/index') . "\";");
} }
} else { }
else
{
/* /*
* @TODO version-webcheck check here * @TODO version-webcheck check here
*/ */
$success_message = $lng['update']['noupdatesavail']; $success_message = $lng['update']['noupdatesavail'];
$redirect_url = 'admin_index.php?s=' . $s; $redirect_url = 'admin_index.php';
eval("echo \"" . getTemplate('update/noupdatesavail') . "\";"); eval("echo \"" . getTemplate("update/noupdatesavail") . "\";");
} }
} }
?>

1
cache/.gitignore vendored
View File

@@ -1 +0,0 @@
*

0
cache/.keep vendored
View File

File diff suppressed because one or more lines are too long

View File

@@ -1 +0,0 @@
.jqplot-target{position:relative;color:#666;font-family:"Trebuchet MS",Arial,Helvetica,sans-serif;font-size:1em}.jqplot-axis{font-size:.75em}.jqplot-xaxis{margin-top:10px}.jqplot-x2axis{margin-bottom:10px}.jqplot-yaxis{margin-right:10px}.jqplot-y2axis,.jqplot-y3axis,.jqplot-y4axis,.jqplot-y5axis,.jqplot-y6axis,.jqplot-y7axis,.jqplot-y8axis,.jqplot-y9axis,.jqplot-yMidAxis{margin-left:10px;margin-right:10px}.jqplot-axis-tick,.jqplot-xaxis-tick,.jqplot-yaxis-tick,.jqplot-x2axis-tick,.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick,.jqplot-yMidAxis-tick{position:absolute;white-space:pre}.jqplot-xaxis-tick{top:0;left:15px;vertical-align:top}.jqplot-x2axis-tick{bottom:0;left:15px;vertical-align:bottom}.jqplot-yaxis-tick{right:0;top:15px;text-align:right}.jqplot-yaxis-tick.jqplot-breakTick{right:-20px;margin-right:0;padding:1px 5px 1px 5px;z-index:2;font-size:1.5em}.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{left:0;top:15px;text-align:left}.jqplot-yMidAxis-tick{text-align:center;white-space:nowrap}.jqplot-xaxis-label{margin-top:10px;font-size:11pt;position:absolute}.jqplot-x2axis-label{margin-bottom:10px;font-size:11pt;position:absolute}.jqplot-yaxis-label{margin-right:10px;font-size:11pt;position:absolute}.jqplot-yMidAxis-label{font-size:11pt;position:absolute}.jqplot-y2axis-label,.jqplot-y3axis-label,.jqplot-y4axis-label,.jqplot-y5axis-label,.jqplot-y6axis-label,.jqplot-y7axis-label,.jqplot-y8axis-label,.jqplot-y9axis-label{font-size:11pt;margin-left:10px;position:absolute}.jqplot-meterGauge-tick{font-size:.75em;color:#999}.jqplot-meterGauge-label{font-size:1em;color:#999}table.jqplot-table-legend{margin-top:12px;margin-bottom:12px;margin-left:12px;margin-right:12px}table.jqplot-table-legend,table.jqplot-cursor-legend{background-color:rgba(255,255,255,0.6);border:1px solid #ccc;position:absolute;font-size:.75em}td.jqplot-table-legend{vertical-align:middle}td.jqplot-seriesToggle:hover,td.jqplot-seriesToggle:active{cursor:pointer}.jqplot-table-legend .jqplot-series-hidden{text-decoration:line-through}div.jqplot-table-legend-swatch-outline{border:1px solid #ccc;padding:1px}div.jqplot-table-legend-swatch{width:0;height:0;border-top-width:5px;border-bottom-width:5px;border-left-width:6px;border-right-width:6px;border-top-style:solid;border-bottom-style:solid;border-left-style:solid;border-right-style:solid}.jqplot-title{top:0;left:0;padding-bottom:.5em;font-size:1.2em}table.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em}.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-highlighter-tooltip,.jqplot-canvasOverlay-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-point-label{font-size:.75em;z-index:2}td.jqplot-cursor-legend-swatch{vertical-align:middle;text-align:center}div.jqplot-cursor-legend-swatch{width:1.2em;height:.7em}.jqplot-error{text-align:center}.jqplot-error-message{position:relative;top:46%;display:inline-block}div.jqplot-bubble-label{font-size:.8em;padding-left:2px;padding-right:2px;color:rgb(20%,20%,20%)}div.jqplot-bubble-label.jqplot-bubble-label-highlight{background:rgba(90%,90%,90%,0.7)}div.jqplot-noData-container{text-align:center;background-color:rgba(96%,96%,96%,0.3)}

View File

@@ -14,21 +14,22 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
// Required code
define('AREA', 'customer'); define('AREA', 'customer');
require ('./lib/init.php'); require ("./lib/init.php");
require ("./lib/class_apsparser.php");
$Id = 0; $Id = 0;
if (isset($_GET['id'])) {
$Id = (int)$_GET['id'];
}
if (isset($_POST['id'])) {
$Id = (int)$_POST['id'];
}
eval("echo \"" . getTemplate('aps/header') . "\";"); if(isset($_GET['id']))$Id = (int)$_GET['id'];
if(isset($_POST['id']))$Id = (int)$_POST['id'];
eval("echo \"" . getTemplate("aps/header") . "\";");
$Aps = new ApsParser($userinfo, $settings, $db); $Aps = new ApsParser($userinfo, $settings, $db);
$Aps->MainHandler($action); $Aps->MainHandler($action);
eval("echo \"" . getTemplate('aps/footer') . "\";"); eval("echo \"" . getTemplate("aps/footer") . "\";");
?>

View File

@@ -14,17 +14,21 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); // Required code
require('./lib/init.php');
if ($action == 'add') { define('AREA', 'customer');
// Create new autoresponder require ("./lib/init.php");
if (isset($_POST['send'])
&& $_POST['send'] == 'send' // Create new autoresponder
) {
if($action == "add")
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$account = trim($_POST['account']); $account = trim($_POST['account']);
$subject = trim($_POST['subject']); $subject = trim($_POST['subject']);
$message = trim($_POST['message']); $message = trim($_POST['message']);
@@ -38,31 +42,39 @@ if ($action == 'add') {
$ts_from = -1; $ts_from = -1;
$ts_until = -1; $ts_until = -1;
if ($date_from_off > -1) { if($date_from_off > -1)
{
$date_from = $_POST['date_from']; $date_from = $_POST['date_from'];
$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4)); $ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
} }
if ($date_until_off > -1) { if($date_until_off > -1)
{
$date_until = $_POST['date_until']; $date_until = $_POST['date_until'];
$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4)); $ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
} }
if (empty($account) if(empty($account)
|| empty($subject) || empty($subject)
|| empty($message) || empty($message))
) { {
standard_error('missingfields'); standard_error('missingfields');
} }
// Does account exist? // Does account exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('accountnotexisting'); standard_error('accountnotexisting');
} }
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 1) {
if($db->num_rows($result) == 1)
{
standard_error('autoresponderalreadyexists'); standard_error('autoresponderalreadyexists');
} }
@@ -75,38 +87,40 @@ if ($action == 'add') {
`subject` = '" . $db->escape($subject) . "', `subject` = '" . $db->escape($subject) . "',
`customerid` = '" . $db->escape((int)$userinfo['customerid']) . "' `customerid` = '" . $db->escape((int)$userinfo['customerid']) . "'
"); ");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_autoresponder_used` = `email_autoresponder_used` + 1 WHERE `customerid` = '" . $db->escape((int)$userinfo['customerid']). "'");
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} }
// Get accounts // Get accounts
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('noemailaccount'); standard_error('noemailaccount');
} }
$accounts = ''; $accounts = '';
while ($row = $db->fetch_array($result)) {
$accounts .= '<option value="' . $row['email'] . '">' . $row['email'] . '</option>'; while($row = $db->fetch_array($result))
{
$accounts.= "<option value=\"" . $row['email'] . "\">" . $row['email'] . "</option>";
} }
$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true); $date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true); $date_until_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
//$isactive = makeyesno('active', '1', '0', '1'); eval("echo \"" . getTemplate("email/autoresponder_add") . "\";");
}
$autoresponder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_add.php'; // Edit autoresponder
$autoresponder_add_form = htmlform::genHTMLForm($autoresponder_add_data);
$title = $autoresponder_add_data['autoresponder_add']['title']; else
$image = $autoresponder_add_data['autoresponder_add']['image'];
eval("echo \"" . getTemplate('autoresponder/autoresponder_add') . "\";"); if($action == "edit")
} elseif ($action == 'edit') { {
// Edit autoresponder if(isset($_POST['send'])
if (isset($_POST['send']) && $_POST['send'] == 'send')
&& $_POST['send'] == 'send' {
) {
$account = trim($_POST['account']); $account = trim($_POST['account']);
$subject = trim($_POST['subject']); $subject = trim($_POST['subject']);
$message = trim($_POST['message']); $message = trim($_POST['message']);
@@ -120,36 +134,49 @@ if ($action == 'add') {
$ts_from = -1; $ts_from = -1;
$ts_until = -1; $ts_until = -1;
if ($date_from_off > -1) { if($date_from_off > -1)
{
$date_from = $_POST['date_from']; $date_from = $_POST['date_from'];
$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4)); $ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
} }
if ($date_until_off > -1) { if($date_until_off > -1)
{
$date_until = $_POST['date_until']; $date_until = $_POST['date_until'];
$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4)); $ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
} }
if (empty($account) if(empty($account)
|| empty($subject) || empty($subject)
|| empty($message) || empty($message))
) { {
standard_error('missingfields'); standard_error('missingfields');
} }
// Does account exist? // Does account exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0)
if($db->num_rows($result) == 0)
{ {
standard_error('accountnotexisting'); standard_error('accountnotexisting');
} }
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
$ResponderActive = (isset($_POST['active']) && $_POST['active'] == '1') ? 1 : 0; $ResponderActive = 0;
if(isset($_POST['active'])
&& $_POST['active'] == '1')
{
$ResponderActive = 1;
}
$db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "` $db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "`
SET `message` = '" . $db->escape($message) . "', SET `message` = '" . $db->escape($message) . "',
@@ -166,8 +193,11 @@ if ($action == 'add') {
$email = trim(htmlspecialchars($_GET['email'])); $email = trim(htmlspecialchars($_GET['email']));
// Get account data // Get account data
$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1"); $result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
@@ -178,43 +208,56 @@ if ($action == 'add') {
$date_from = (int)$row['date_from']; $date_from = (int)$row['date_from'];
$date_until = (int)$row['date_until']; $date_until = (int)$row['date_until'];
if ($date_from == -1) { if($date_from == -1)
{
$deactivated = '-1'; $deactivated = '-1';
$date_from = ''; }
} else { else
{
$deactivated = '0'; $deactivated = '0';
$date_from = date('d-m-Y', $date_from); $date_from = date('d-m-Y', $date_from);
} }
$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true); $date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
if ($date_until == -1) { if($date_until == -1)
{
$deactivated = '-1'; $deactivated = '-1';
$date_until = ''; $date_until = '-1';
} else { }
else
{
$deactivated = '0'; $deactivated = '0';
$date_until = date('d-m-Y', $date_until); $date_until = date('d-m-Y', $date_until);
} }
$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true); $date_from_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
//$isactive = makeyesno('active', '1', '0', $row['enabled']); $checked = '';
$autoresponder_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_edit.php'; if($row['enabled'] == 1)
$autoresponder_edit_form = htmlform::genHTMLForm($autoresponder_edit_data); {
$checked = "checked=\"checked\"";
}
$title = $autoresponder_edit_data['autoresponder_edit']['title']; eval("echo \"" . getTemplate("email/autoresponder_edit") . "\";");
$image = $autoresponder_edit_data['autoresponder_edit']['image']; }
eval("echo \"" . getTemplate('autoresponder/autoresponder_edit') . "\";"); // Delete autoresponder
} elseif ($action == 'delete') {
// Delete autoresponder else
if (isset($_POST['send'])
&& $_POST['send'] == 'send' if($action == "delete")
) { {
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$account = trim($_POST['account']); $account = trim($_POST['account']);
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
@@ -222,31 +265,42 @@ if ($action == 'add') {
WHERE `email` = '" . $db->escape($account) . "' WHERE `email` = '" . $db->escape($account) . "'
AND `customerid` = '" . $db->escape((int)$userinfo['customerid']) . "' AND `customerid` = '" . $db->escape((int)$userinfo['customerid']) . "'
"); ");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_autoresponder_used` = `email_autoresponder_used` - 1 WHERE `customerid` = '" . $db->escape((int)$userinfo['customerid']). "'");
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} }
$email = trim(htmlspecialchars($_GET['email'])); $email = trim(htmlspecialchars($_GET['email']));
ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email)); ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email));
} else { }
// List existing autoresponders
// List existing autoresponders
else
{
$autoresponder = ''; $autoresponder = '';
$count = 0;
$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC"); $result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($row['date_from'] == -1 && $row['date_until'] == -1) { {
if($row['date_from'] == -1 && $row['date_until'] == -1)
{
$activated_date = $lng['panel']['not_activated']; $activated_date = $lng['panel']['not_activated'];
} elseif($row['date_from'] == -1 && $row['date_until'] != -1) { }
elseif($row['date_from'] == -1 && $row['date_until'] != -1)
{
$activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']); $activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']);
} elseif($row['date_from'] != -1 && $row['date_until'] == -1) { }
elseif($row['date_from'] != -1 && $row['date_until'] == -1)
{
$activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']); $activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']);
} else { }
else
{
$activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']); $activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']);
} }
eval("\$autoresponder.=\"" . getTemplate('autoresponder/autoresponder_autoresponder') . "\";"); eval("\$autoresponder.=\"" . getTemplate("email/autoresponder_autoresponder") . "\";");
$count++;
} }
eval("echo \"" . getTemplate('autoresponder/autoresponder') . "\";"); eval("echo \"" . getTemplate("email/autoresponder") . "\";");
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -45,7 +45,9 @@ elseif($page == 'domains')
{ {
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains");
$fields = array( $fields = array(
'd.domain' => $lng['domains']['domainname'] 'd.domain' => $lng['domains']['domainname'],
'd.documentroot' => $lng['panel']['path'],
'd.aliasdomain' => $lng['domains']['aliasdomain']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
@@ -66,39 +68,22 @@ elseif($page == 'domains')
$row['domainalias'] = $idna_convert->decode($row['domainalias']); $row['domainalias'] = $idna_convert->decode($row['domainalias']);
if($row['parentdomainid'] == '0' if($row['parentdomainid'] == '0'
&& $row['iswildcarddomain'] != '1'
&& $row['caneditdomain'] == '1') && $row['caneditdomain'] == '1')
{ {
$parentdomains_count++; $parentdomains_count++;
} }
/** $domains_count++;
* check for set ssl-certs to show different state-icons $domainparts = explode('.', $row['domain']);
*/ $domainparts = array_reverse($domainparts);
// nothing (ssl_global) $sortkey = '';
$row['domain_hascert'] = 0; foreach($domainparts as $key => $part)
$ssl_result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`='".(int)$row['id']."';"); {
if (is_array($ssl_result) $sortkey.= $part . '.';
&& isset($ssl_result['ssl_cert_file'])
&& $ssl_result['ssl_cert_file'] != ''
) {
// own certificate (ssl_customer_green)
$row['domain_hascert'] = 1;
} else {
// check if it's parent has one set (shared)
if ($row['parentdomainid'] != 0) {
$ssl_result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`='".(int)$row['parentdomainid']."';");
if (is_array($ssl_result)
&& isset($ssl_result['ssl_cert_file'])
&& $ssl_result['ssl_cert_file'] != ''
) {
// parent has a certificate (ssl_shared)
$row['domain_hascert'] = 2;
}
}
} }
$domains_count++; $domain_array[$sortkey] = $row;
$domain_array[$row['domain']] = $row;
} }
ksort($domain_array); ksort($domain_array);
@@ -140,11 +125,6 @@ elseif($page == 'domains')
if($paging->checkDisplay($i)) if($paging->checkDisplay($i))
{ {
$row = htmlentities_array($domain_array[$sortkey]); $row = htmlentities_array($domain_array[$sortkey]);
if($settings['system']['awstats_enabled'] == '1') {
$statsapp = 'awstats';
} else {
$statsapp = 'webalizer';
}
eval("\$domains.=\"" . getTemplate("domains/domains_delimiter") . "\";"); eval("\$domains.=\"" . getTemplate("domains/domains_delimiter") . "\";");
if($paging->sortfield == 'd.domain' if($paging->sortfield == 'd.domain'
@@ -165,14 +145,6 @@ elseif($page == 'domains')
$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot']))); $row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
} }
// get ssl-ips if activated
$show_ssledit = false;
if ($settings['system']['use_ssl'] == '1'
&& domainHasSslIpPort($row['id'])
&& $row['caneditdomain'] == '1'
) {
$show_ssledit = true;
}
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";"); eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
} }
@@ -206,22 +178,11 @@ elseif($page == 'domains')
} }
} }
/*
* check for APS packages used with this domain, #110
*/
if(domainHasApsInstances($id))
{
standard_error('domains_cantdeletedomainwithapsinstances');
}
$log->logAction(USR_ACTION, LOG_INFO, "deleted subdomain '" . $idna_convert->decode($result['domain']) . "'"); $log->logAction(USR_ACTION, LOG_INFO, "deleted subdomain '" . $idna_convert->decode($result['domain']) . "'");
$result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
else else
@@ -244,19 +205,17 @@ elseif($page == 'domains')
{ {
$subdomain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['subdomain'], 'subdomain', '', 'subdomainiswrong'))); $subdomain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['subdomain'], 'subdomain', '', 'subdomainiswrong')));
$domain = $idna_convert->encode($_POST['domain']); $domain = $idna_convert->encode($_POST['domain']);
$domain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($domain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `caneditdomain`='1' "); $domain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($domain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `iswildcarddomain`='0' AND `caneditdomain`='1' ");
$completedomain = $subdomain . '.' . $domain; $completedomain = $subdomain . '.' . $domain;
$completedomain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($completedomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `email_only`='0' AND `caneditdomain` = '1'"); $completedomain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($completedomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `email_only`='0' AND `caneditdomain` = '1'");
$aliasdomain = intval($_POST['alias']); $aliasdomain = intval($_POST['alias']);
$aliasdomain_check = array( $aliasdomain_check = array(
'id' => 0 'id' => 0
); );
$_doredirect = false;
if($aliasdomain != 0) if($aliasdomain != 0)
{ {
// also check ip/port combination to be the same, #176 $aliasdomain_check = $db->query_first('SELECT `id` FROM `' . TABLE_PANEL_DOMAINS . '` `d`,`' . TABLE_PANEL_CUSTOMERS . '` `c` WHERE `d`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`aliasdomain` IS NULL AND `d`.`id`<>`c`.`standardsubdomain` AND `c`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`id`=\'' . (int)$aliasdomain . '\'');
$aliasdomain_check = $db->query_first("SELECT `d`.`id` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` = '".(int)$aliasdomain."' AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`customerid` = '" . (int)$userinfo['customerid'] . "' AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '".(int)$aliasdomain."') GROUP BY `d`.`domain` ORDER BY `d`.`domain` ASC;");
} }
if(isset($_POST['url']) if(isset($_POST['url'])
@@ -264,7 +223,6 @@ elseif($page == 'domains')
&& validateUrl($idna_convert->encode($_POST['url']))) && validateUrl($idna_convert->encode($_POST['url'])))
{ {
$path = $_POST['url']; $path = $_POST['url'];
$_doredirect = true;
} }
else else
{ {
@@ -274,25 +232,8 @@ elseif($page == 'domains')
if(!preg_match('/^https?\:\/\//', $path) if(!preg_match('/^https?\:\/\//', $path)
|| !validateUrl($idna_convert->encode($path))) || !validateUrl($idna_convert->encode($path)))
{ {
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, $path = $userinfo['documentroot'] . '/' . $path;
// set default path to subdomain or domain name $path = makeCorrectDir($path);
if((($path == '') || ($path == '/'))
&& $settings['system']['documentroot_use_default_value'] == 1)
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
}
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
}
if (strstr($path, ":") !== FALSE)
{
standard_error('pathmaynotcontaincolon');
}
}
else
{
$_doredirect = true;
} }
if(isset($_POST['openbasedir_path']) if(isset($_POST['openbasedir_path'])
@@ -345,51 +286,17 @@ elseif($page == 'domains')
} }
else else
{ {
// get the phpsettingid from parentdomain, #107 $result = $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`customerid`, `domain`, `documentroot`, `ipandport`, `aliasdomain`, `parentdomainid`, `isemaildomain`, `openbasedir`, `openbasedir_path`, `safemode`, `speciallogfile`, `specialsettings`, `ssl_redirect`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($completedomain) . "', '" . $db->escape($path) . "', '" . $db->escape($domain_check['ipandport']) . "', " . (($aliasdomain != 0) ? "'" . $db->escape($aliasdomain) . "'" : "NULL") . ", '" . (int)$domain_check['id'] . "', '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', '" . $db->escape($domain_check['openbasedir']) . "', '" . $db->escape($openbasedir_path) . "', '" . $db->escape($domain_check['safemode']) . "', '" . $db->escape($domain_check['speciallogfile']) . "', '" . $db->escape($domain_check['specialsettings']) . "', '" . $ssl_redirect . "')");
$phpsid_result = $db->query_first("SELECT `phpsettingid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `id` = '".(int)$domain_check['id']."'");
if(!isset($phpsid_result['phpsettingid'])
|| (int)$phpsid_result['phpsettingid'] <= 0
) {
// assign default config
$phpsid_result['phpsettingid'] = 1;
}
$result = $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET
`customerid` = '" . (int)$userinfo['customerid'] . "',
`domain` = '" . $db->escape($completedomain) . "',
`documentroot` = '" . $db->escape($path) . "',
`aliasdomain` = ".(($aliasdomain != 0) ? "'" . $db->escape($aliasdomain) . "'" : "NULL") .",
`parentdomainid` = '" . (int)$domain_check['id'] . "',
`isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "',
`openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "',
`openbasedir_path` = '" . $db->escape($openbasedir_path) . "',
`speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "',
`specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "',
`ssl_redirect` = '" . $ssl_redirect . "',
`phpsettingid` = '" . $phpsid_result['phpsettingid'] . "'");
$result = $db->query("INSERT INTO `".TABLE_DOMAINTOIP."` (`id_domain`, `id_ipandports`) SELECT LAST_INSERT_ID(), `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '" . (int)$domain_check['id'] . "';");
if($_doredirect)
{
$did = $db->insert_id();
$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : $settings['customredirect']['default'];
addRedirectToDomain($did, $redirect);
}
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
$result = $db->query("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `caneditdomain`='1' ORDER BY `domain` ASC"); $result = $db->query("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `iswildcarddomain`='0' AND `caneditdomain`='1' ORDER BY `domain` ASC");
$domains = ''; $domains = '';
while($row = $db->fetch_array($result)) while($row = $db->fetch_array($result))
@@ -405,32 +312,9 @@ elseif($page == 'domains')
$aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']); $aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
} }
$redirectcode = ''; $ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
if($settings['customredirect']['enabled'] == '1')
{
$codes = getRedirectCodesArray();
foreach($codes as $rc)
{
$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $settings['customredirect']['default']);
}
}
// check if we at least have one ssl-ip/port, #1179
$ssl_ipsandports = '';
$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
$ssl_ipsandports = 'notempty';
}
$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true); $openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php';
$subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data);
$title = $subdomain_add_data['domain_add']['title'];
$image = $subdomain_add_data['domain_add']['image'];
eval("echo \"" . getTemplate("domains/domains_add") . "\";"); eval("echo \"" . getTemplate("domains/domains_add") . "\";");
} }
} }
@@ -438,10 +322,9 @@ elseif($page == 'domains')
elseif($action == 'edit' elseif($action == 'edit'
&& $id != 0) && $id != 0)
{ {
$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`wwwserveralias`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'"); $result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir_path` ,`pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
$alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\''); $alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\'');
$alias_check = $alias_check['count']; $alias_check = $alias_check['count'];
$_doredirect = false;
if(isset($result['customerid']) if(isset($result['customerid'])
&& $result['customerid'] == $userinfo['customerid']) && $result['customerid'] == $userinfo['customerid'])
@@ -454,7 +337,6 @@ elseif($page == 'domains')
&& validateUrl($idna_convert->encode($_POST['url']))) && validateUrl($idna_convert->encode($_POST['url'])))
{ {
$path = $_POST['url']; $path = $_POST['url'];
$_doredirect = true;
} }
else else
{ {
@@ -464,37 +346,30 @@ elseif($page == 'domains')
if(!preg_match('/^https?\:\/\//', $path) if(!preg_match('/^https?\:\/\//', $path)
|| !validateUrl($idna_convert->encode($path))) || !validateUrl($idna_convert->encode($path)))
{ {
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, $path = $userinfo['documentroot'] . '/' . $path;
// set default path to subdomain or domain name $path = makeCorrectDir($path);
if((($path == '') || ($path == '/'))
&& $settings['system']['documentroot_use_default_value'] == 1)
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
}
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
}
if (strstr($path, ":") !== FALSE)
{
standard_error('pathmaynotcontaincolon');
}
}
else
{
$_doredirect = true;
} }
$aliasdomain = intval($_POST['alias']); $aliasdomain = intval($_POST['alias']);
if(isset($_POST['selectserveralias']) if(isset($_POST['iswildcarddomain'])
&& $_POST['iswildcarddomain'] == '1'
&& $result['parentdomainid'] == '0' && $result['parentdomainid'] == '0'
) { && $userinfo['subdomains'] != '0')
$iswildcarddomain = ($_POST['selectserveralias'] == '0') ? '1' : '0'; {
$wwwserveralias = ($_POST['selectserveralias'] == '1') ? '1' : '0'; $wildcarddomaincheck = $db->query("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `parentdomainid` = '" . (int)$result['id'] . "'");
} else {
if($db->num_rows($wildcarddomaincheck) != '0')
{
standard_error('firstdeleteallsubdomains');
exit;
}
$iswildcarddomain = '1';
}
else
{
$iswildcarddomain = '0'; $iswildcarddomain = '0';
$wwwserveralias = '0';
} }
if($result['parentdomainid'] != '0' if($result['parentdomainid'] != '0'
@@ -556,36 +431,17 @@ elseif($page == 'domains')
$log->logAction(USR_ACTION, LOG_NOTICE, "automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'");
} }
if($_doredirect)
{
$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : false;
updateRedirectOfDomain($id, $redirect);
}
if($path != $result['documentroot'] if($path != $result['documentroot']
|| $isemaildomain != $result['isemaildomain'] || $isemaildomain != $result['isemaildomain']
|| $wwwserveralias != $result['wwwserveralias']
|| $iswildcarddomain != $result['iswildcarddomain'] || $iswildcarddomain != $result['iswildcarddomain']
|| $aliasdomain != $result['aliasdomain'] || $aliasdomain != $result['aliasdomain']
|| $openbasedir_path != $result['openbasedir_path'] || $openbasedir_path != $result['openbasedir_path']
|| $ssl_redirect != $result['ssl_redirect']) || $ssl_redirect != $result['ssl_redirect'])
{ {
$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'"); $log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
`documentroot`='" . $db->escape($path) . "',
`isemaildomain`='" . (int)$isemaildomain . "',
`wwwserveralias`='" . (int)$wwwserveralias . "',
`iswildcarddomain`='" . (int)$iswildcarddomain . "',
`aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",
`openbasedir_path`='" . $db->escape($openbasedir_path) . "',
`ssl_redirect`='" . $ssl_redirect . "'
WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"
);
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
} }
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -594,10 +450,8 @@ elseif($page == 'domains')
else else
{ {
$result['domain'] = $idna_convert->decode($result['domain']); $result['domain'] = $idna_convert->decode($result['domain']);
$domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true); $domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true);
// also check ip/port combination to be the same, #176 $result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id`<>'" . (int)$result['id'] . "' AND `c`.`standardsubdomain`<>`d`.`id` AND `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `c`.`customerid`=`d`.`customerid` ORDER BY `d`.`domain` ASC");
$result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` <> '".(int)$result['id']."' AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`customerid` = '" . (int)$userinfo['customerid'] . "' AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '".(int)$result['id']."') GROUP BY `d`.`domain` ORDER BY `d`.`domain` ASC");
while($row_domain = $db->fetch_array($result_domains)) while($row_domain = $db->fetch_array($result_domains))
{ {
@@ -606,17 +460,10 @@ elseif($page == 'domains')
if(preg_match('/^https?\:\/\//', $result['documentroot']) if(preg_match('/^https?\:\/\//', $result['documentroot'])
&& validateUrl($idna_convert->encode($result['documentroot'])) && validateUrl($idna_convert->encode($result['documentroot']))
) { && $settings['panel']['pathedit'] == 'Dropdown')
if($settings['panel']['pathedit'] == 'Dropdown') {
{ $urlvalue = $result['documentroot'];
$urlvalue = $result['documentroot']; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
}
else
{
$urlvalue = '';
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot'], true);
}
} }
else else
{ {
@@ -624,52 +471,15 @@ elseif($page == 'domains')
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']);
} }
$redirectcode = ''; $ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
if($settings['customredirect']['enabled'] == '1') $iswildcarddomain = makeyesno('iswildcarddomain', '1', '0', $result['iswildcarddomain']);
{ $isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
$def_code = getDomainRedirectId($id);
$codes = getRedirectCodesArray();
foreach($codes as $rc)
{
$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $def_code);
}
}
// check if we at least have one ssl-ip/port, #1179
$ssl_ipsandports = '';
$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
$ssl_ipsandports = 'notempty';
}
$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true); $openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
// create serveralias options
$serveraliasoptions = "";
$_value = '2';
if ($result['iswildcarddomain'] == '1') {
$_value = '0';
} elseif ($result['wwwserveralias'] == '1') {
$_value = '1';
}
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_wildcard'], '0', $_value, true, true);
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_www'], '1', $_value, true, true);
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_none'], '2', $_value, true, true);
$resultips = $db->query("SELECT `p`.`ip` AS `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` `p` LEFT JOIN `".TABLE_DOMAINTOIP."` `dip` ON ( `dip`.`id_ipandports` = `p`.`id` ) WHERE `dip`.`id_domain` = '".(int)$result['id']."' GROUP BY `p`.`ip`");
$result_ipandport['ip'] = '';
while ($rowip = $db->fetch_array($resultips)) {
$result_ipandport['ip'] .= $rowip['ip'] . "<br />";
}
$domainip = $result_ipandport['ip'];
$result = htmlentities_array($result); $result = htmlentities_array($result);
$subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php'; if($settings['system']['use_ssl'] == "1")
$subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data); {
}
$title = $subdomain_edit_data['domain_edit']['title'];
$image = $subdomain_edit_data['domain_edit']['image'];
eval("echo \"" . getTemplate("domains/domains_edit") . "\";"); eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
} }
@@ -680,126 +490,5 @@ elseif($page == 'domains')
} }
} }
} }
elseif ($page == 'domainssleditor') {
if ($action == '' ?>
|| $action == 'view'
) {
if (isset($_POST['send'])
&& $_POST['send'] == 'send'
) {
$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
if ($ssl_cert_file != '' && $ssl_key_file == '') {
standard_error('sslcertificateismissingprivatekey');
}
$do_verify = true;
// no cert-file given -> forget everything
if ($ssl_cert_file == '') {
$ssl_key_file = '';
$ssl_ca_file = '';
$ssl_cert_chainfile = '';
$do_verify = false;
}
// verify certificate content
if ($do_verify) {
// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
// openssl_x509_parse() returns information about the supplied x509cert, including fields such as
// subject name, issuer name, purposes, valid from and valid to dates etc.
$cert_content = openssl_x509_parse($ssl_cert_file);
if (is_array($cert_content)
&& isset($cert_content['subject'])
&& isset($cert_content['subject']['CN'])
) {
// TODO self-signed certs might differ and don't need/want this
/*
$domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'");
if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) {
standard_error('sslcertificatewrongdomain');
}
*/
// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
// Checks whether the given key is the private key that corresponds to cert.
if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
standard_error('sslcertificateinvalidcertkeypair');
}
// check optional stuff
if ($ssl_ca_file != '') {
$ca_content = openssl_x509_parse($ssl_ca_file);
if (!is_array($ca_content)) {
// invalid
standard_error('sslcertificateinvalidca');
}
}
if ($ssl_cert_chainfile != '') {
$chain_content = openssl_x509_parse($ssl_cert_chainfile);
if (!is_array($chain_content)) {
// invalid
standard_error('sslcertificateinvalidchain');
}
}
} else {
standard_error('sslcertificateinvalidcert');
}
}
// Add/Update database entry
$qrystart = "UPDATE ";
$qrywhere = "WHERE ";
if ($do_insert) {
$qrystart = "INSERT INTO ";
$qrywhere = ", ";
}
$db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
`ssl_cert_file` = '".$db->escape($ssl_cert_file)."',
`ssl_key_file` = '".$db->escape($ssl_key_file)."',
`ssl_ca_file` = '".$db->escape($ssl_ca_file)."',
`ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."'
".$qrywhere." `domainid`='".(int)$id."';"
);
// insert task to re-generate webserver-configs (#1260)
inserttask('1');
// back to domain overview
redirectTo($filename, array('page' => 'domains', 's' => $s));
}
$result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
WHERE `domainid`='".(int)$id."';"
);
$do_insert = false;
// if no entry can be found, behave like we have empty values
if (!is_array($result) || !isset($result['ssl_cert_file'])) {
$result = array(
'ssl_cert_file' => '',
'ssl_key_file' => '',
'ssl_ca_file' => '',
'ssl_cert_chainfile' => ''
);
$do_insert = true;
}
$result = htmlentities_array($result);
$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
$title = $ssleditor_data['domain_ssleditor']['title'];
$image = $ssleditor_data['domain_ssleditor']['image'];
eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
}
}

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -50,7 +50,7 @@ elseif($page == 'emails')
'm.destination' => $lng['emails']['forwarders'] 'm.destination' => $lng['emails']['forwarders']
); );
$paging = new paging($userinfo, $db, TABLE_MAIL_VIRTUAL, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_MAIL_VIRTUAL, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query('SELECT `m`.`id`, `m`.`domainid`, `m`.`email`, `m`.`email_full`, `m`.`iscatchall`, `u`.`quota`, `m`.`destination`, `m`.`popaccountid`, `d`.`domain`, `u`.`mboxsize` FROM `' . TABLE_MAIL_VIRTUAL . '` `m` LEFT JOIN `' . TABLE_PANEL_DOMAINS . '` `d` ON (`m`.`domainid` = `d`.`id`) LEFT JOIN `' . TABLE_MAIL_USERS . '` `u` ON (`m`.`popaccountid` = `u`.`id`) WHERE `m`.`customerid`="' . $db->escape($userinfo['customerid']) . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query('SELECT `m`.`id`, `m`.`domainid`, `m`.`email`, `m`.`email_full`, `m`.`iscatchall`, `u`.`quota`, `m`.`destination`, `m`.`popaccountid`, `d`.`domain` FROM `' . TABLE_MAIL_VIRTUAL . '` `m` LEFT JOIN `' . TABLE_PANEL_DOMAINS . '` `d` ON (`m`.`domainid` = `d`.`id`) LEFT JOIN `' . TABLE_MAIL_USERS . '` `u` ON (`m`.`popaccountid` = `u`.`id`) WHERE `m`.`customerid`="' . $db->escape($userinfo['customerid']) . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -66,7 +66,6 @@ elseif($page == 'emails')
$emails[$row['domain']] = array(); $emails[$row['domain']] = array();
} }
$row['mboxsize'] = size_readable($row['mboxsize']);
$emails[$row['domain']][$row['email_full']] = $row; $emails[$row['domain']][$row['email_full']] = $row;
} }
@@ -140,10 +139,8 @@ elseif($page == 'emails')
} }
} }
$emaildomains_count = $db->query_first("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `isemaildomain`='1' ORDER BY `domain` ASC"); $emaildomains_count = $db->query_first("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' AND `isemaildomain`='1' ORDER BY `domain` ASC");
$emaildomains_count = $emaildomains_count['count']; $emaildomains_count = $emaildomains_count['count'];
$emailscount = $db->num_rows($result);
eval("echo \"" . getTemplate("email/emails") . "\";"); eval("echo \"" . getTemplate("email/emails") . "\";");
} }
elseif($action == 'delete' elseif($action == 'delete'
@@ -185,12 +182,6 @@ elseif($page == 'emails')
$number_forwarders = 0; $number_forwarders = 0;
} }
if(isset($_POST['delete_userfiles'])
&& (int)$_POST['delete_userfiles'] == 1)
{
inserttask('7', $userinfo['loginname'], $result['email_full']);
}
$db->query("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `emails_used`=`emails_used` - 1 , `email_forwarders_used` = `email_forwarders_used` - " . (int)$number_forwarders . " $update_users_query_addon WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `emails_used`=`emails_used` - 1 , `email_forwarders_used` = `email_forwarders_used` - " . (int)$number_forwarders . " $update_users_query_addon WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "deleted email address '" . $result['email'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "deleted email address '" . $result['email'] . "'");
@@ -198,12 +189,7 @@ elseif($page == 'emails')
} }
else else
{ {
if(maildirExists($result)) { ask_yesno('email_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full']));
$show_checkbox = true;
} else {
$show_checkbox = false;
}
ask_yesno_withcheckbox('email_reallydelete', 'admin_customer_alsoremovemail', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full']), $show_checkbox);
} }
} }
} }
@@ -238,7 +224,7 @@ elseif($page == 'emails')
standard_error('emailiswrong', $email_full); standard_error('emailiswrong', $email_full);
} }
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE (`email` = '" . strtolower($db->escape($email)) . "' OR `email_full` = '" . strtolower($db->escape($email_full)) . "') AND `customerid`='" . (int)$userinfo['customerid'] . "'"); $email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE ( `email`='" . $db->escape($email) . "' OR `email_full` = '" . $db->escape($email_full) . "' ) AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email == '' if($email == ''
|| $email_full == '' || $email_full == ''
@@ -254,7 +240,7 @@ elseif($page == 'emails')
{ {
standard_error('maindomainnonexist', $domain); standard_error('maindomainnonexist', $domain);
} }
elseif(strtolower($email_check['email_full']) == strtolower($email_full)) elseif($email_check['email_full'] == $email_full)
{ {
standard_error('emailexistalready', $email_full); standard_error('emailexistalready', $email_full);
} }
@@ -282,20 +268,7 @@ elseif($page == 'emails')
$domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']); $domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']);
} }
//$iscatchall = makeyesno('iscatchall', '1', '0', '0'); $iscatchall = makeyesno('iscatchall', '1', '0', '0');
$email_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_add.php';
if ( $settings['catchall']['catchall_enabled'] != '1' )
{
unset($email_add_data['emails_add']['sections']['section_a']['fields']['iscatchall']);
}
$email_add_form = htmlform::genHTMLForm($email_add_data);
$title = $email_add_data['emails_add']['title'];
$image = $email_add_data['emails_add']['image'];
eval("echo \"" . getTemplate("email/emails_add") . "\";"); eval("echo \"" . getTemplate("email/emails_add") . "\";");
} }
} }
@@ -335,60 +308,40 @@ elseif($page == 'emails')
$destinations_count = count($result['destination']); $destinations_count = count($result['destination']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$email_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_edit.php';
if ( $settings['catchall']['catchall_enabled'] != '1' )
{
unset($email_edit_data['emails_edit']['sections']['section_a']['fields']['mail_catchall']);
}
$email_edit_form = htmlform::genHTMLForm($email_edit_data);
$title = $email_edit_data['emails_edit']['title'];
$image = $email_edit_data['emails_edit']['image'];
eval("echo \"" . getTemplate("email/emails_edit") . "\";"); eval("echo \"" . getTemplate("email/emails_edit") . "\";");
} }
} }
elseif($action == 'togglecatchall' elseif($action == 'togglecatchall'
&& $id != 0) && $id != 0)
{ {
if ( $settings['catchall']['catchall_enabled'] == '1' ) $result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
{
$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if(isset($result['email']) if(isset($result['email'])
&& $result['email'] != '') && $result['email'] != '')
{
if($result['iscatchall'] == '1')
{ {
if($result['iscatchall'] == '1') $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
}
else
{
$email_parts = explode('@', $result['email_full']);
$email = '@' . $email_parts[1];
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email_check['email'] == $email)
{ {
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'"); standard_error('youhavealreadyacatchallforthisdomain');
exit;
} }
else else
{ {
$email_parts = explode('@', $result['email_full']); $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
$email = '@' . $email_parts[1]; $log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email_check['email'] == $email)
{
standard_error('youhavealreadyacatchallforthisdomain');
exit;
}
else
{
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
}
} }
redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
} }
}
else redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
{
standard_error(array('operationnotpermitted', 'featureisdisabled'), 'Catchall');
} }
} }
} }
@@ -419,7 +372,6 @@ elseif($page == 'accounts')
$email_full = $result['email_full']; $email_full = $result['email_full'];
$username = $idna_convert->decode($email_full); $username = $idna_convert->decode($email_full);
$password = validate($_POST['email_password'], 'password'); $password = validate($_POST['email_password'], 'password');
$password = validatePassword($password);
if($settings['panel']['sendalternativemail'] == 1) if($settings['panel']['sendalternativemail'] == 1)
{ {
@@ -459,42 +411,11 @@ elseif($page == 'accounts')
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} }
$cryptPassword = makeCryptPassword($password); $db->query("INSERT INTO `" . TABLE_MAIL_USERS . "` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($email_full) . "', '" . $db->escape($username) . "', " . ($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "'," : '') . " ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_full . '/') . "', '" . (int)$settings['system']['vmail_uid'] . "', '" . (int)$settings['system']['vmail_gid'] . "', '" . (int)$result['domainid'] . "', 'y', '" . (int)$quota . "', '" . (int)$userinfo['imap'] . "', '" . (int)$userinfo['pop3'] . "')");
$email_user=substr($email_full,0,strrpos($email_full,"@"));
$email_domain=substr($email_full,strrpos($email_full,"@")+1);
$maildirname=trim($settings['system']['vmail_maildirname']);
// Add trailing slash to Maildir if needed
$maildirpath=$maildirname;
if (!empty($maildirname) and substr($maildirname,-1) != "/") $maildirpath.="/";
$db->query("INSERT INTO `" . TABLE_MAIL_USERS .
"` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) ".
"VALUES (".
"'" . (int)$userinfo['customerid'] . "', ".
"'" . $db->escape($email_full) . "', ".
"'" . $db->escape($username) . "', " .
($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "', " : '') .
"'" . $db->escape($cryptPassword) . "', ".
"'" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_domain . "/" . $email_user . "/" . $maildirpath) . "', ".
"'" . (int)$settings['system']['vmail_uid'] . "', ".
"'" . (int)$settings['system']['vmail_gid'] . "', ".
"'" . (int)$result['domainid'] . "', ".
"'y', ".
"'" . (int)$quota . "', ".
"'" . (int)$userinfo['imap'] . "', ".
"'" . (int)$userinfo['pop3'] . "')");
$popaccountid = $db->insert_id(); $popaccountid = $db->insert_id();
$result['destination'].= ' ' . $email_full; $result['destination'].= ' ' . $email_full;
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET ". $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', `popaccountid` = '" . (int)$popaccountid . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
"`destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', ". $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used`=`email_accounts_used`+1, `email_quota_used`=`email_quota_used`+" . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
"`popaccountid` = '" . (int)$popaccountid . "' ".
"WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET ".
"`email_accounts_used`=`email_accounts_used`+1, ".
"`email_quota_used`=`email_quota_used`+" . (int)$quota . " ".
"WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'");
$replace_arr = array( $replace_arr = array(
'EMAIL' => $email_full, 'EMAIL' => $email_full,
@@ -506,26 +427,25 @@ elseif($page == 'accounts')
$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success']['subject']), $replace_arr)); $mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success']['subject']), $replace_arr));
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($userinfo['def_language']) . '\' AND `templategroup`=\'mails\' AND `varname`=\'pop_success_mailbody\''); $result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($userinfo['def_language']) . '\' AND `templategroup`=\'mails\' AND `varname`=\'pop_success_mailbody\'');
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success']['mailbody']), $replace_arr)); $mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success']['mailbody']), $replace_arr));
$mail->From = $admin['email'];
$mail->FromName = getCorrectUserSalutation($admin);
$mail->Subject = $mail_subject;
$mail->Body = $mail_body;
$mail->AddAddress($email_full, getCorrectUserSalutation($userinfo));
$_mailerror = false; if(!$mail->Send())
try { {
$mail->SetFrom($admin['email'], getCorrectUserSalutation($admin)); if($mail->ErrorInfo != '')
$mail->Subject = $mail_subject; {
$mail->AltBody = $mail_body; $mailerr_msg = $mail->ErrorInfo;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body)); }
$mail->AddAddress($email_full); else
$mail->Send(); {
} catch(phpmailerException $e) { $mailerr_msg = $email;
$mailerr_msg = $e->errorMessage(); }
$_mailerror = true;
} catch (Exception $e) {
$mailerr_msg = $e->getMessage();
$_mailerror = true;
}
if ($_mailerror) {
$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg); $log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error('errorsendingmail', $email_full); standard_error('errorsendingmail', $email);
} }
$mail->ClearAddresses(); $mail->ClearAddresses();
@@ -537,24 +457,23 @@ elseif($page == 'accounts')
$mail_subject = replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success_alternative']['subject']), $replace_arr); $mail_subject = replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success_alternative']['subject']), $replace_arr);
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($userinfo['def_language']) . '\' AND `templategroup`=\'mails\' AND `varname`=\'pop_success_alternative_mailbody\''); $result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($userinfo['def_language']) . '\' AND `templategroup`=\'mails\' AND `varname`=\'pop_success_alternative_mailbody\'');
$mail_body = replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success_alternative']['mailbody']), $replace_arr); $mail_body = replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['pop_success_alternative']['mailbody']), $replace_arr);
$mail->From = $admin['email'];
$mail->FromName = getCorrectUserSalutation($admin);
$mail->Subject = $mail_subject;
$mail->Body = $mail_body;
$mail->AddAddress($idna_convert->encode($alternative_email), getCorrectUserSalutation($userinfo));
$_mailerror = false; if(!$mail->Send())
try { {
$mail->SetFrom($admin['email'], getCorrectUserSalutation($admin)); if($mail->ErrorInfo != '')
$mail->Subject = $mail_subject; {
$mail->AltBody = $mail_body; $mailerr_msg = $mail->ErrorInfo;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body)); }
$mail->AddAddress($idna_convert->encode($alternative_email), getCorrectUserSalutation($userinfo)); else
$mail->Send(); {
} catch(phpmailerException $e) { $mailerr_msg = $alternative_email;
$mailerr_msg = $e->errorMessage(); }
$_mailerror = true;
} catch (Exception $e) {
$mailerr_msg = $e->getMessage();
$_mailerror = true;
}
if ($_mailerror) {
$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg); $log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error(array('errorsendingmail', $alternative_email)); standard_error(array('errorsendingmail', $alternative_email));
} }
@@ -570,13 +489,6 @@ elseif($page == 'accounts')
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$quota = $settings['system']['mail_quota']; $quota = $settings['system']['mail_quota'];
$account_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addaccount.php';
$account_add_form = htmlform::genHTMLForm($account_add_data);
$title = $account_add_data['emails_addaccount']['title'];
$image = $account_add_data['emails_addaccount']['image'];
eval("echo \"" . getTemplate("email/account_add") . "\";"); eval("echo \"" . getTemplate("email/account_add") . "\";");
} }
} }
@@ -604,25 +516,17 @@ elseif($page == 'accounts')
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
exit; exit;
} }
else
$password = validatePassword($password); {
$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'"); $result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
$cryptPassword = makeCryptPassword($password); redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'"); }
redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
} }
else else
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$account_changepw_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangepasswd.php';
$account_changepw_form = htmlform::genHTMLForm($account_changepw_data);
$title = $account_changepw_data['emails_accountchangepasswd']['title'];
$image = $account_changepw_data['emails_accountchangepasswd']['image'];
eval("echo \"" . getTemplate("email/account_changepw") . "\";"); eval("echo \"" . getTemplate("email/account_changepw") . "\";");
} }
} }
@@ -664,13 +568,6 @@ elseif($page == 'accounts')
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$quota_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangequota.php';
$quota_edit_form = htmlform::genHTMLForm($quota_edit_data);
$title = $quota_edit_data['emails_accountchangequota']['title'];
$image = $quota_edit_data['emails_accountchangequota']['image'];
eval("echo \"" . getTemplate("email/account_changequota") . "\";"); eval("echo \"" . getTemplate("email/account_changequota") . "\";");
} }
} }
@@ -700,19 +597,13 @@ elseif($page == 'accounts')
$quota = 0; $quota = 0;
} }
if(isset($_POST['delete_userfiles'])
&& (int)$_POST['delete_userfiles'] == 1)
{
inserttask('7', $userinfo['loginname'], $result['email_full']);
}
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used` = `email_accounts_used` - 1, `email_quota_used` = `email_quota_used` - " . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used` = `email_accounts_used` - 1, `email_quota_used` = `email_quota_used` - " . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "deleted email account for '" . $result['email_full'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "deleted email account for '" . $result['email_full'] . "'");
redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s)); redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
} }
else else
{ {
ask_yesno_withcheckbox('email_reallydelete_account', 'admin_customer_alsoremovemail', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full'])); ask_yesno('email_reallydelete_account', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full']));
} }
} }
} }
@@ -765,13 +656,6 @@ elseif($page == 'forwarders')
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$forwarder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addforwarder.php';
$forwarder_add_form = htmlform::genHTMLForm($forwarder_add_data);
$title = $forwarder_add_data['emails_addforwarder']['title'];
$image = $forwarder_add_data['emails_addforwarder']['image'];
eval("echo \"" . getTemplate("email/forwarder_add") . "\";"); eval("echo \"" . getTemplate("email/forwarder_add") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -39,30 +39,6 @@ if($page == 'overview')
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras");
eval("echo \"" . getTemplate("extras/extras") . "\";"); eval("echo \"" . getTemplate("extras/extras") . "\";");
} }
elseif($page == 'backup')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras_backup");
$result = $db->query("SELECT `backup_enabled` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$row = $db->fetch_array($result);
$backup_enabled = makeyesno('backup_enabled', '1', '0', $row['backup_enabled']);
if(isset($_POST['send']) && $_POST['send'] == 'send'){
$backup_enabled = ($_POST['backup_enabled'] == '1' ? '1' : '0');
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `backup_enabled`='" . $backup_enabled . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
redirectTo($filename, Array('page' => $page, 's' => $s));
}
$backup_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.backup.php';
$backup_form = htmlform::genHTMLForm($backup_data);
$title = $backup_data['backup']['title'];
$image = $backup_data['backup']['image'];
eval("echo \"" . getTemplate("extras/backup") . "\";");
}
elseif($page == 'htpasswds') elseif($page == 'htpasswds')
{ {
if($action == '') if($action == '')
@@ -73,7 +49,7 @@ elseif($page == 'htpasswds')
'path' => $lng['panel']['path'] 'path' => $lng['panel']['path']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_HTPASSWDS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_HTPASSWDS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -105,7 +81,7 @@ elseif($page == 'htpasswds')
elseif($action == 'delete' elseif($action == 'delete'
&& $id != 0) && $id != 0)
{ {
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT `id`, `customerid`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if(isset($result['username']) if(isset($result['username'])
&& $result['username'] != '') && $result['username'] != '')
@@ -138,7 +114,6 @@ elseif($page == 'htpasswds')
$userpath = $path; $userpath = $path;
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
$username = validate($_POST['username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/'); $username = validate($_POST['username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
$authname = validate($_POST['directory_authname'], 'directory_authname', '/^[a-zA-Z0-9][a-zA-Z0-9\-_ ]+\$?$/');
validate($_POST['directory_password'], 'password'); validate($_POST['directory_password'], 'password');
$username_path_check = $db->query_first("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `username`='" . $db->escape($username) . "' AND `path`='" . $db->escape($path) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'"); $username_path_check = $db->query_first("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `username`='" . $db->escape($username) . "' AND `path`='" . $db->escape($path) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
@@ -176,7 +151,7 @@ elseif($page == 'htpasswds')
} }
else else
{ {
$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` (`customerid`, `username`, `password`, `path`, `authname`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($password) . "', '" . $db->escape($path) . "', '" . $db->escape($authname) . "')"); $db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` (`customerid`, `username`, `password`, `path`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($password) . "', '" . $db->escape($path) . "')");
$log->logAction(USR_ACTION, LOG_INFO, "added htpasswd for '" . $username . " (" . $path . ")'"); $log->logAction(USR_ACTION, LOG_INFO, "added htpasswd for '" . $username . " (" . $path . ")'");
inserttask('1'); inserttask('1');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -185,20 +160,13 @@ elseif($page == 'htpasswds')
else else
{ {
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$htpasswd_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_add.php';
$htpasswd_add_form = htmlform::genHTMLForm($htpasswd_add_data);
$title = $htpasswd_add_data['htpasswd_add']['title'];
$image = $htpasswd_add_data['htpasswd_add']['image'];
eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";"); eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";");
} }
} }
elseif($action == 'edit' elseif($action == 'edit'
&& $id != 0) && $id != 0)
{ {
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if(isset($result['username']) if(isset($result['username'])
&& $result['username'] != '') && $result['username'] != '')
@@ -207,7 +175,6 @@ elseif($page == 'htpasswds')
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
validate($_POST['directory_password'], 'password'); validate($_POST['directory_password'], 'password');
$authname = validate($_POST['directory_authname'], 'directory_authname', '/^[a-zA-Z0-9][a-zA-Z0-9\-_ ]+\$?$/');
if(CRYPT_STD_DES == 1) if(CRYPT_STD_DES == 1)
{ {
@@ -219,25 +186,13 @@ elseif($page == 'htpasswds')
$password = crypt($_POST['directory_password']); $password = crypt($_POST['directory_password']);
} }
$pwd_sql = ''; if($_POST['directory_password'] == '')
if($_POST['directory_password'] != '')
{ {
$pwd_sql = "`password`='" . $db->escape($password) . "' "; standard_error(array('stringisempty', 'mypassword'));
} }
else
$auth_sql = '';
if($authname != $result['authname'])
{ {
$auth_sql = "`authname`='" . $db->escape($authname) . "' "; $db->query("UPDATE `" . TABLE_PANEL_HTPASSWDS . "` SET `password`='" . $db->escape($password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
}
if($pwd_sql != '' || $auth_sql != '')
{
if($pwd_sql !='' && $auth_sql != '') {
$pwd_sql.= ', ';
}
$db->query("UPDATE `" . TABLE_PANEL_HTPASSWDS . "` SET ".$pwd_sql.$auth_sql." WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$log->logAction(USR_ACTION, LOG_INFO, "edited htpasswd for '" . $result['username'] . " (" . $result['path'] . ")'"); $log->logAction(USR_ACTION, LOG_INFO, "edited htpasswd for '" . $result['username'] . " (" . $result['path'] . ")'");
inserttask('1'); inserttask('1');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -251,13 +206,6 @@ elseif($page == 'htpasswds')
} }
$result = htmlentities_array($result); $result = htmlentities_array($result);
$htpasswd_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_edit.php';
$htpasswd_edit_form = htmlform::genHTMLForm($htpasswd_edit_data);
$title = $htpasswd_edit_data['htpasswd_edit']['title'];
$image = $htpasswd_edit_data['htpasswd_edit']['image'];
eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";"); eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";");
} }
} }
@@ -273,11 +221,10 @@ elseif($page == 'htaccess')
'options_indexes' => $lng['extras']['view_directory'], 'options_indexes' => $lng['extras']['view_directory'],
'error404path' => $lng['extras']['error404path'], 'error404path' => $lng['extras']['error404path'],
'error403path' => $lng['extras']['error403path'], 'error403path' => $lng['extras']['error403path'],
'error500path' => $lng['extras']['error500path'], 'error500path' => $lng['extras']['error500path']
'options_cgi' => $lng['extras']['execute_perl']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_HTACCESS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_HTACCESS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT * FROM `" . TABLE_PANEL_HTACCESS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `id`, `path`, `options_indexes`, `error404path`, `error403path`, `error500path` FROM `" . TABLE_PANEL_HTACCESS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -287,8 +234,6 @@ elseif($page == 'htaccess')
$count = 0; $count = 0;
$htaccess = ''; $htaccess = '';
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
while($row = $db->fetch_array($result)) while($row = $db->fetch_array($result))
{ {
if($paging->checkDisplay($i)) if($paging->checkDisplay($i))
@@ -296,14 +241,10 @@ elseif($page == 'htaccess')
if(strpos($row['path'], $userinfo['documentroot']) === 0) if(strpos($row['path'], $userinfo['documentroot']) === 0)
{ {
$row['path'] = substr($row['path'], strlen($userinfo['documentroot'])); $row['path'] = substr($row['path'], strlen($userinfo['documentroot']));
// don't show nothing wehn it's the docroot, show slash
if ($row['path'] == '') { $row['path'] = '/'; }
} }
$row['options_indexes'] = str_replace('1', $lng['panel']['yes'], $row['options_indexes']); $row['options_indexes'] = str_replace('1', $lng['panel']['yes'], $row['options_indexes']);
$row['options_indexes'] = str_replace('0', $lng['panel']['no'], $row['options_indexes']); $row['options_indexes'] = str_replace('0', $lng['panel']['no'], $row['options_indexes']);
$row['options_cgi'] = str_replace('1', $lng['panel']['yes'], $row['options_cgi']);
$row['options_cgi'] = str_replace('0', $lng['panel']['no'], $row['options_cgi']);
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$htaccess.=\"" . getTemplate("extras/htaccess_htaccess") . "\";"); eval("\$htaccess.=\"" . getTemplate("extras/htaccess_htaccess") . "\";");
$count++; $count++;
@@ -352,27 +293,34 @@ elseif($page == 'htaccess')
standard_error('invalidpath'); standard_error('invalidpath');
} }
if(isset($_POST['options_cgi']) if(($_POST['error404path'] === '')
&& (int)$_POST['options_cgi'] != 0 || (validateUrl($idna_convert->encode($_POST['error404path']))))
) { {
$options_cgi = '1'; $error404path = $_POST['error404path'];
} }
else else
{ {
$options_cgi = '0'; standard_error('mustbeurl');
} }
$error404path = ''; if(($_POST['error403path'] === '')
if (isset($_POST['error404path'])) { || (validateUrl($idna_convert->encode($_POST['error403path']))))
$error404path = correctErrorDocument($_POST['error404path']); {
$error403path = $_POST['error403path'];
} }
$error403path = ''; else
if (isset($_POST['error403path'])) { {
$error403path = correctErrorDocument($_POST['error403path']); standard_error('mustbeurl');
} }
$error500path = '';
if (isset($_POST['error500path'])) { if(($_POST['error500path'] === '')
$error500path = correctErrorDocument($_POST['error500path']); || (validateUrl($idna_convert->encode($_POST['error500path']))))
{
$error500path = $_POST['error500path'];
}
else
{
standard_error('mustbeurl');
} }
if($path_dupe_check['path'] == $path) if($path_dupe_check['path'] == $path)
@@ -385,15 +333,7 @@ elseif($page == 'htaccess')
} }
else else
{ {
$db->query('INSERT INTO `' . TABLE_PANEL_HTACCESS . '` SET $db->query('INSERT INTO `' . TABLE_PANEL_HTACCESS . '` (`customerid`, `path`, `options_indexes`, `error404path`, `error403path`, `error500path` ) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($path) . '", "' . $db->escape($_POST['options_indexes'] == '1' ? '1' : '0') . '", "' . $db->escape($error404path) . '", "' . $db->escape($error403path) . '", "' . $db->escape($error500path) . '" )');
`customerid` = "'.(int)$userinfo['customerid'].'",
`path` = "'.$db->escape($path).'",
`options_indexes` = "'.$db->escape($_POST['options_indexes'] == '1' ? '1' : '0').'",
`error404path` = "'.$db->escape($error404path).'",
`error403path` = "'.$db->escape($error403path).'",
`error500path` = "'.$db->escape($error500path).'",
`options_cgi` = "'.$db->escape($options_cgi).'"');
$log->logAction(USR_ACTION, LOG_INFO, "added htaccess for '" . $path . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added htaccess for '" . $path . "'");
inserttask('1'); inserttask('1');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -402,18 +342,7 @@ elseif($page == 'htaccess')
else else
{ {
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']); $options_indexes = makeyesno('options_indexes', '1', '0', '1');
/*
$options_indexes = makeyesno('options_indexes', '1', '0', '0');
$options_cgi = makeyesno('options_cgi', '1', '0', '0');
*/
$htaccess_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_add.php';
$htaccess_add_form = htmlform::genHTMLForm($htaccess_add_data);
$title = $htaccess_add_data['htaccess_add']['title'];
$image = $htaccess_add_data['htaccess_add']['image'];
eval("echo \"" . getTemplate("extras/htaccess_add") . "\";"); eval("echo \"" . getTemplate("extras/htaccess_add") . "\";");
} }
} }
@@ -430,30 +359,49 @@ elseif($page == 'htaccess')
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$option_indexes = intval($_POST['options_indexes']); $option_indexes = intval($_POST['options_indexes']);
$options_cgi = isset($_POST['options_cgi']) ? intval($_POST['options_cgi']) : 0;
if($option_indexes != '1') if($option_indexes != '1')
{ {
$option_indexes = '0'; $option_indexes = '0';
} }
if($options_cgi != '1') if(($_POST['error404path'] === '')
|| (validateUrl($idna_convert->encode($_POST['error404path']))))
{ {
$options_cgi = '0'; $error404path = $_POST['error404path'];
}
else
{
standard_error('mustbeurl');
} }
$error404path = correctErrorDocument($_POST['error404path']); if(($_POST['error403path'] === '')
$error403path = correctErrorDocument($_POST['error403path']); || (validateUrl($idna_convert->encode($_POST['error403path']))))
$error500path = correctErrorDocument($_POST['error500path']); {
$error403path = $_POST['error403path'];
}
else
{
standard_error('mustbeurl');
}
if(($_POST['error500path'] === '')
|| (validateUrl($idna_convert->encode($_POST['error500path']))))
{
$error500path = $_POST['error500path'];
}
else
{
standard_error('mustbeurl');
}
if(($option_indexes != $result['options_indexes']) if(($option_indexes != $result['options_indexes'])
|| ($error404path != $result['error404path']) || ($error404path != $result['error404path'])
|| ($error403path != $result['error403path']) || ($error403path != $result['error403path'])
|| ($error500path != $result['error500path']) || ($error500path != $result['error500path']))
|| ($options_cgi != $result['options_cgi']))
{ {
inserttask('1'); inserttask('1');
$db->query('UPDATE `' . TABLE_PANEL_HTACCESS . '` SET `options_indexes` = "' . $db->escape($option_indexes) . '", `error404path` = "' . $db->escape($error404path) . '", `error403path` = "' . $db->escape($error403path) . '", `error500path` = "' . $db->escape($error500path) . '", `options_cgi` = "' . $db->escape($options_cgi) . '" WHERE `customerid` = "' . (int)$userinfo['customerid'] . '" AND `id` = "' . (int)$id . '"'); $db->query('UPDATE `' . TABLE_PANEL_HTACCESS . '` SET `options_indexes` = "' . $db->escape($option_indexes) . '", `error404path` = "' . $db->escape($error404path) . '", `error403path` = "' . $db->escape($error403path) . '", `error500path` = "' . $db->escape($error500path) . '" WHERE `customerid` = "' . (int)$userinfo['customerid'] . '" AND `id` = "' . (int)$id . '"');
$log->logAction(USR_ACTION, LOG_INFO, "edited htaccess for '" . str_replace($userinfo['documentroot'], '', $result['path']) . "'"); $log->logAction(USR_ACTION, LOG_INFO, "edited htaccess for '" . str_replace($userinfo['documentroot'], '', $result['path']) . "'");
} }
@@ -464,26 +412,13 @@ elseif($page == 'htaccess')
if(strpos($result['path'], $userinfo['documentroot']) === 0) if(strpos($result['path'], $userinfo['documentroot']) === 0)
{ {
$result['path'] = substr($result['path'], strlen($userinfo['documentroot'])); $result['path'] = substr($result['path'], strlen($userinfo['documentroot']));
// don't show nothing wehn it's the docroot, show slash
if ($result['path'] == '') { $result['path'] = '/'; }
} }
$result['error404path'] = $result['error404path']; $result['error404path'] = $result['error404path'];
$result['error403path'] = $result['error403path']; $result['error403path'] = $result['error403path'];
$result['error500path'] = $result['error500path']; $result['error500path'] = $result['error500path'];
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
/*
$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']); $options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
*/
$result = htmlentities_array($result); $result = htmlentities_array($result);
$htaccess_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_edit.php';
$htaccess_edit_form = htmlform::genHTMLForm($htaccess_edit_data);
$title = $htaccess_edit_data['htaccess_edit']['title'];
$image = $htaccess_edit_data['htaccess_edit']['image'];
eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";"); eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,27 +22,34 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
$id = 0; require ("./lib/init.php");
if (isset($_POST['id'])) {
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
eval("echo \"" . getTemplate('ftp/ftp') . "\";"); eval("echo \"" . getTemplate("ftp/ftp") . "\";");
} elseif ($page == 'accounts') { }
if ($action == '') { elseif($page == 'accounts')
{
if($action == '')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
$fields = array( $fields = array(
'username' => $lng['login']['username'], 'username' => $lng['login']['username'],
'homedir' => $lng['panel']['path'] 'homedir' => $lng['panel']['path']
); );
$paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' AND `username` NOT LIKE '%_backup'" . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -52,18 +59,23 @@ if ($page == 'overview') {
$count = 0; $count = 0;
$accounts = ''; $accounts = '';
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($paging->checkDisplay($i)) { {
if (strpos($row['homedir'], $userinfo['documentroot']) === 0) { if($paging->checkDisplay($i))
{
if(strpos($row['homedir'], $userinfo['documentroot']) === 0)
{
$row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot'])); $row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot']));
} else { }
else
{
$row['documentroot'] = $row['homedir']; $row['documentroot'] = $row['homedir'];
} }
$row['documentroot'] = makeCorrectDir($row['documentroot']); $row['documentroot'] = makeCorrectDir($row['documentroot']);
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$accounts.=\"" . getTemplate('ftp/accounts_account') . "\";"); eval("\$accounts.=\"" . getTemplate("ftp/accounts_account") . "\";");
$count++; $count++;
} }
@@ -71,246 +83,163 @@ if ($page == 'overview') {
} }
$ftps_count = $db->num_rows($result); $ftps_count = $db->num_rows($result);
eval("echo \"" . getTemplate('ftp/accounts') . "\";"); eval("echo \"" . getTemplate("ftp/accounts") . "\";");
} elseif ($action == 'delete' && $id != 0) { }
elseif($action == 'delete'
&& $id != 0)
{
$result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if (isset($result['username']) if(isset($result['username'])
&& $result['username'] != $userinfo['loginname'] && $result['username'] != $userinfo['loginname'])
) { {
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'"); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'");
$result = $db->query_first("SELECT `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($result['username']) . "'");
$db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'");
$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$resetaccnumber = ($userinfo['ftps_used'] == '1') ? " , `ftp_lastaccountnumber`='0'" : ''; // $db->query("DELETE FROM `".TABLE_FTP_GROUPS."` WHERE `customerid`='".$userinfo['customerid']."' AND `id`='$id'");
// refs #293 if($userinfo['ftps_used'] == '1')
if (isset($_POST['delete_userfiles']) {
&& (int)$_POST['delete_userfiles'] == 1 $resetaccnumber = " , `ftp_lastaccountnumber`='0'";
) { }
inserttask('8', $userinfo['loginname'], $result['homedir']); else
{
$resetaccnumber = '';
} }
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else {
ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
} }
} else { else
{
ask_yesno('ftp_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
}
}
else
{
standard_error('ftp_cantdeletemainaccount'); standard_error('ftp_cantdeletemainaccount');
} }
} elseif ($action == 'add') { }
if ($userinfo['ftps_used'] < $userinfo['ftps'] elseif($action == 'add')
|| $userinfo['ftps'] == '-1' {
) { if($userinfo['ftps_used'] < $userinfo['ftps']
if (isset($_POST['send']) || $userinfo['ftps'] == '-1')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
// @FIXME use a good path-validating regex here (refs #1231) && $_POST['send'] == 'send')
{
$path = validate($_POST['path'], 'path'); $path = validate($_POST['path'], 'path');
$password = validate($_POST['ftp_password'], 'password'); $password = validate($_POST['ftp_password'], 'password');
$password = validatePassword($password);
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0; if($settings['customer']['ftpatdomain'] == '1')
if ($sendinfomail != 1) { {
$sendinfomail = 0;
}
if ($settings['customer']['ftpatdomain'] == '1') {
$ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/'); $ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
if ($ftpusername == '') { if($ftpusername == '')
{
standard_error(array('stringisempty', 'username')); standard_error(array('stringisempty', 'username'));
} }
$ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain')); $ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain'));
$ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'"); $ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if ($ftpdomain_check['domain'] != $ftpdomain) { if($ftpdomain_check['domain'] != $ftpdomain)
{
standard_error('maindomainnonexist', $domain); standard_error('maindomainnonexist', $domain);
} }
$username = $ftpusername . "@" . $ftpdomain; $username = $ftpusername . "@" . $ftpdomain;
} else { }
else
{
$username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1); $username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1);
} }
$username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\''); $username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\'');
if (!empty($username_check) && $username_check['username'] = $username) { if(!empty($username_check) && $username_check['username'] = $username)
{
standard_error('usernamealreadyexists', $username); standard_error('usernamealreadyexists', $username);
} elseif ($password == '') { }
elseif($password == '')
{
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
} elseif ($path == '') { }
elseif($path == '')
{
standard_error('patherror'); standard_error('patherror');
} else { }
else
{
$userpath = makeCorrectDir($path);
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
$cryptPassword = makeCryptPassword($password); $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
$result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'");
while ($row = $db->fetch_array($result)) {
$db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')");
}
$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'"); $db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'");
// $db->query("INSERT INTO `".TABLE_FTP_GROUPS."` (`customerid`, `groupname`, `gid`, `members`) VALUES ('".$userinfo['customerid']."', '$username', '$uid', '$username')");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`+1, `ftp_lastaccountnumber`=`ftp_lastaccountnumber`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`+1, `ftp_lastaccountnumber`=`ftp_lastaccountnumber`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
// $db->query("UPDATE `".TABLE_PANEL_SETTINGS."` SET `value`='$uid' WHERE settinggroup='ftp' AND varname='lastguid'");
$log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'"); $log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'");
inserttask(5); inserttask(5);
if ($sendinfomail == 1) {
$replace_arr = array(
'SALUTATION' => getCorrectUserSalutation($userinfo),
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
'USR_NAME' => $username,
'USR_PASS' => $password,
'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot'])))
);
$def_language = $userinfo['def_language'];
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_ftpaccount_by_customer_subject\'');
$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['ftp_add']['infomail_subject']), $replace_arr));
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_ftpaccount_by_customer_mailbody\'');
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['ftp_add']['infomail_body']['main']), $replace_arr));
$_mailerror = false;
try {
$mail->Subject = $mail_subject;
$mail->AltBody = $mail_body;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
$mail->AddAddress($userinfo['email'], getCorrectUserSalutation($userinfo));
$mail->Send();
} catch(phpmailerException $e) {
$mailerr_msg = $e->errorMessage();
$_mailerror = true;
} catch (Exception $e) {
$mailerr_msg = $e->getMessage();
$_mailerror = true;
}
if ($_mailerror) {
$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error('errorsendingmail', $userinfo['email']);
}
$mail->ClearAddresses();
}
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} else { }
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/'); else
{
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
if ($settings['customer']['ftpatdomain'] == '1') { if($settings['customer']['ftpatdomain'] == '1')
$domainlist = array(); {
$domains = ''; $domains = '';
$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
while ($row_domain = $db->fetch_array($result_domains)) { while($row_domain = $db->fetch_array($result_domains))
$domainlist[] = $row_domain['domain']; {
} $domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
sort($domainlist);
if (isset($domainlist[0]) && $domainlist[0] != '') {
foreach ($domainlist as $dom) {
$domains .= makeoption($idna_convert->decode($dom), $dom);
}
} }
} }
//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0'); eval("echo \"" . getTemplate("ftp/accounts_add") . "\";");
$ftp_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_add.php';
$ftp_add_form = htmlform::genHTMLForm($ftp_add_data);
$title = $ftp_add_data['ftp_add']['title'];
$image = $ftp_add_data['ftp_add']['image'];
eval("echo \"" . getTemplate('ftp/accounts_add') . "\";");
} }
} }
} elseif ($action == 'edit' && $id != 0) { }
$result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if (isset($result['username']) if(isset($result['username'])
&& $result['username'] != '' && $result['username'] != '')
) { {
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// @FIXME use a good path-validating regex here (refs #1231) $password = validate($_POST['ftp_password'], 'password');
$path = validate($_POST['path'], 'path');
$_setnewpass = false; if($password == '')
if (isset($_POST['ftp_password']) && $_POST['ftp_password'] != '') { {
$password = validate($_POST['ftp_password'], 'password'); standard_error(array('stringisempty', 'mypassword'));
$password = validatePassword($password); exit;
$_setnewpass = true;
} }
else
if ($_setnewpass) { {
if ($password == '') { $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
standard_error(array('stringisempty', 'mypassword')); $log->logAction(USR_ACTION, LOG_INFO, "edited ftp-account '" . $result['username'] . "'");
exit; redirectTo($filename, Array('page' => $page, 's' => $s));
}
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
$cryptPassword = makeCryptPassword($password);
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
// also update customers backup user password if password of main ftp user is changed
if(!preg_match('/' . $settings['customer']['ftpprefix'] . '/', $result['username'])){
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $result['username'] . "_backup'");
}
} }
}
if ($path != '') { else
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); {
eval("echo \"" . getTemplate("ftp/accounts_edit") . "\";");
if ($path != $result['homedir']) {
if (!file_exists($path)) {
// it's the task for "new ftp" but that will
// create all directories and correct their permissions
inserttask(5);
}
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `homedir`= '" . $db->escape($path) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
}
}
redirectTo($filename, Array('page' => $page, 's' => $s));
} else {
if (strpos($result['homedir'], $userinfo['documentroot']) === 0) {
$homedir = substr($result['homedir'], strlen($userinfo['documentroot']));
} else {
$homedir = $result['homedir'];
}
$homedir = makeCorrectDir($homedir);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir);
if ($settings['customer']['ftpatdomain'] == '1') {
$domains = '';
$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
while ($row_domain = $db->fetch_array($result_domains)) {
$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
}
}
$ftp_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_edit.php';
$ftp_edit_form = htmlform::genHTMLForm($ftp_edit_data);
$title = $ftp_edit_data['ftp_edit']['title'];
$image = $ftp_edit_data['ftp_edit']['image'];
eval("echo \"" . getTemplate('ftp/accounts_edit') . "\";");
} }
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,32 +22,40 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if ($action == 'logout') { require ("./lib/init.php");
$log->logAction(USR_ACTION, LOG_NOTICE, 'logged out');
$query = "DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'"; if($action == 'logout')
if ($settings['session']['allow_multiple_login'] == '1') { {
$query .= " AND `hash` = '" . $s . "'"; $log->logAction(USR_ACTION, LOG_NOTICE, "logged out");
if($settings['session']['allow_multiple_login'] == '1')
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0' AND `hash` = '" . $s . "'");
} }
$db->query($query); else
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'");
}
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index");
$domains = ''; $domains = '';
$result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' "); $result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' ");
$domainArray = array(); $domainArray = array();
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$domainArray[] = $idna_convert->decode($row['domain']); $domainArray[] = $idna_convert->decode($row['domain']);
} }
natsort($domainArray); natsort($domainArray);
$domains = implode(',<br />', $domainArray); $domains = implode(', ', $domainArray);
$userinfo['email'] = $idna_convert->decode($userinfo['email']); $userinfo['email'] = $idna_convert->decode($userinfo['email']);
$yesterday = time() - (60 * 60 * 24); $yesterday = time() - (60 * 60 * 24);
$month = date('M Y', $yesterday); $month = date('M Y', $yesterday);
@@ -59,7 +67,7 @@ if ($page == 'overview') {
$userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, $settings['panel']['decimal_places']); $userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
$userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']); $userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
$userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']); $userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']);
$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps tickets subdomains aps_packages'); $userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps tickets subdomains aps_packages');
$opentickets = 0; $opentickets = 0;
$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '` $opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
WHERE `customerid` = "' . $userinfo['customerid'] . '" WHERE `customerid` = "' . $userinfo['customerid'] . '"
@@ -69,49 +77,67 @@ if ($page == 'overview') {
$awaitingtickets = $opentickets['count']; $awaitingtickets = $opentickets['count'];
$awaitingtickets_text = ''; $awaitingtickets_text = '';
if ($opentickets > 0) { if($opentickets > 0)
{
$awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>')); $awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>'));
} }
eval("echo \"" . getTemplate('index/index') . "\";"); eval("echo \"" . getTemplate("index/index") . "\";");
} elseif ($page == 'change_password') { }
if (isset($_POST['send']) && $_POST['send'] == 'send') { elseif($page == 'change_password')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$old_password = validate($_POST['old_password'], 'old password'); $old_password = validate($_POST['old_password'], 'old password');
if (md5($old_password) != $userinfo['password']) {
if(md5($old_password) != $userinfo['password'])
{
standard_error('oldpasswordnotcorrect'); standard_error('oldpasswordnotcorrect');
exit; exit;
} }
$new_password = validatePassword($_POST['new_password'], 'new password'); $new_password = validate($_POST['new_password'], 'new password');
$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm'); $new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
if ($old_password == '') { if($old_password == '')
{
standard_error(array('stringisempty', 'oldpassword')); standard_error(array('stringisempty', 'oldpassword'));
} elseif($new_password == '') { }
elseif($new_password == '')
{
standard_error(array('stringisempty', 'newpassword')); standard_error(array('stringisempty', 'newpassword'));
} elseif($new_password_confirm == '') { }
elseif($new_password_confirm == '')
{
standard_error(array('stringisempty', 'newpasswordconfirm')); standard_error(array('stringisempty', 'newpasswordconfirm'));
} elseif($new_password != $new_password_confirm) { }
elseif($new_password != $new_password_confirm)
{
standard_error('newpasswordconfirmerror'); standard_error('newpasswordconfirmerror');
} else { }
else
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed password'); $log->logAction(USR_ACTION, LOG_NOTICE, 'changed password');
if (isset($_POST['change_main_ftp']) if(isset($_POST['change_main_ftp'])
&& $_POST['change_main_ftp'] == 'true' && $_POST['change_main_ftp'] == 'true')
) { {
$cryptPassword = makeCryptPassword($new_password); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($new_password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password'); $log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password');
} }
if (isset($_POST['change_webalizer']) if(isset($_POST['change_webalizer'])
&& $_POST['change_webalizer'] == 'true' && $_POST['change_webalizer'] == 'true')
) { {
if (CRYPT_STD_DES == 1) { if(CRYPT_STD_DES == 1)
{
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2); $saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
$new_webalizer_password = crypt($new_password, $saltfordescrypt); $new_webalizer_password = crypt($new_password, $saltfordescrypt);
} else { }
else
{
$new_webalizer_password = crypt($new_password); $new_webalizer_password = crypt($new_password);
} }
@@ -120,52 +146,39 @@ if ($page == 'overview') {
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} }
} else {
eval("echo \"" . getTemplate('index/change_password') . "\";");
} }
} elseif ($page == 'change_language') { else
if (isset($_POST['send']) && $_POST['send'] == 'send') { {
eval("echo \"" . getTemplate("index/change_password") . "\";");
}
}
elseif($page == 'change_language')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
if (isset($languages[$def_language])) {
if(isset($languages[$def_language]))
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'"); $db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
} }
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} else {
$default_lang = $settings['panel']['standardlanguage'];
if ($userinfo['def_language'] != '') {
$default_lang = $userinfo['def_language'];
}
$language_options = '';
while (list($language_file, $language_name) = each($languages)) {
$language_options .= makeoption($language_name, $language_file, $default_lang, true);
}
eval("echo \"" . getTemplate('index/change_language') . "\";");
} }
} elseif ($page == 'change_theme') { else
if (isset($_POST['send']) && $_POST['send'] == 'send') { {
$theme = validate($_POST['theme'], 'theme'); $language_options = '';
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); while(list($language_file, $language_name) = each($languages))
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'"); {
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'"); $language_options.= makeoption($language_name, $language_file, $userinfo['def_language'], true);
redirectTo($filename, Array('s' => $s));
} else {
$default_theme = $settings['panel']['default_theme'];
if ($userinfo['theme'] != '') {
$default_theme = $userinfo['theme'];
} }
$theme_options = ''; eval("echo \"" . getTemplate("index/change_language") . "\";");
$themes_avail = getThemes();
foreach ($themes_avail as $t) {
$theme_options .= makeoption($t, $t, $default_theme, true);
}
eval("echo \"" . getTemplate('index/change_theme') . "\";");
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,29 +22,36 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
$need_db_sql_data = true;
$need_root_db_sql_data = true;
require('./lib/init.php');
if (isset($_POST['id'])) { $need_root_db_sql_data = true;
require ("./lib/init.php");
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
$lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']); $lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']);
eval("echo \"" . getTemplate('mysql/mysql') . "\";"); eval("echo \"" . getTemplate("mysql/mysql") . "\";");
} elseif($page == 'mysqls') { }
if ($action == '') { elseif($page == 'mysqls')
{
if($action == '')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
$fields = array( $fields = array(
'databasename' => $lng['mysql']['databasename'], 'databasename' => $lng['mysql']['databasename'],
'description' => $lng['mysql']['databasedescription'] 'description' => $lng['mysql']['databasedescription']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_DATABASES, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_DATABASES, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT * FROM `" . TABLE_PANEL_DATABASES . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `id`, `databasename`, `description`, `dbserver` FROM `" . TABLE_PANEL_DATABASES . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -54,117 +61,114 @@ if ($page == 'overview') {
$count = 0; $count = 0;
$mysqls = ''; $mysqls = '';
// Begin root-session while($row = $db->fetch_array($result))
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], ''); {
while ($row = $db->fetch_array($result)) { if($paging->checkDisplay($i))
if ($paging->checkDisplay($i)) { {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$mbdata = $db_root->query_first("SELECT SUM( data_length + index_length) / 1024 / 1024 'MB' FROM information_schema.TABLES WHERE table_schema = '" . $db_root->escape($row['databasename']) . "' GROUP BY table_schema ;"); eval("\$mysqls.=\"" . getTemplate("mysql/mysqls_database") . "\";");
$row['size'] = number_format($mbdata['MB'], 3, '.', '');
eval("\$mysqls.=\"" . getTemplate('mysql/mysqls_database') . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
$db_root->close();
// End root-session
$mysqls_count = $db->num_rows($result); $mysqls_count = $db->num_rows($result);
eval("echo \"" . getTemplate('mysql/mysqls') . "\";"); eval("echo \"" . getTemplate("mysql/mysqls") . "\";");
} elseif($action == 'delete' && $id != 0) { }
$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); elseif($action == 'delete'
&& $id != 0)
{
$result = $db->query_first('SELECT `id`, `databasename`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
if (isset($result['databasename']) if(isset($result['databasename'])
&& $result['databasename'] != '' && $result['databasename'] != '')
) { {
if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) { if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
{
$result['dbserver'] = 0; $result['dbserver'] = 0;
} }
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// Begin root-session // Begin root-session
$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
$log->logAction(USR_ACTION, LOG_INFO, "deleted database '" . $result['databasename'] . "'");
if (mysql_get_server_info() < '5.0.2') {
// Revoke privileges (only required for MySQL 4.1.2 - 5.0.1)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($result['databasename']) .'\'',false,true);
}
$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($result['databasename']) . "'"); $db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
while ($host = $db_root->fetch_array($host_res)) { unset($db_root->password);
// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+) foreach(array_map('trim', array_unique(explode(',', $settings['system']['mysql_access_host']))) as $mysql_access_host)
$db_root->query('DROP USER \'' . $db_root->escape($result['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true); {
$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($result['databasename'])) . '` . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($result['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
} }
$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`'); $db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`');
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session // End root-session
$db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
$resetaccnumber = ($userinfo['mysqls_used'] == '1') ? " , `mysql_lastaccountnumber`='0' " : ''; if($userinfo['mysqls_used'] == '1')
{
$resetaccnumber = " , `mysql_lastaccountnumber`='0' ";
}
else
{
$resetaccnumber = '';
}
$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
$dbnamedesc = $result['databasename']; else
if (isset($result['description']) && $result['description'] != '') { {
$dbnamedesc .= ' ('.$result['description'].')'; ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['databasename']);
}
ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc);
} }
} }
} elseif ($action == 'add') { }
if ($userinfo['mysqls_used'] < $userinfo['mysqls'] elseif($action == 'add')
|| $userinfo['mysqls'] == '-1' {
) { if($userinfo['mysqls_used'] < $userinfo['mysqls']
if (isset($_POST['send']) || $userinfo['mysqls'] == '-1')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$password = validate($_POST['mysql_password'], 'password'); $password = validate($_POST['mysql_password'], 'password');
$password = validatePassword($password);
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0; if($password == '')
if ($sendinfomail != 1) { {
$sendinfomail = 0;
}
if ($password == '') {
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
} else { }
$dbserver = 0; else
if (count($sql_root) > 1) { {
$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
if(count($sql_root) > 1)
{
$dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0); $dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0);
if (!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver])) {
if(!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver]))
{
$dbserver = 0; $dbserver = 0;
} }
} }
else
// validate description before actual adding the database, #1052 {
$databasedescription = validate(trim($_POST['description']), 'description'); $dbserver = 0;
// Begin root-session
$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
if (strtoupper($settings['customer']['mysqlprefix']) == 'RANDOM') {
$result = $db_root->query('SELECT `User` FROM mysql.user');
while ($row = $db_root->fetch_array($result)) {
$allsqlusers[] = $row[User];
}
$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
while (in_array($username , $allsqlusers)) {
$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
}
} else {
$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
} }
// Begin root-session
$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
unset($db_root->password);
$db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`'); $db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`');
$log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'"); $log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'");
foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) { foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\''); $db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\'');
$db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')'); $db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
$log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'");
@@ -172,121 +176,79 @@ if ($page == 'overview') {
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session
// Statement modified for Database description -- PH 2004-11-29 // End root-session
// Statement modifyed for Database description -- PH 2004-11-29
$databasedescription = validate($_POST['description'], 'description');
$result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")'); $result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")');
$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
if ($sendinfomail == 1) {
$pma = $lng['admin']['notgiven'];
if ($settings['panel']['phpmyadmin_url'] != '') {
$pma = $settings['panel']['phpmyadmin_url'];
}
$replace_arr = array(
'SALUTATION' => getCorrectUserSalutation($userinfo),
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
'DB_NAME' => $username,
'DB_PASS' => $password,
'DB_DESC' => $databasedescription,
'DB_SRV' => $sql_root[$dbserver]['host'],
'PMA_URI' => $pma
);
$def_language = $userinfo['def_language'];
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_database_by_customer_subject\'');
$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['mysql_add']['infomail_subject']), $replace_arr));
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_database_by_customer_mailbody\'');
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['mysql_add']['infomail_body']['main']), $replace_arr));
$_mailerror = false;
try {
$mail->Subject = $mail_subject;
$mail->AltBody = $mail_body;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
$mail->AddAddress($userinfo['email'], getCorrectUserSalutation($userinfo));
$mail->Send();
} catch(phpmailerException $e) {
$mailerr_msg = $e->errorMessage();
$_mailerror = true;
} catch (Exception $e) {
$mailerr_msg = $e->getMessage();
$_mailerror = true;
}
if ($_mailerror) {
$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error('errorsendingmail', $userinfo['email']);
}
$mail->ClearAddresses();
}
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} else { }
else
{
$mysql_servers = ''; $mysql_servers = '';
foreach ($sql_root as $mysql_server => $mysql_server_details) { foreach($sql_root as $mysql_server => $mysql_server_details)
{
$mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server); $mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server);
} }
//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0'); eval("echo \"" . getTemplate("mysql/mysqls_add") . "\";");
$mysql_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_add.php';
$mysql_add_form = htmlform::genHTMLForm($mysql_add_data);
$title = $mysql_add_data['mysql_add']['title'];
$image = $mysql_add_data['mysql_add']['image'];
eval("echo \"" . getTemplate('mysql/mysqls_add') . "\";");
} }
} }
} elseif ($action == 'edit' && $id != 0) { }
elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"'); $result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"');
if (isset($result['databasename']) if(isset($result['databasename'])
&& $result['databasename'] != '' && $result['databasename'] != '')
) { {
if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) { if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
{
$result['dbserver'] = 0; $result['dbserver'] = 0;
} }
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29 // Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29
$password = validate($_POST['mysql_password'], 'password');
if ($password != '') {
// validate password
$password = validatePassword($password);
$password = validate($_POST['mysql_password'], 'password');
if($password != '')
{
// Begin root-session // Begin root-session
$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], ''); $db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) { unset($db_root->password);
foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')'); $db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
} }
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session // End root-session
} }
// Update the Database description -- PH 2004-11-29 // Update the Database description -- PH 2004-11-29
$log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'");
$databasedescription = validate($_POST['description'], 'description'); $databasedescription = validate($_POST['description'], 'description');
$result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
$mysql_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_edit.php'; else
$mysql_edit_form = htmlform::genHTMLForm($mysql_edit_data); {
eval("echo \"" . getTemplate("mysql/mysqls_edit") . "\";");
$title = $mysql_edit_data['mysql_edit']['title'];
$image = $mysql_edit_data['mysql_edit']['image'];
eval("echo \"" . getTemplate('mysql/mysqls_edit') . "\";");
} }
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -28,17 +28,6 @@ require ("./lib/init.php");
if(isset($_POST['id'])) if(isset($_POST['id']))
{ {
$id = intval($_POST['id']); $id = intval($_POST['id']);
/*
* Check if the current user is allowed to see the current ticket.
*/
$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `customerid` = '".$userinfo['customerid']."'";
$result = $db->query_first($sql);
if ($result == null) {
// no rights to see the requested ticket
standard_error(array('ticketnotaccessible'));
}
} }
elseif(isset($_GET['id'])) elseif(isset($_GET['id']))
{ {
@@ -48,7 +37,7 @@ elseif(isset($_GET['id']))
if($page == 'overview') if($page == 'overview')
{ {
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets");
eval("echo \"" . getTemplate("tickets/ticket") . "\";"); eval("echo \"" . getTemplate("ticket/ticket") . "\";");
} }
elseif($page == 'tickets') elseif($page == 'tickets')
{ {
@@ -66,7 +55,7 @@ elseif($page == 'tickets')
$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$paging->sortfield = 'lastchange'; $paging->sortfield = 'lastchange';
$paging->sortorder = 'desc'; $paging->sortorder = 'desc';
$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" AND `adminid`="' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -109,13 +98,12 @@ elseif($page == 'tickets')
$cananswer = 0; $cananswer = 0;
} }
$row['subject'] = html_entity_decode($row['subject']);
if(strlen($row['subject']) > 20) if(strlen($row['subject']) > 20)
{ {
$row['subject'] = substr($row['subject'], 0, 17) . '...'; $row['subject'] = substr($row['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
$count++; $count++;
} }
@@ -168,7 +156,7 @@ elseif($page == 'tickets')
} }
$ticketsopen = (int)$opentickets['count']; $ticketsopen = (int)$opentickets['count'];
eval("echo \"" . getTemplate("tickets/tickets") . "\";"); eval("echo \"" . getTemplate("ticket/tickets") . "\";");
} }
elseif($action == 'new') elseif($action == 'new')
{ {
@@ -221,12 +209,12 @@ elseif($page == 'tickets')
else else
{ {
$categories = ''; $categories = '';
$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC'); $result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
if(isset($result['name']) if(isset($result['name'])
&& $result['name'] != '') && $result['name'] != '')
{ {
$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC'); $result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
while($row = $db->fetch_array($result2)) while($row = $db->fetch_array($result2))
{ {
@@ -238,9 +226,9 @@ elseif($page == 'tickets')
$categories = makeoption($lng['ticket']['no_cat'], '0'); $categories = makeoption($lng['ticket']['no_cat'], '0');
} }
$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']); $priorities = makeoption($lng['ticket']['unf_high'], '1');
$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_normal'], '2');
$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_low'], '3');
$ticketsopen = 0; $ticketsopen = 0;
$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '` $opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
WHERE `customerid` = "' . $userinfo['customerid'] . '" WHERE `customerid` = "' . $userinfo['customerid'] . '"
@@ -258,14 +246,7 @@ elseif($page == 'tickets')
} }
$ticketsopen = (int)$opentickets['count']; $ticketsopen = (int)$opentickets['count'];
eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
$ticket_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_add.php';
$ticket_add_form = htmlform::genHTMLForm($ticket_add_data);
$title = $ticket_add_data['ticket_add']['title'];
$image = $ticket_add_data['ticket_add']['image'];
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
} }
} }
else else
@@ -340,18 +321,12 @@ elseif($page == 'tickets')
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = getCorrectFullUserDetails($usr);
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -368,13 +343,12 @@ elseif($page == 'tickets')
} }
else else
{ {
$by = getCorrectFullUserDetails($usr); $by = $lng['ticket']['customer'];
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -385,13 +359,7 @@ elseif($page == 'tickets')
// don't forget the main-ticket! // don't forget the main-ticket!
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_reply.php'; eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
$title = $ticket_reply_data['ticket_reply']['title'];
$image = $ticket_reply_data['ticket_reply']['image'];
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
} }
} }
elseif($action == 'close' elseif($action == 'close'

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,20 +22,21 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
$intrafficpage = 1;
require('./lib/init.php'); require ("./lib/init.php");
$traffic = ''; $traffic = '';
$month = null; $month = null;
$year = null; $year = null;
if (isset($_POST['month']) if(isset($_POST['month'])
&& isset($_POST['year']) && isset($_POST['year']))
) { {
$month = intval($_POST['month']); $month = intval($_POST['month']);
$year = intval($_POST['year']); $year = intval($_POST['year']);
} elseif (isset($_GET['month']) }
&& isset($_GET['year']) elseif(isset($_GET['month'])
) { && isset($_GET['year']))
{
$month = intval($_GET['month']); $month = intval($_GET['month']);
$year = intval($_GET['year']); $year = intval($_GET['year']);
} }
@@ -43,25 +44,39 @@ if (isset($_POST['month'])
//BAM! $_GET??? //BAM! $_GET???
elseif (isset($_GET['page']) elseif (isset($_GET['page'])
&& $_GET['page'] == 'current' && $_GET['page'] == "current")
) { {
if (date('d') != '01') { if(date('d') != '01')
{
$month = date('m'); $month = date('m');
$year = date('Y'); $year = date('Y');
} else { }
if (date('m') == '01') { else
{
if(date('m') == '01')
{
$month = 12; $month = 12;
$year = date('Y') - 1; $year = date('Y') - 1;
} else { }
else
{
$month = date('m') - 1; $month = date('m') - 1;
$year = date('Y'); $year = date('Y');
} }
} }
} }
if (!is_null($month) if(!is_null($month)
&& !is_null($year)) { && !is_null($year))
{
$traf['byte'] = 0; $traf['byte'] = 0;
$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid`='" . $userinfo['customerid'] . "'
AND `month` = '" . $month . "'
AND `year` = '" . $year . "'");
rsort($row = mysql_fetch_row($result));
$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));;
$result = $db->query("SELECT $result = $db->query("SELECT
SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail', SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail',
`day`, `month`, `year` `day`, `month`, `year`
@@ -74,50 +89,101 @@ if (!is_null($month)
$traffic_complete['mail'] = 0; $traffic_complete['mail'] = 0;
$show = ''; $show = '';
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$http = $row['http']; $http = $row['http'];
$ftp = $row['ftp_up'] + $row['ftp_down']; $ftp = $row['ftp_up'] + $row['ftp_down'];
$mail = $row['mail']; $mail = $row['mail'];
$traf['byte'] = $http + $ftp + $mail; $traf['byte'] = $http + $ftp + $mail;
$traffic_complete['http'] += $http; $traffic_complete['http']+= $http;
$traffic_complete['ftp'] += $ftp; $traffic_complete['ftp']+= $ftp;
$traffic_complete['mail'] += $mail; $traffic_complete['mail']+= $mail;
$traf['day'] = $row['day'] . '.'; $traf['day'] = $row['day'];
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['ftp'] = bcdiv($ftp, 1024, $settings['panel']['decimal_places']); }
$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']); else
$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']); {
$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
} else {
$traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['http'] = round($http, $settings['panel']['decimal_places']); }
$traf['ftp'] = round($ftp, $settings['panel']['decimal_places']);
$traf['mail'] = round($mail, $settings['panel']['decimal_places']); if($traf['byte'] != 0
&& $traf['max'] != 0)
{
$proz = $traf['max'] / 100;
$traf['http'] = round($http / $proz, 0);
$traf['ftp'] = round($ftp / $proz, 0);
$traf['mail'] = round($mail / $proz, 0);
if($traf['http'] == 0)
{
$traf['http'] = 1;
}
if($traf['ftp'] == 0)
{
$traf['ftp'] = 1;
}
if($traf['mail'] == 0)
{
$traf['mail'] = 1;
}
}
else
{
$traf['http'] = 0;
$traf['ftp'] = 0;
$traf['mail'] = 0;
}
if(extension_loaded('bcmath'))
{
$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
}
else
{
$traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']); $traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']);
} }
eval("\$traffic.=\"" . getTemplate('traffic/traffic_month') . "\";"); eval("\$traffic.=\"" . getTemplate("traffic/traffic_month") . "\";");
$show = $lng['traffic']['months'][intval($row['month'])] . ' ' . $row['year']; $show = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
} }
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']);
} else { }
else
{
$traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']);
} }
eval("echo \"" . getTemplate('traffic/traffic_details') . "\";"); eval("echo \"" . getTemplate("traffic/traffic_details") . "\";");
} else { }
else
{
$result = $db->query("(SELECT SUM(`http`) as sum FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid` = '" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12) UNION
(SELECT SUM(`ftp_up`+`ftp_down`) FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid` = '" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12) UNION
(SELECT SUM(`mail`) FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid` = '" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12) ORDER BY sum DESC LIMIT 1");
$row = $db->fetch_array($result);
$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));;
$result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail $result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail
FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "' FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12"); GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
@@ -125,49 +191,88 @@ if (!is_null($month)
$traffic_complete['ftp'] = 0; $traffic_complete['ftp'] = 0;
$traffic_complete['mail'] = 0; $traffic_complete['mail'] = 0;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$http = $row['http']; $http = $row['http'];
$ftp_up = $row['ftp_up']; $ftp_up = $row['ftp_up'];
$ftp_down = $row['ftp_down']; $ftp_down = $row['ftp_down'];
$mail = $row['mail']; $mail = $row['mail'];
$traffic_complete['http'] += $http; $traffic_complete['http']+= $http;
$traffic_complete['ftp'] += $ftp_up + $ftp_down; $traffic_complete['ftp']+= $ftp_up + $ftp_down;
$traffic_complete['mail'] += $mail; $traffic_complete['mail']+= $mail;
$traf['month'] = $row['month']; $traf['month'] = $row['month'];
$traf['year'] = $row['year']; $traf['year'] = $row['year'];
$traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year']; $traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
$traf['byte'] = $http + $ftp_up + $ftp_down + $mail; $traf['byte'] = $http + $ftp_up + $ftp_down + $mail;
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
$traf['ftptext'] = bcdiv($ftp_up, 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($ftp_down, 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; {
$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['ftptext'] = bcdiv($ftp_up, 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . bcdiv($ftp_down, 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['httptext'] = bcdiv($http, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
$traf['ftp'] = bcdiv(($ftp_up + $ftp_down), 1024, $settings['panel']['decimal_places']); $traf['mailtext'] = bcdiv($mail, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']); }
$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']); else
$traf['byte'] = bcdiv($traf['byte'], 1024 * 1024, $settings['panel']['decimal_places']); {
} else { $traf['ftptext'] = round($ftp_up / 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . round($ftp_down / 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
$traf['ftptext'] = round($ftp_up / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($ftp_down / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['httptext'] = round($http / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['mailtext'] = round($mail / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['ftp'] = round(($ftp_up + $ftp_down) / 1024, $settings['panel']['decimal_places']);
$traf['http'] = round($http / 1024, $settings['panel']['decimal_places']);
$traf['mail'] = round($mail / 1024, $settings['panel']['decimal_places']);
$traf['byte'] = round($traf['byte'] / (1024 * 1024), $settings['panel']['decimal_places']);
} }
eval("\$traffic.=\"" . getTemplate('traffic/traffic_traffic') . "\";"); if($traf['max'] != 0)
{
$proz = $traf['max'] / 100;
$traf['ftp'] = round(($ftp_up + $ftp_down) / $proz, 0);
$traf['http'] = round($http / $proz, 0);
$traf['mail'] = round($mail / $proz, 0);
if($traf['http'] == 0)
{
$traf['http'] = 1;
}
if($traf['ftp'] == 0)
{
$traf['ftp'] = 1;
}
if($traf['mail'] == 0)
{
$traf['mail'] = 1;
}
}
else
{
$traf['ftp'] = 0;
$traf['http'] = 0;
$traf['mail'] = 0;
}
if(extension_loaded('bcmath'))
{
$traf['byte'] = bcadd($traf['byte'] / (1024 * 1024), 0.0000, 4);
}
else
{
$traf['byte'] = round($traf['byte'] + (1024 * 1024), 4);
}
eval("\$traffic.=\"" . getTemplate("traffic/traffic_traffic") . "\";");
} }
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']);
} else { }
$traffic_complete['http'] = round($traffic_complete['http'] / (1024 * 1024), $settings['panel']['decimal_places']); else
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / (1024 * 1024), $settings['panel']['decimal_places']); {
$traffic_complete['mail'] = round($traffic_complete['mail'] / (1024 * 1024), $settings['panel']['decimal_places']); $traffic_complete['http'] = round($traffic_complete['http'] / 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024 * 1024, $settings['panel']['decimal_places']);
} }
eval("echo \"" . getTemplate('traffic/traffic') . "\";"); eval("echo \"" . getTemplate("traffic/traffic") . "\";");
} }
?>

BIN
images/ball.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 51 B

BIN
images/changelanguage.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.8 KiB

BIN
images/default.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.6 KiB

BIN
images/endsection.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.3 KiB

BIN
images/error.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.3 KiB

BIN
images/error.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.7 KiB

BIN
images/footer.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 21 KiB

BIN
images/header.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 16 KiB

BIN
images/header_r.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.2 KiB

BIN
images/info.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 2.9 KiB

BIN
images/login.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 2.0 KiB

BIN
images/logininternal.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.8 KiB

BIN
images/order_asc.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 62 B

BIN
images/order_desc.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 60 B

BIN
images/section.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.3 KiB

BIN
images/shadow.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 86 B

BIN
images/subsection.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 3.6 KiB

BIN
images/title.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 69 B

View File

Before

Width:  |  Height:  |  Size: 66 B

After

Width:  |  Height:  |  Size: 66 B

View File

Before

Width:  |  Height:  |  Size: 82 B

After

Width:  |  Height:  |  Size: 82 B

View File

Before

Width:  |  Height:  |  Size: 105 B

After

Width:  |  Height:  |  Size: 105 B

View File

Before

Width:  |  Height:  |  Size: 827 B

After

Width:  |  Height:  |  Size: 827 B

367
index.php
View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'login'); define('AREA', 'login');
@@ -22,74 +22,69 @@ define('AREA', 'login');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require ('./lib/init.php');
if ($action == '') { require ("./lib/init.php");
if($action == '')
{
$action = 'login'; $action = 'login';
} }
if ($action == 'login') { if($action == 'login')
if (isset($_POST['send']) {
&& $_POST['send'] == 'send' if(isset($_POST['send'])
) { && $_POST['send'] == 'send')
{
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$password = validate($_POST['password'], 'password'); $password = validate($_POST['password'], 'password');
$row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($row['customer'] == $loginname) { if($row['customer'] == $loginname)
{
$table = "`" . TABLE_PANEL_CUSTOMERS . "`"; $table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid'; $uid = 'customerid';
$adminsession = '0'; $adminsession = '0';
$is_admin = false; $is_admin = false;
} else { }
else
{
$is_admin = true; $is_admin = true;
if ((int)$settings['login']['domain_login'] == 1) {
/**
* check if the customer tries to login with a domain, #374
*/
$domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname));
$row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'");
if (isset($row2['customerid']) && $row2['customerid'] > 0) {
$loginname = getCustomerDetail($row2['customerid'], 'loginname');
if ($loginname !== false) {
$row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($row3['customer'] == $loginname) {
$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid';
$adminsession = '0';
$is_admin = false;
}
}
}
}
} }
if (hasUpdates($version) && $is_admin == false) { if(hasUpdates($version) && $is_admin == false)
{
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
if ($is_admin) { if($is_admin)
if (hasUpdates($version)) { {
if(hasUpdates($version))
{
$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'"); $row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'");
/* /*
* not an admin who can see updates * not an admin who can see updates
*/ */
if (!isset($row['admin'])) { if(!isset($row['admin']))
{
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
} else { }
else
{
$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
} }
if ($row['admin'] == $loginname) { if($row['admin'] == $loginname)
{
$table = "`" . TABLE_PANEL_ADMINS . "`"; $table = "`" . TABLE_PANEL_ADMINS . "`";
$uid = 'adminid'; $uid = 'adminid';
$adminsession = '1'; $adminsession = '1';
} else { }
else
{
redirectTo('index.php', Array('showmessage' => '2'), true); redirectTo('index.php', Array('showmessage' => '2'), true);
exit; exit;
} }
@@ -97,240 +92,224 @@ if ($action == 'login') {
$userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'"); $userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts'] if($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']) && $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']))
) { {
redirectTo('index.php', Array('showmessage' => '3'), true); redirectTo('index.php', Array('showmessage' => '3'), true);
exit; exit;
} elseif($userinfo['password'] == md5($password)) { }
elseif($userinfo['password'] == md5($password))
{
// login correct // login correct
// reset loginfail_counter, set lastlogin_succ // reset loginfail_counter, set lastlogin_succ
$db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'"); $db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
$userinfo['userid'] = $userinfo[$uid]; $userinfo['userid'] = $userinfo[$uid];
$userinfo['adminsession'] = $adminsession; $userinfo['adminsession'] = $adminsession;
} else { }
else
{
// login incorrect // login incorrect
$db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'"); $db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
unset($userinfo); unset($userinfo);
redirectTo('index.php', Array('showmessage' => '2'), true); redirectTo('index.php', Array('showmessage' => '2'), true);
exit; exit;
} }
if (isset($userinfo['userid']) if(isset($userinfo['userid'])
&& $userinfo['userid'] != '' && $userinfo['userid'] != '')
) { {
$s = md5(uniqid(microtime(), 1)); $s = md5(uniqid(microtime(), 1));
if (isset($_POST['language'])) { if(isset($_POST['language']))
{
$language = validate($_POST['language'], 'language'); $language = validate($_POST['language'], 'language');
if ($language == 'profile') {
if($language == 'profile')
{
$language = $userinfo['def_language']; $language = $userinfo['def_language'];
} elseif(!isset($languages[$language])) { }
elseif(!isset($languages[$language]))
{
$language = $settings['panel']['standardlanguage']; $language = $settings['panel']['standardlanguage'];
} }
} else { }
else
{
$language = $settings['panel']['standardlanguage']; $language = $settings['panel']['standardlanguage'];
} }
if (isset($userinfo['theme']) && $userinfo['theme'] != '') { if($settings['session']['allow_multiple_login'] != '1')
$theme = $userinfo['theme']; {
} else {
$theme = $settings['panel']['default_theme'];
}
if ($settings['session']['allow_multiple_login'] != '1') {
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'");
} }
// check for field 'theme' in session-table, refs #607 $db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
$fields = mysql_list_fields($db->getDbName(), TABLE_PANEL_SESSIONS);
$columns = mysql_num_fields($fields);
$field_array = array();
for ($i = 0; $i < $columns; $i++) {
$field_array[] = mysql_field_name($fields, $i);
}
if (!in_array('theme', $field_array)) { if($userinfo['adminsession'] == '1')
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')"); {
} else { if(hasUpdates($version))
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "', '" . $db->escape($theme) . "')"); {
}
if ($userinfo['adminsession'] == '1') {
if (hasUpdates($version)) {
redirectTo('admin_updates.php', Array('s' => $s), true); redirectTo('admin_updates.php', Array('s' => $s), true);
} else { exit;
redirectTo('admin_index.php', Array('s' => $s), true); }
else
{
redirectTo('admin_index.php', Array('s' => $s), true);
exit;
} }
} else {
redirectTo('customer_index.php', Array('s' => $s), true);
} }
} else { else
redirectTo('index.php', Array('showmessage' => '2'), true); {
redirectTo('customer_index.php', Array('s' => $s), true);
exit;
}
} }
exit; else
} else { {
redirectTo('index.php', Array('showmessage' => '2'), true);
exit;
}
}
else
{
$language_options = ''; $language_options = '';
$language_options .= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true); $language_options.= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
while (list($language_file, $language_name) = each($languages)) { while(list($language_file, $language_name) = each($languages))
$language_options .= makeoption($language_name, $language_file, 'profile', true); {
$language_options.= makeoption($language_name, $language_file, 'profile', true);
} }
$smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0; $smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0;
$message = ''; $message = '';
$successmessage = '';
switch ($smessage) { switch($smessage)
{
case 1: case 1:
$successmessage = $lng['pwdreminder']['success']; $message = $lng['pwdreminder']['success'];
break; break;
case 2: case 2:
$message = $lng['error']['login']; $message = $lng['error']['login'];
break; break;
case 3: case 3:
$message = sprintf($lng['error']['login_blocked'],$settings['login']['deactivatetime']); $message = $lng['error']['login_blocked'];
break; break;
case 4: case 4:
$cmail = isset($_GET['customermail']) ? $_GET['customermail'] : 'unknown'; $message = $lng['error']['errorsendingmail'];
$message = str_replace('%s', $cmail, $lng['error']['errorsendingmail']);
break;
case 5:
$message = $lng['error']['user_banned'];
break; break;
} }
$update_in_progress = ''; $update_in_progress = '';
if (hasUpdates($version)) { if(hasUpdates($version))
{
$update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin']; $update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin'];
} }
eval("echo \"" . getTemplate('login') . "\";"); eval("echo \"" . getTemplate("login") . "\";");
} }
} }
if ($action == 'forgotpwd') { if($action == 'forgotpwd')
$adminchecked = false; {
$message = ''; if(isset($_POST['send'])
&& $_POST['send'] == 'send')
if (isset($_POST['send']) {
&& $_POST['send'] == 'send' $adminchecked = false;
) {
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$email = validateEmail($_POST['loginemail'], 'email'); $email = validateEmail($_POST['loginemail'], 'email');
$sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_CUSTOMERS . "` $sql = "SELECT `customerid`, `firstname`, `name`, `email`, `loginname` FROM `" . TABLE_PANEL_CUSTOMERS . "`
WHERE `loginname`='" . $db->escape($loginname) . "' WHERE `loginname`='" . $db->escape($loginname) . "'
AND `email`='" . $db->escape($email) . "'"; AND `email`='" . $db->escape($email) . "'";
$result = $db->query($sql); $result = $db->query($sql);
if ($db->num_rows() == 0) { if($db->num_rows() == 0)
$sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "` {
$sql = "SELECT `adminid`, `firstname`, `name`, `email`, `loginname` FROM `" . TABLE_PANEL_ADMINS . "`
WHERE `loginname`='" . $db->escape($loginname) . "' WHERE `loginname`='" . $db->escape($loginname) . "'
AND `email`='" . $db->escape($email) . "'"; AND `email`='" . $db->escape($email) . "'";
$result = $db->query($sql); $result = $db->query($sql);
$adminchecked = true;
if ($db->num_rows() > 0) {
$adminchecked = true;
} else {
$result = null;
}
} }
if ($result !== null) { $user = $db->fetch_array($result);
$user = $db->fetch_array($result);
/* Check whether user is banned */ if(($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
if ($user['deactivated']) { || $adminchecked == false)
$message = $lng['pwdreminder']['notallowed']; {
redirectTo('index.php', Array('showmessage' => '5'), true); if($user !== false)
} {
$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
if (($adminchecked && $settings['panel']['allow_preset_admin'] == '1') if($adminchecked)
|| $adminchecked == false {
) { $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `password`='" . md5($password) . "'
if ($user !== false) { WHERE `loginname`='" . $user['loginname'] . "'
if ($settings['panel']['password_min_length'] <= 6) { AND `email`='" . $user['email'] . "'");
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); }
} else { else
// make it two times larger than password_min_length {
$rnd = ''; $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($password) . "'
$minlength = $settings['panel']['password_min_length'];
while (strlen($rnd) < ($minlength * 2)) {
$rnd .= md5(uniqid(microtime(), 1));
}
$password = substr($rnd, (int)($minlength / 2), $minlength);
}
$passwordTable = $adminchecked ? TABLE_PANEL_ADMINS : TABLE_PANEL_CUSTOMERS;
$db->query("UPDATE `" . $passwordTable . "` SET `password`='" . md5($password) . "'
WHERE `loginname`='" . $user['loginname'] . "' WHERE `loginname`='" . $user['loginname'] . "'
AND `email`='" . $user['email'] . "'"); AND `email`='" . $user['email'] . "'");
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
$replace_arr = array(
'SALUTATION' => getCorrectUserSalutation($user),
'USERNAME' => $user['loginname'],
'PASSWORD' => $password
);
$body = strtr($lng['pwdreminder']['body'], array('%s' => $user['firstname'] . ' ' . $user['name'], '%p' => $password));
$def_language = ($user['def_language'] != '') ? $user['def_language'] : $settings['panel']['standardlanguage'];
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$user['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'password_reset_subject\'');
$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['pwdreminder']['subject']), $replace_arr));
$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$user['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'password_reset_mailbody\'');
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $body), $replace_arr));
$_mailerror = false;
try {
$mail->Subject = $mail_subject;
$mail->AltBody = $mail_body;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
$mail->AddAddress($user['email'], $user['firstname'] . ' ' . $user['name']);
$mail->Send();
} catch(phpmailerException $e) {
$mailerr_msg = $e->errorMessage();
$_mailerror = true;
} catch (Exception $e) {
$mailerr_msg = $e->getMessage();
$_mailerror = true;
}
if ($_mailerror) {
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
redirectTo('index.php', Array('showmessage' => '4', 'customermail' => $user['email']), true);
exit;
}
$mail->ClearAddresses();
redirectTo('index.php', Array('showmessage' => '1'), true);
exit;
} else {
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
$message = $lng['login']['combination_not_found'];
} }
unset($user); $rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
$body = strtr($lng['pwdreminder']['body'], array('%s' => $user['firstname'] . ' ' . $user['name'], '%p' => $password));
$mail->From = $settings['panel']['adminmail'];
$mail->FromName = 'Froxlor';
$mail->Subject = $lng['pwdreminder']['subject'];
$mail->Body = $body;
$mail->AddAddress($user['email'], $user['firstname'] . ' ' . $user['name']);
if(!$mail->Send())
{
if($mail->ErrorInfo != '')
{
$mailerr_msg = $mail->ErrorInfo;
}
else
{
$mailerr_msg = $email;
}
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
redirectTo('index.php', Array('showmessage' => '4'), true);
exit;
}
$mail->ClearAddresses();
redirectTo('index.php', Array('showmessage' => '1'), true);
exit;
} }
} else { else
$message = $lng['login']['usernotfound']; {
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
$message = $lng['login']['usernotfound'];
}
unset($user, $adminchecked);
}
else
{
$message = '';
} }
} }
else
if ($adminchecked) { {
if ($settings['panel']['allow_preset_admin'] != '1') { $message = '';
$message = $lng['pwdreminder']['notallowed'];
unset ($adminchecked);
}
} else {
if ($settings['panel']['allow_preset'] != '1') {
$message = $lng['pwdreminder']['notallowed'];
}
} }
eval("echo \"" . getTemplate('fpwd') . "\";"); if($settings['panel']['allow_preset'] != '1')
{
$message = $lng['pwdreminder']['notallowed'];
}
eval("echo \"" . getTemplate("fpwd") . "\";");
} }
?>

File diff suppressed because it is too large Load Diff

View File

@@ -2,6 +2,7 @@
/** /**
* This file is part of the Froxlor project. * This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors). * Copyright (c) 2010 the Froxlor Team (see authors).
* *
* For the full copyright and license information, please view the COPYING * For the full copyright and license information, please view the COPYING
@@ -9,14 +10,821 @@
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
* *
* @copyright (c) the authors * @copyright (c) the authors
* @author Michael Kaufmann <mkaufmann@nutime.de> * @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
require 'lib/class.FroxlorInstall.php'; /**
* Most elements are taken from the phpBB (www.phpbb.com)
* installer, (c) 1999 - 2004 phpBB Group.
*/
$frxinstall = new FroxlorInstall(); if(file_exists('../lib/userdata.inc.php'))
$frxinstall->run(); {
/**
* Includes the Usersettings eg. MySQL-Username/Passwort etc. to test if Froxlor is already installed
*/
require ('../lib/userdata.inc.php');
if(isset($sql)
&& is_array($sql))
{
die('Sorry, Froxlor is already configured...');
}
}
/**
* Include the functions
*/
require ('../lib/functions.php');
/**
* Include the MySQL-Table-Definitions
*/
require ('../lib/tables.inc.php');
/**
* Language Managament
*/
$languages = Array(
'german' => 'Deutsch',
'english' => 'English',
'french' => 'Francais'
);
$standardlanguage = 'english';
if(isset($_GET['language'])
&& isset($languages[$_GET['language']]))
{
$language = $_GET['language'];
}
elseif(isset($_POST['language'])
&& isset($languages[$_POST['language']]))
{
$language = $_POST['language'];
}
else
{
$language = $standardlanguage;
}
if(file_exists('./lng/' . $language . '.lng.php'))
{
/**
* Includes file /lng/$language.lng.php if it exists
*/
require ('./lng/' . $language . '.lng.php');
}
/**
* BEGIN FUNCTIONS -----------------------------------------------
*/
function page_header()
{
?>
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
<html xmlns="http://www.w3.org/1999/xhtml">
<head>
<meta content="text/html; charset=ISO-8859-1" http-equiv="content-type" />
<link rel="stylesheet" href="../templates/main.css" type="text/css" />
<title>Froxlor</title>
</head>
<body style="margin: 0; padding: 0;" onload="document.loginform.loginname.focus()">
<!--
We request you retain the full copyright notice below including the link to www.froxlor.org.
This not only gives respect to the large amount of time given freely by the developers
but also helps build interest, traffic and use of Froxlor. If you refuse
to include even this then support on our forums may be affected.
The Froxlor Team : 2009-2010
// -->
<!--
Templates based on work by Luca Piona (info@havanastudio.ch) and Luca Longinotti (chtekk@gentoo.org)
// -->
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td width="800"><img src="../images/header.gif" width="800" height="90" alt="" /></td>
<td class="header">&nbsp;</td>
</tr>
</table>
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td valign="top" bgcolor="#FFFFFF">
<br />
<br />
<?php
}
function page_footer()
{
?>
</td>
</tr>
</table>
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td width="100%" class="footer">
<br />Froxlor &copy; 2009-2010 by <a href="http://www.froxlor.org/" target="_blank">the Froxlor Team</a>
<br /><br/>
</td>
</tr>
</table>
</body>
</html>
<?php
}
function status_message($case, $text)
{
if($case == 'begin')
{
echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\">$text";
}
else
{
echo " <span style=\"color:$case;\">$text</span></td>\n\t\t</tr>\n";
}
}
/**
* END FUNCTIONS ---------------------------------------------------
*/
/**
* BEGIN VARIABLES ---------------------------------------------------
*/
//guess Servername
if(!empty($_POST['servername']))
{
$servername = $_POST['servername'];
}
else
{
if(!empty($_SERVER['SERVER_NAME']))
{
if(validate_ip($_SERVER['SERVER_NAME'], true) == false)
{
$servername = $_SERVER['SERVER_NAME'];
}
else
{
$servername = '';
}
}
else
{
$servername = '';
}
}
//guess serverip
if(!empty($_POST['serverip']))
{
$serverip = $_POST['serverip'];
}
else
{
if(!empty($_SERVER['SERVER_ADDR']))
{
$serverip = $_SERVER['SERVER_ADDR'];
}
else
{
$serverip = '';
}
}
if(!empty($_POST['mysql_host']))
{
$mysql_host = $_POST['mysql_host'];
}
else
{
$mysql_host = '127.0.0.1';
}
if(!empty($_POST['mysql_database']))
{
$mysql_database = $_POST['mysql_database'];
}
else
{
$mysql_database = 'froxlor';
}
if(!empty($_POST['mysql_unpriv_user']))
{
$mysql_unpriv_user = $_POST['mysql_unpriv_user'];
}
else
{
$mysql_unpriv_user = 'froxlor';
}
if(!empty($_POST['mysql_unpriv_pass']))
{
$mysql_unpriv_pass = $_POST['mysql_unpriv_pass'];
}
else
{
$mysql_unpriv_pass = '';
}
if(!empty($_POST['mysql_root_user']))
{
$mysql_root_user = $_POST['mysql_root_user'];
}
else
{
$mysql_root_user = 'root';
}
if(!empty($_POST['mysql_root_pass']))
{
$mysql_root_pass = $_POST['mysql_root_pass'];
}
else
{
$mysql_root_pass = '';
}
if(!empty($_POST['admin_user']))
{
$admin_user = $_POST['admin_user'];
}
else
{
$admin_user = 'admin';
}
if(!empty($_POST['admin_pass1']))
{
$admin_pass1 = $_POST['admin_pass1'];
}
else
{
$admin_pass1 = '';
}
if(!empty($_POST['admin_pass2']))
{
$admin_pass2 = $_POST['admin_pass2'];
}
else
{
$admin_pass2 = '';
}
if($mysql_host == 'localhost'
|| $mysql_host == '127.0.0.1')
{
$mysql_access_host = $mysql_host;
}
else
{
$mysql_access_host = $serverip;
}
// gues http software
if(!empty($_POST['webserver']))
{
$webserver = $_POST['webserver'];
}
else
{
if(strtoupper(@php_sapi_name()) == "APACHE2HANDLER"
|| stristr($_SERVER[SERVER_SOFTWARE], "apache/2"))
{
$webserver = 'apache2';
}
elseif(substr(strtoupper(@php_sapi_name()), 0, 8) == "LIGHTTPD"
|| stristr($_SERVER[SERVER_SOFTWARE], "lighttpd"))
{
$webserver = 'lighttpd';
}
else
{
// we don't need to bail out, since unknown does not affect any critical installation routines
$webserver = 'unknown';
}
}
if(!empty($_POST['httpuser']))
{
$httpuser = $_POST['httpuser'];
}
else
{
$httpuser = '';
}
if(!empty($_POST['httpgroup']))
{
$httpgroup = $_POST['httpgroup'];
}
else
{
$httpgroup = '';
}
/**
* END VARIABLES ---------------------------------------------------
*/
/**
* BEGIN INSTALL ---------------------------------------------------
*/
if(isset($_POST['installstep'])
&& $_POST['installstep'] == '1'
&& $admin_pass1 == $admin_pass2
&& $admin_pass1 != ''
&& $admin_pass2 != ''
&& $mysql_unpriv_pass != ''
&& $mysql_root_pass != ''
&& $servername != ''
&& $serverip != ''
&& $httpuser != ''
&& $httpgroup != ''
&& $mysql_unpriv_user != $mysql_root_user)
{
page_header();
?>
<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
<tr>
<td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
</tr>
<?php
$_die = false;
// check for correct php version
status_message('begin', $lng['install']['phpversion']);
if(version_compare("5.2.0", PHP_VERSION, ">="))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpmysql']);
if(!extension_loaded('mysql'))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpfilter']);
if(!extension_loaded('filter'))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpposix']);
if(!extension_loaded('posix'))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpbcmath']);
if(!extension_loaded('bcmath'))
{
status_message('orange', $lng['install']['notinstalled'] . '<br />' . $lng['install']['bcmathdescription']);
$_die = false;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['openbasedir']);
$php_ob = @ini_get("open_basedir");
if(!empty($php_ob)
&& $php_ob != '')
{
status_message('orange', $lng['install']['openbasedirenabled']);
$_die = false;
}
else
{
status_message('green', 'OK');
}
if($_die)
{
status_message('begin', $lng['install']['diedbecauseofrequirements']);
die();
}
//first test if we can access the database server with the given root user and password
status_message('begin', $lng['install']['testing_mysql']);
$db_root = new db($mysql_host, $mysql_root_user, $mysql_root_pass, '');
//ok, if we are here, the database class is build up (otherwise it would have already die'd this script)
status_message('green', 'OK');
//first we make a backup of the old DB if it exists
status_message('begin', $lng['install']['backup_old_db']);
$result = mysql_list_tables($mysql_database);
if($result)
{
$filename = "/tmp/froxlor_backup_" . date(YmdHi) . ".sql";
if(is_file("/usr/bin/mysqldump"))
{
$command = "/usr/bin/mysqldump " . $mysql_database . " -u " . $mysql_root_user . " --password='" . $mysql_root_pass . "' --result-file=" . $filename;
$output = exec($command);
if(stristr($output, "error"))
{
status_message('red', $lng['install']['backing_up_failed']);
}
else
{
status_message('green', 'OK');
}
}
else
{
status_message('red', $lng['install']['backing_up_binary_missing']);
}
}
//so first we have to delete the database and the user given for the unpriv-user if they exit
status_message('begin', $lng['install']['erasing_old_db']);
$db_root->query("DELETE FROM `mysql`.`user` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DELETE FROM `mysql`.`db` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DELETE FROM `mysql`.`tables_priv` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DELETE FROM `mysql`.`columns_priv` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DROP DATABASE IF EXISTS `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "` ;");
$db_root->query("FLUSH PRIVILEGES;");
status_message('green', 'OK');
//then we have to create a new user and database for the froxlor unprivileged mysql access
status_message('begin', $lng['install']['create_mysqluser_and_db']);
$db_root->query("CREATE DATABASE `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "`");
$mysql_access_host_array = array_map('trim', explode(',', $mysql_access_host));
if(in_array('127.0.0.1', $mysql_access_host_array)
&& !in_array('localhost', $mysql_access_host_array))
{
$mysql_access_host_array[] = 'localhost';
}
if(!in_array('127.0.0.1', $mysql_access_host_array)
&& in_array('localhost', $mysql_access_host_array))
{
$mysql_access_host_array[] = '127.0.0.1';
}
$mysql_access_host_array[] = $serverip;
foreach($mysql_access_host_array as $mysql_access_host)
{
$db_root->query("GRANT ALL PRIVILEGES ON `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "`.* TO '" . $db_root->escape($mysql_unpriv_user) . "'@'" . $db_root->escape($mysql_access_host) . "' IDENTIFIED BY 'password'");
$db_root->query("SET PASSWORD FOR '" . $db_root->escape($mysql_unpriv_user) . "'@'" . $db_root->escape($mysql_access_host) . "' = PASSWORD('" . $db_root->escape($mysql_unpriv_pass) . "')");
}
$db_root->query("FLUSH PRIVILEGES;");
$mysql_access_host = implode(',', $mysql_access_host_array);
status_message('green', 'OK');
//now a new database and the new froxlor-unprivileged-mysql-account have been created and we can fill it now with the data.
status_message('begin', $lng['install']['testing_new_db']);
$db = new db($mysql_host, $mysql_unpriv_user, $mysql_unpriv_pass, $mysql_database);
status_message('green', 'OK');
status_message('begin', $lng['install']['importing_data']);
$db_schema = './froxlor.sql';
$sql_query = @file_get_contents($db_schema, 'r');
$sql_query = remove_remarks($sql_query);
$sql_query = split_sql_file($sql_query, ';');
for ($i = 0;$i < sizeof($sql_query);$i++)
{
if(trim($sql_query[$i]) != '')
{
$result = $db->query($sql_query[$i]);
}
}
status_message('green', 'OK');
status_message('begin', 'System Servername...');
if(validate_ip($_SERVER['SERVER_NAME'], true) !== false)
{
status_message('red', $lng['install']['servername_should_be_fqdn']);
}
else
{
status_message('green', 'OK');
}
//now let's change the settings in our settings-table
status_message('begin', $lng['install']['changing_data']);
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = 'admin@" . $db->escape($servername) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'adminmail'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($serverip) . "' WHERE `settinggroup` = 'system' AND `varname` = 'ipaddress'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($servername) . "' WHERE `settinggroup` = 'system' AND `varname` = 'hostname'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($version) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'version'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($languages[$language]) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'standardlanguage'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($mysql_access_host) . "' WHERE `settinggroup` = 'system' AND `varname` = 'mysql_access_host'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
//FIXME
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpuser) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpuser'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpgroup) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'");
if($webserver == "apache2")
{
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/apache2 reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
}
elseif($webserver == "lighttpd")
{
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/conf-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-diroptions/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/lighttpd reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/lighttpd.pem' WHERE `settinggroup` = 'system' AND `varname` = 'ssl_cert_file'");
}
// insert the lastcronrun to be the installation date
$query = 'UPDATE `%s` SET `value` = UNIX_TIMESTAMP() WHERE `settinggroup` = \'system\' AND `varname` = \'lastcronrun\'';
$query = sprintf($query, TABLE_PANEL_SETTINGS);
$db->query($query);
// and lets insert the default ip and port
$query = 'INSERT INTO `%s` SET `ip` = \'%s\', `port` = \'80\' ';
$query = sprintf($query, TABLE_PANEL_IPSANDPORTS, $db->escape($serverip));
$db->query($query);
$defaultip = $db->insert_id();
// insert the defaultip
$query = 'UPDATE `%s` SET `value` = \'%s\' WHERE `settinggroup` = \'system\' AND `varname` = \'defaultip\'';
$query = sprintf($query, TABLE_PANEL_SETTINGS, $db->escape($defaultip));
$db->query($query);
status_message('green', 'OK');
//last but not least create the main admin
status_message('begin', $lng['install']['adding_admin_user']);
$db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET
`loginname` = '" . $db->escape($admin_user) . "',
`password` = '" . md5($admin_pass1) . "',
`name` = 'Siteadmin',
`email` = 'admin@" . $db->escape($servername) . "',
`customers` = -1,
`customers_used` = 0,
`customers_see_all` = 1,
`caneditphpsettings` = 1,
`domains` = -1,
`domains_used` = 0,
`domains_see_all` = 1,
`change_serversettings` = 1,
`diskspace` = -1024,
`diskspace_used` = 0,
`mysqls` = -1,
`mysqls_used` = 0,
`emails` = -1,
`emails_used` = 0,
`email_accounts` = -1,
`email_accounts_used` = 0,
`email_forwarders` = -1,
`email_forwarders_used` = 0,
`email_quota` = -1,
`email_quota_used` = 0,
`ftps` = -1,
`ftps_used` = 0,
`tickets` = -1,
`tickets_used` = 0,
`subdomains` = -1,
`subdomains_used` = 0,
`traffic` = -1048576,
`traffic_used` = 0,
`deactivated` = 0,
`aps_packages` = -1");
status_message('green', 'OK');
//now we create the userdata.inc.php with the mysql-accounts
status_message('begin', $lng['install']['creating_configfile']);
$userdata = "<?php\n";
$userdata.= "//automatically generated userdata.inc.php for Froxlor\n";
$userdata.= "\$sql['host']='" . addcslashes($mysql_host, "'\\") . "';\n";
$userdata.= "\$sql['user']='" . addcslashes($mysql_unpriv_user, "'\\") . "';\n";
$userdata.= "\$sql['password']='" . addcslashes($mysql_unpriv_pass, "'\\") . "';\n";
$userdata.= "\$sql['db']='" . addcslashes($mysql_database, "'\\") . "';\n";
$userdata.= "\$sql_root[0]['caption']='Default';\n";
$userdata.= "\$sql_root[0]['host']='" . addcslashes($mysql_host, "'\\") . "';\n";
$userdata.= "\$sql_root[0]['user']='" . addcslashes($mysql_root_user, "'\\") . "';\n";
$userdata.= "\$sql_root[0]['password']='" . addcslashes($mysql_root_pass, "'\\") . "';\n";
$userdata.= "?>";
//we test now if we can store the userdata.inc.php in ../lib
if($fp = @fopen('../lib/userdata.inc.php', 'w'))
{
$result = @fputs($fp, $userdata, strlen($userdata));
@fclose($fp);
status_message('green', $lng['install']['creating_configfile_succ']);
chmod('../lib/userdata.inc.php', 0440);
}
elseif($fp = @fopen('/tmp/userdata.inc.php', 'w'))
{
$result = @fputs($fp, $userdata, strlen($userdata));
@fclose($fp);
status_message('orange', $lng['install']['creating_configfile_temp']);
chmod('/tmp/userdata.inc.php', 0440);
}
else
{
status_message('red', $lng['install']['creating_configfile_failed']);
echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\"><p>" . nl2br(htmlspecialchars($userdata)) . "</p></td>\n\t\t</tr>\n";
}
?>
<tr>
<td class="main_field_display" align="center">
<?php echo $lng['install']['froxlor_succ_installed']; ?><br />
<a href="../index.php"><?php echo $lng['install']['click_here_to_login']; ?></a>
</td>
</tr>
</table>
<br />
<br />
<?php
page_footer();
}
else
{
page_header();
?>
<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="get">
<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['welcome']; ?></b></td>
</tr>
<tr>
<td class="main_field_name" colspan="2"><?php echo $lng['install']['welcometext']; ?></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['language']; ?>: </td>
<td class="main_field_display" nowrap="nowrap">
<select name="language" class="dropdown_noborder"><?php
$language_options = '';
while(list($language_file, $language_name) = each($languages))
{
$language_options.= "\n\t\t\t\t\t\t" . makeoption($language_name, $language_file, $language, true, true);
}
echo $language_options;
?>
</select>
</td>
</tr>
<tr>
<td class="main_field_confirm" colspan="2">
<input class="bottom" type="submit" name="chooselang" value="Go" />
</td>
</tr>
</table>
</form>
<br />
<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="post">
<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['database']; ?></b></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['mysql_hostname']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_host" value="<?php echo htmlspecialchars($mysql_host); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['mysql_database']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_database" value="<?php echo htmlspecialchars($mysql_database); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_user']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_unpriv_user" value="<?php echo htmlspecialchars($mysql_unpriv_user); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_unpriv_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_pass']; ?>:</td>
<td class="main_field_display"><input type="password" name="mysql_unpriv_pass" value="<?php echo htmlspecialchars($mysql_unpriv_pass); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_root_user']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_root_user" value="<?php echo htmlspecialchars($mysql_root_user); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_root_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_root_pass']; ?>:</td>
<td class="main_field_display"><input type="password" name="mysql_root_pass" value="<?php echo htmlspecialchars($mysql_root_pass); ?>"/></td>
</tr>
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['admin_account']; ?></b></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['admin_user']; ?>:</td>
<td class="main_field_display"><input type="text" name="admin_user" value="<?php echo htmlspecialchars($admin_user); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass1 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass']; ?>:</td>
<td class="main_field_display"><input type="password" name="admin_pass1" value="<?php echo htmlspecialchars($admin_pass1); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass2 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass_confirm']; ?>:</td>
<td class="main_field_display"><input type="password" name="admin_pass2" value="<?php echo htmlspecialchars($admin_pass2); ?>"/></td>
</tr>
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['serversettings']; ?></b></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $servername == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['servername']; ?>:</td>
<td class="main_field_display"><input type="text" name="servername" value="<?php echo htmlspecialchars($servername); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['serverip']; ?>:</td>
<td class="main_field_display"><input type="text" name="serverip" value="<?php echo htmlspecialchars($serverip); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?>:</td>
<td class="main_field_display"><input type="radio" name="webserver" value="apache2" <?php echo $webserver == "apache2" ? 'checked="checked"' : "" ?>/>Apache2&nbsp;<br /><input type="radio" name="webserver" value="lighttpd" <?php echo $webserver == "lighttpd" ? 'checked="checked"' : "" ?>/>Lighttpd</td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpuser']; ?>:</td>
<td class="main_field_display"><input type="text" name="httpuser" value="<?php $posixusername = posix_getpwuid(posix_getuid()); echo $posixusername['name']; ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpgroup']; ?>:</td>
<td class="main_field_display"><input type="text" name="httpgroup" value="<?php $posixgroup = posix_getgrgid(posix_getgid()); echo $posixgroup['name']; ?>"/></td>
</tr>
<tr>
<td class="main_field_confirm" colspan="2"><input type="hidden" name="language" value="<?php echo htmlspecialchars($language); ?>"/><input type="hidden" name="installstep" value="1"/><input class="bottom" type="submit" name="submitbutton" value="<?php echo $lng['install']['next']; ?>"/></td>
</tr>
</table>
</form>
<br />
<br />
<?php
page_footer();
}
/**
* END INSTALL ---------------------------------------------------
*/
?>

File diff suppressed because it is too large Load Diff

View File

@@ -14,71 +14,74 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
$lng['requirements']['title'] = 'Checking system requirements...'; /**
$lng['requirements']['installed'] = 'installed'; * Begin
$lng['requirements']['not_true'] = 'no'; */
$lng['requirements']['notfound'] = 'not found';
$lng['requirements']['notinstalled'] = 'not installed';
$lng['requirements']['activated'] = 'enabled';
$lng['requirements']['phpversion'] = 'PHP version >= 5.2';
$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime...';
$lng['requirements']['phpmagic_quotes_runtime_description'] = 'PHP setting "magic_quotes_runtime" must be set to "Off". We have disabled it temporary for now please fix the coresponding php.ini.';
$lng['requirements']['phpmysql'] = 'MySQL-extension...';
$lng['requirements']['phpxml'] = 'PHP XML-extension...';
$lng['requirements']['phpfilter'] = 'PHP filter-extension...';
$lng['requirements']['phpposix'] = 'PHP posix-extension...';
$lng['requirements']['phpbcmath'] = 'PHP bcmath-extension...';
$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
$lng['requirements']['openbasedir'] = 'open_basedir...';
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the coresponding php.ini';
$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';
$lng['requirements']['froxlor_succ_checks'] = 'All requirements are satisfied';
$lng['install']['title'] = 'Froxlor install - chose language'; $lng['install']['language'] = 'Installation - Language';
$lng['install']['language'] = 'Installation language'; $lng['install']['welcome'] = 'Welcome to Froxlor Installation';
$lng['install']['lngbtn_go'] = 'Change language';
$lng['install']['title'] = 'Froxlor install - setup';
$lng['install']['welcometext'] = 'Thank you for choosing Froxlor. Please fill out the following fields with the required information to start the installation.<br /><b>Attention:</b> If the database you chose for Froxlor already exists on your System, it will be erased with all containing data!'; $lng['install']['welcometext'] = 'Thank you for choosing Froxlor. Please fill out the following fields with the required information to start the installation.<br /><b>Attention:</b> If the database you chose for Froxlor already exists on your System, it will be erased with all containing data!';
$lng['install']['database'] = 'Database connection'; $lng['install']['database'] = 'Database';
$lng['install']['mysql_host'] = 'MySQL-Hostname'; $lng['install']['mysql_hostname'] = 'MySQL-Hostname';
$lng['install']['mysql_database'] = 'Database name'; $lng['install']['mysql_database'] = 'MySQL-Database';
$lng['install']['mysql_unpriv_user'] = 'Username for the unprivileged MySQL-account'; $lng['install']['mysql_unpriv_user'] = 'Username for the unprivileged MySQL-account';
$lng['install']['mysql_unpriv_pass'] = 'Password for the unprivileged MySQL-account'; $lng['install']['mysql_unpriv_pass'] = 'Password for the unprivileged MySQL-account';
$lng['install']['mysql_root_user'] = 'Username for the MySQL-root-account'; $lng['install']['mysql_root_user'] = 'Username for the MySQL-root-account';
$lng['install']['mysql_root_pass'] = 'Password for the MySQL-root-account'; $lng['install']['mysql_root_pass'] = 'Password for the MySQL-root-account';
$lng['install']['admin_account'] = 'Administrator Account'; $lng['install']['admin_account'] = 'Administrator Account';
$lng['install']['admin_user'] = 'Administrator Username'; $lng['install']['admin_user'] = 'Administrator Username';
$lng['install']['admin_pass1'] = 'Administrator Password'; $lng['install']['admin_pass'] = 'Administrator Password';
$lng['install']['admin_pass2'] = 'Administrator-Password (confirm)'; $lng['install']['admin_pass_confirm'] = 'Administrator-Password (confirm)';
$lng['install']['serversettings'] = 'Server settings'; $lng['install']['serversettings'] = 'Server settings';
$lng['install']['servername'] = 'Server name (FQDN, no ip-address)'; $lng['install']['servername'] = 'Server name (FQDN)';
$lng['install']['serverip'] = 'Server IP'; $lng['install']['serverip'] = 'Server IP';
$lng['install']['webserver'] = 'Webserver';
$lng['install']['apache2'] = 'Apache 2';
$lng['install']['lighttpd'] = 'LigHTTPd';
$lng['install']['nginx'] = 'NGINX';
$lng['install']['httpuser'] = 'HTTP username'; $lng['install']['httpuser'] = 'HTTP username';
$lng['install']['httpgroup'] = 'HTTP groupname'; $lng['install']['httpgroup'] = 'HTTP groupname';
$lng['install']['apacheversion'] = 'Apacheversion';
$lng['install']['next'] = 'Next';
$lng['install']['testing_mysql'] = 'Checking MySQL-root access...'; /**
$lng['install']['backup_old_db'] = 'Creating backup of old database...'; * Progress
$lng['install']['backup_binary_missing'] = 'Could not find mysqldump'; */
$lng['install']['backup_failed'] = 'Could not backup database';
$lng['install']['prepare_db'] = 'Preparing database...'; $lng['install']['testing_mysql'] = 'Testing if MySQL-root-username and password are correct...';
$lng['install']['create_mysqluser_and_db'] = 'Creating database and username...'; $lng['install']['erasing_old_db'] = 'Erasing old Database...';
$lng['install']['testing_new_db'] = 'Testing if database and user have been created correctly...'; $lng['install']['backup_old_db'] = 'Create backup of the old Database...';
$lng['install']['importing_data'] = 'Importing data...'; $lng['install']['backing_up'] = 'Backing up';
$lng['install']['changing_data'] = 'Adjusting settings...'; $lng['install']['backing_up_binary_missing'] = '/usr/bin/mysqldump is missing';
$lng['install']['creating_entries'] = 'Inserting new values...'; $lng['install']['create_mysqluser_and_db'] = 'Creating MySQL-database and username...';
$lng['install']['adding_admin_user'] = 'Creating admin-account...'; $lng['install']['testing_new_db'] = 'Testing if MySQL-database and username have been created correctly...';
$lng['install']['importing_data'] = 'Importing data into MySQL-database...';
$lng['install']['changing_data'] = 'Changing imported data...';
$lng['install']['adding_admin_user'] = 'Adding Administrator Account...';
$lng['install']['creating_configfile'] = 'Creating configfile...'; $lng['install']['creating_configfile'] = 'Creating configfile...';
$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php was saved in lib/.';
$lng['install']['creating_configfile_temp'] = 'File was saved in /tmp/userdata.inc.php, please move to lib/.'; $lng['install']['creating_configfile_temp'] = 'File was saved in /tmp/userdata.inc.php, please move to lib/.';
$lng['install']['creating_configfile_failed'] = 'Could not create lib/userdata.inc.php, please create it manually with the following content:'; $lng['install']['creating_configfile_failed'] = 'Cannot create lib/userdata.inc.php, please create it manually with the following data:';
$lng['install']['froxlor_succ_installed'] = 'Froxlor was installed successfully.'; $lng['install']['froxlor_succ_installed'] = 'Froxlor was installed successfully.';
$lng['install']['click_here_to_login'] = 'Click here to login.';
$lng['install']['phpmysql'] = 'Testing if PHP MySQL-extension is installed...';
$lng['install']['phpfilter'] = 'Testing if PHP filter-extension is installed...';
$lng['install']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Aborting...';
$lng['install']['notinstalled'] = 'not installed!';
$lng['install']['phpbcmath'] = 'Testing if PHP bcmath-extension is installed...';
$lng['install']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
$lng['install']['openbasedir'] = 'Testing if open_basedir is enabled...';
$lng['install']['openbasedirenabled'] = 'enabled. Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor';
$lng['click_here_to_refresh'] = 'Click here to check again'; /**
$lng['click_here_to_continue'] = 'Click here to continue'; * Renamed in 1.2.19-svn40
$lng['click_here_to_login'] = 'Click here to login.'; */
$lng['install']['webserver'] = 'Webserver';
/*
* Added in Froxlor 0.9
*/
$lng['install']['phpversion'] = 'Checking for PHP version >= 5.2';
$lng['install']['phpposix'] = 'Testing if PHP posix-extension is installed...';
?>

View File

@@ -0,0 +1,71 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Tim Zielosko <mail@zielosko.net>
* @author Romain MARIADASSOU <roms2000@free.fr>
* @author Froxlor Team <team@froxlor.org>
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language
* @version $Id$
*/
/**
* Begin
*/
$lng['install']['language'] = 'Langue d\'installation';
$lng['install']['welcome'] = 'Bienvenue <20> l\'installation de Froxlor';
$lng['install']['welcometext'] = 'Merci beaucoup d\'avoir choisi Froxlor. Pour installer Froxlor remplissez les cases ci-dessous avec les informations demand<6E>es.<br /><b>Attention :</b> Si vous entrez le nom d\'une base de donn<6E>es existante, celle-ci sera effac<61>e !';
$lng['install']['database'] = 'Base de donn<6E>es';
$lng['install']['mysql_hostname'] = 'Nom d\'h<>te du serveur MySQL';
$lng['install']['mysql_database'] = 'Base de donn<6E>es MySQL';
$lng['install']['mysql_unpriv_user'] = 'Utilisateur pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
$lng['install']['mysql_unpriv_pass'] = 'Mot de passe pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
$lng['install']['mysql_root_user'] = 'Utilisateur pour l\'acc<63>s root <20> MySQL';
$lng['install']['mysql_root_pass'] = 'Mot de passe pour l\'acc<63>s root <20> MySQL';
$lng['install']['admin_account'] = 'Acc<63>s administratif';
$lng['install']['admin_user'] = 'Login de l\'administrateur';
$lng['install']['admin_pass'] = 'Mot de passe de l\'administrateur';
$lng['install']['admin_pass_confirm'] = 'Mot de passe de l\'administrateur (confirmation)';
$lng['install']['serversettings'] = 'Configuration du serveur';
$lng['install']['servername'] = 'Nom du serveur (FQDN)';
$lng['install']['serverip'] = 'Adresse IP du serveur';
$lng['install']['apacheversion'] = 'Version du serveur Apache';
$lng['install']['next'] = 'Continuer';
/**
* Progress
*/
$lng['install']['testing_mysql'] = 'V<>rification du login root de MySQL ...';
$lng['install']['erasing_old_db'] = 'Effacement de l\'ancienne base de donn<6E>es ...';
$lng['install']['create_mysqluser_and_db'] = 'Cr<43>ation de la base de donn<6E>es puis des utilisateurs ...';
$lng['install']['testing_new_db'] = 'V<>rification de la base de donn<6E>es et des utilisateurs ...';
$lng['install']['importing_data'] = 'Importation des informations dans la base de donn<6E>es ...';
$lng['install']['changing_data'] = 'Modification des donn<6E>es import<72>s ...';
$lng['install']['adding_admin_user'] = 'Ajout de l\'utilisateur administrateur ...';
$lng['install']['creating_configfile'] = 'Cr<43>ation du fichier de configuration ...';
$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php a <20>t<EFBFBD> sauvegard<72> dans le dossier lib/ de Froxlor.';
$lng['install']['creating_configfile_temp'] = 'Le fichier a <20>t<EFBFBD> sauvegard<72> dans /tmp/userdata.inc.php, veuillez le d<>placer / copier dans le dossier lib/ de Froxlor.';
$lng['install']['creating_configfile_failed'] = 'Erreur en cr<63>ant le fichier lib/userdata.inc.php, veuillez le cr<63>er avec le contenu ci-dessous :';
$lng['install']['froxlor_succ_installed'] = 'Froxlor a <20>t<EFBFBD> install<6C> correctement.';
$lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'invite de connexion.';
$lng['install']['httpuser'] = 'Nom du utilisateur du HTTP';
$lng['install']['httpgroup'] = 'Nom du la group du HTTP';
/**
* Renamed in 1.2.19-svn40
*/
$lng['install']['webserver'] = 'Version du serveur';
?>

View File

@@ -2,83 +2,83 @@
/** /**
* This file is part of the Froxlor project. * This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors). * Copyright (c) 2003-2007 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors). * Copyright (c) 2010 the Froxlor Team (see authors).
* *
* For the full copyright and license information, please view the COPYING * For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the * file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt * COPYING file online at http://files.syscp.org/misc/COPYING.txt
* *
* @copyright (c) the authors * @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009) * @author Florian Lippert <flo@syscp.org> (2003-2007)
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor Team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
$lng['requirements']['title'] = 'Prüfe Systemvoraussetzungen...'; /**
$lng['requirements']['installed'] = 'installiert'; * Begin
$lng['requirements']['not_true'] = 'nein'; */
$lng['requirements']['notfound'] = 'nicht gefunden';
$lng['requirements']['notinstalled'] = 'nicht installiert';
$lng['requirements']['activated'] = 'ist aktiviert.';
$lng['requirements']['phpversion'] = 'PHP Version >= 5.2';
$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime';
$lng['requirements']['phpmagic_quotes_runtime_description'] = 'Die PHP Einstellung "magic_quotes_runtime" muss deaktiviert sein ("Off"). Die Einstellung wurde temporär deaktiviert, bitte ändern Sie diese in der entsprechenden php.ini.';
$lng['requirements']['phpmysql'] = 'PHP MySQL-Erweiterung...';
$lng['requirements']['phpxml'] = 'PHP XML-Erweiterung...';
$lng['requirements']['phpfilter'] = 'PHP filter-Erweiterung...';
$lng['requirements']['phpposix'] = 'PHP posix-Erweiterung...';
$lng['requirements']['phpbcmath'] = 'PHP bcmath-Erweiterung...';
$lng['requirements']['bcmathdescription'] = 'Traffic-Berechnungs bezogene Funktionen stehen nicht vollständig zur Verfügung!';
$lng['requirements']['openbasedir'] = 'open_basedir genutzt wird...';
$lng['requirements']['openbasedirenabled'] = 'Froxlor wird mit aktiviertem open_basedir nicht vollständig funktionieren. Bitte deaktivieren Sie open_basedir für Froxlor in der entsprechenden php.ini';
$lng['requirements']['diedbecauseofrequirements'] = 'Kann Froxlor ohne diese Voraussetzungen nicht installieren! Versuchen Sie die angezeigten Problem zu beheben und versuchen Sie es erneut.';
$lng['requirements']['froxlor_succ_checks'] = 'Alle Vorraussetzungen sind erfüllt';
$lng['install']['lngtitle'] = 'Froxlor Installation - Sprache auswählen'; $lng['install']['language'] = 'Installations - Sprache';
$lng['install']['language'] = 'Sprache für die Installation'; $lng['install']['welcome'] = 'Willkommen zur Froxlor Installation';
$lng['install']['lngbtn_go'] = 'Sprache ändern'; $lng['install']['welcometext'] = 'Vielen Dank dass Sie sich f&uuml;r Froxlor entschieden haben. Um Ihre Installation von Froxlor zu starten, f&uuml;llen Sie bitte alle Felder unten mit den geforderten Angaben.<br /><b>Achtung:</b> Eine eventuell bereits existierende Datenbank, die den selben Namen hat wie den, den Sie unten eingeben werden, wird mit allen enthaltenen Daten gel&ouml;scht!';
$lng['install']['title'] = 'Froxlor Installation - Einrichtung'; $lng['install']['database'] = 'Datenbank';
$lng['install']['welcometext'] = 'Vielen Dank dass Sie sich für Froxlor entschieden haben. Um die Installation von Froxlor zu starten, füllen Sie bitte alle Felder mit den geforderten Angaben aus.<br /><b>Achtung:</b> Eine eventuell existierende Datenbank, die den selben Namen hat wie den Gewählten, wird mit allen enthaltenen Daten gelöscht!'; $lng['install']['mysql_hostname'] = 'MySQL-Hostname';
$lng['install']['database'] = 'Datenbankverbindung'; $lng['install']['mysql_database'] = 'MySQL-Datenbank';
$lng['install']['mysql_host'] = 'MySQL-Hostname'; $lng['install']['mysql_unpriv_user'] = 'Benutzername f&uuml;r den unprivilegierten MySQL-Account';
$lng['install']['mysql_database'] = 'Datenbank Name'; $lng['install']['mysql_unpriv_pass'] = 'Passwort f&uuml;r den unprivilegierten MySQL-Account';
$lng['install']['mysql_unpriv_user'] = 'Benutzername für den unprivilegierten MySQL-Account'; $lng['install']['mysql_root_user'] = 'Benutzername f&uuml;r den MySQL-Root-Account';
$lng['install']['mysql_unpriv_pass'] = 'Passwort für den unprivilegierten MySQL-Account'; $lng['install']['mysql_root_pass'] = 'Passwort f&uuml;r den MySQL-Root-Account';
$lng['install']['mysql_root_user'] = 'Benutzername für den MySQL-Root-Account';
$lng['install']['mysql_root_pass'] = 'Passwort für den MySQL-Root-Account';
$lng['install']['admin_account'] = 'Admin-Zugang'; $lng['install']['admin_account'] = 'Admin-Zugang';
$lng['install']['admin_user'] = 'Administrator-Benutzername'; $lng['install']['admin_user'] = 'Administrator-Benutzername';
$lng['install']['admin_pass1'] = 'Administrator-Passwort'; $lng['install']['admin_pass'] = 'Administrator-Passwort';
$lng['install']['admin_pass2'] = 'Administrator-Passwort (Bestätigung)'; $lng['install']['admin_pass_confirm'] = 'Administrator-Passwort (Best&auml;tigung)';
$lng['install']['serversettings'] = 'Servereinstellungen'; $lng['install']['serversettings'] = 'Servereinstellungen';
$lng['install']['servername'] = 'Servername (FQDN, keine IP-Adresse)'; $lng['install']['servername'] = 'Servername (FQDN)';
$lng['install']['serverip'] = 'Server-IP'; $lng['install']['serverip'] = 'Server-IP';
$lng['install']['webserver'] = 'Webserver'; $lng['install']['apacheversion'] = 'Apacheversion';
$lng['install']['apache2'] = 'Apache 2'; $lng['install']['next'] = 'Fortfahren';
$lng['install']['lighttpd'] = 'LigHTTPd';
$lng['install']['nginx'] = 'NGINX';
$lng['install']['httpuser'] = 'HTTP Username';
$lng['install']['httpgroup'] = 'HTTP Gruppenname';
$lng['install']['testing_mysql'] = 'Teste MySQL-Root Zugang...'; /**
$lng['install']['backup_old_db'] = 'Sicherung vorheriger Datenbank...'; * Progress
$lng['install']['backup_binary_missing'] = 'Konnte mysqldump nicht finden'; */
$lng['install']['backup_failed'] = 'Sicherung fehlgeschlagen';
$lng['install']['prepare_db'] = 'Datenbank wird vorbereitet...'; $lng['install']['testing_mysql'] = 'Teste, ob die MySQL-Root-Benutzerdaten richtig sind...';
$lng['install']['erasing_old_db'] = 'Entferne alte Datenbank...';
$lng['install']['create_mysqluser_and_db'] = 'Erstelle Datenbank und Benutzer...'; $lng['install']['create_mysqluser_and_db'] = 'Erstelle Datenbank und Benutzer...';
$lng['install']['testing_new_db'] = 'Teste, ob Datenbank und Benutzer korrekt angelegt wurden...'; $lng['install']['testing_new_db'] = 'Teste, ob die Datenbank und Passwort korrekt angelegt wurden...';
$lng['install']['importing_data'] = 'Importiere Daten...'; $lng['install']['importing_data'] = 'Importiere Daten in die MySQL-Datenbank...';
$lng['install']['changing_data'] = 'Einstellungen anpassen...'; $lng['install']['changing_data'] = 'Passe die importierten Daten an...';
$lng['install']['creating_entries'] = 'Trage neue Werte ein...'; $lng['install']['adding_admin_user'] = 'F&uuml;ge den Admin-Benutzer hinzu...';
$lng['install']['adding_admin_user'] = 'Erstelle Admin-Benutzer...';
$lng['install']['creating_configfile'] = 'Erstelle Konfigurationsdatei...'; $lng['install']['creating_configfile'] = 'Erstelle Konfigurationsdatei...';
$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php wurde in lib/ gespeichert.';
$lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach lib/ verschieben.'; $lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach lib/ verschieben.';
$lng['install']['creating_configfile_failed'] = 'Konnte lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:'; $lng['install']['creating_configfile_failed'] = 'Konnte lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:';
$lng['install']['froxlor_succ_installed'] = 'Froxlor wurde erfolgreich installiert.'; $lng['install']['froxlor_succ_installed'] = 'Froxlor wurde erfolgreich installiert.';
$lng['install']['click_here_to_login'] = 'Hier geht es weiter zum Login-Fenster.';
$lng['install']['phpmysql'] = 'Teste, ob die PHP MySQL-Erweiterung installiert ist...';
$lng['install']['phpfilter'] = 'Teste, ob die PHP Filter-Erweiterung installiert ist...';
$lng['install']['diedbecauseofrequirements'] = 'Kann Froxlor ohne diese Voraussetzungen nicht installieren! Breche ab...';
$lng['install']['notinstalled'] = 'nicht installiert!';
$lng['install']['phpbcmath'] = 'Teste, ob die PHP bcmath-Erweiterung installiert ist...';
$lng['install']['bcmathdescription'] = 'Traffic-Berechnungs bezogene Funktionen stehen nicht vollst&auml;ndig zur Verf&uuml;gung!';
$lng['install']['openbasedir'] = 'Teste, ob open_basedir genutzt wird...';
$lng['install']['openbasedirenabled'] = 'aktiviert. Froxlor wird mit aktiviertem open_basedir nicht vollst&auml;ndig funktionieren. Bitte deaktivieren Sie open_basedir f&uuml;r Froxlor';
$lng['install']['httpuser'] = 'HTTP Username';
$lng['install']['httpgroup'] = 'HTTP Gruppenname';
$lng['click_here_to_refresh'] = 'Hier klicken, um erneut zu prüfen'; /**
$lng['click_here_to_continue'] = 'Installation fortführen'; * Renamed in 1.2.19-svn40
$lng['click_here_to_login'] = 'Hier geht es weiter zum Login-Fenster.'; */
$lng['install']['webserver'] = 'Webserver';
/*
* Added in Froxlor 0.9
*/
$lng['install']['phpversion'] = 'Pr&uuml;fe PHP Version >= 5.2';
$lng['install']['phpposix'] = 'Teste, ob die PHP Posix-Erweiterung installiert ist...';
?>

View File

@@ -12,7 +12,7 @@
* @author Michael Duergner <michael@duergner.com> * @author Michael Duergner <michael@duergner.com>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt * @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package System * @package System
* * @version $Id$
*/ */
if(@php_sapi_name() != 'cli' if(@php_sapi_name() != 'cli'

View File

@@ -12,7 +12,7 @@
* @author Martin Burchert <eremit@syscp.org> * @author Martin Burchert <eremit@syscp.org>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt * @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package System * @package System
* * @version $Id$
*/ */
// some configs // some configs
@@ -21,7 +21,9 @@ $baseLanguage = 'english.lng.php';
// Check if we're in the CLI // Check if we're in the CLI
if(@php_sapi_name() != 'cli') if(@php_sapi_name() != 'cli'
&& @php_sapi_name() != 'cgi'
&& @php_sapi_name() != 'cgi-fcgi')
{ {
die('This script will only work in the shell.'); die('This script will only work in the shell.');
} }

View File

@@ -1,531 +0,0 @@
@charset "UTF-8";
/* RESET */
html,body,div,ul,ol,li,dl,dt,dd,h1,h2,h3,h4,h5,h6,pre,form,p,blockquote,fieldset,input { margin:0; padding:0; }
h1,h2,h3,h4,h5,h6,pre,code,address,caption,cite,code,em,strong,th { font-size:1em; font-weight:400; font-style:normal; }
ul,ol { list-style:none; }
fieldset,img { border:none; }
caption,th { text-align:left; }
table { border-collapse:collapse; border-spacing:0; }
article,aside,details,figcaption,figure,footer,header,hgroup,menu,nav,section { display:block; }
/* TYPE */
html,body {
font:12px/18px Helvetica,Arial,Verdana,sans-serif;
background-color:#f2f2f2;
color:#333;
-webkit-font-smoothing: antialiased;
}
body {
margin:0;
padding:0;
}
.dark {
background-color: #e9edf0;
border-bottom:1px solid #d1d5d8;
}
header img {
padding:10px 0 10px 10px;
}
h1 {
display:none;
}
h2, h3 {
margin: 0 0 1em 0;
padding: 0;
font-weight: bold;
}
h2 {
font-size:17px;
}
h3 {
font-size: 15px;
}
img {
border:0;
vertical-align:middle;
}
td a {
text-decoration:none;
}
.bradius {
border-radius: 5px 5px 5px 5px;
box-shadow: rgba(0, 0, 0, 0.34902) 0px 1px 3px 0px;
}
/* FOOTER */
footer {
clear:both;
text-align:center;
color: #888;
font-size:10px !important;
margin: 10px 0;
}
footer a,footer a:active,footer a:visited {
color: #888;
}
.install {
background-color:#fff;
margin: 20px;
margin-left: auto;
margin-right: auto;
margin-bottom: 12px;
width: 800px;
}
p {
margin: 0 10px !important;
}
.installsec {
margin-top:10px;
padding:0;
text-align:left;
}
.installsec table {
width:100%;
padding:0 10px;
margin: 15px 0 15px 0;
}
.installsec h2 {
display: block;
border-bottom: 1px solid #d1d5d8;
margin: 0;
padding: 5px 15px 15px 15px;
}
.installsec form {
width:800px;
margin:0 auto;
padding:10px 0 0;
text-align:left;
}
.installsec fieldset {
border:0;
float:left;
clear:left;
width:600px;
margin:0 100px 10px;
padding:0;
}
.installsec legend {
display:none;
}
.installsec label {
float:left;
width:26em;
margin-right:1em;
margin-top:6px;
text-align:left;
}
p.submit {
text-align:right;
padding-right:46px;
}
.installsec aside {
border-top:1px solid #d1d5d8;
clear:both;
float:none;
width:auto;
text-align: right;
padding: 10px;
}
.line {
border: 0;
width: 800px;
border-bottom:1px solid #d1d5d8;
}
.messagewrapper {
width:650px;
margin:0 auto;
padding:120px 0 0;
overflow:hidden;
}
.messagewrapperfull {
width:100%;
margin:0 auto;
padding:0;
overflow:hidden;
}
.overviewsearch {
position:absolute;
top:155px;
right:36px;
font-size:80%;
}
.overviewadd {
padding:10px;
font-weight:700;
}
/*
* error message display
*/
.errorcontainer {
background:url(../img/icons/error_big.png) 10px center no-repeat #ffedef;
border:1px solid #ffc2ca;
padding:10px 10px 10px 68px!important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.errortitle {
font-weight:700;
color:#c00!important;
}
.error {
font-weight:400!important;
color:#c00!important;
}
/*
* warning message display
*/
.warningcontainer,.ui-dialog {
background:url(../img/icons/warning_big.png) 10px center no-repeat #fffecc;
border:1px solid #f3c37e;
padding:10px 10px 10px 68px !important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.ui-dialog {
padding: 10px !important;
}
.warningtitle,.ui-dialog-titlebar {
font-weight:700;
color:#D57D00;
}
.warning,.ui-dialog-content {
color:#D57D00!important;
}
/*
* success message display
*/
.successcontainer {
background:url(../img/icons/ok_big.png) 10px center no-repeat #E2F9E3;
border:1px solid #9C9;
padding:10px 10px 10px 68px!important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.successtitle {
font-weight:700;
color:#060!important;
}
.success {
font-weight:400!important;
}
/*
* neutral/info message display
*/
.neutralcontainer {
background:url(../img/icons/info_big.png) 10px center no-repeat #d2eaf6;
border:1px solid #b7d8ed;
padding:10px 10px 10px 68px!important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.neutraltitle {
font-weight:700;
color:#3188c1!important;
}
.neutral {
font-weight:400!important;
color:#3188c1!important;
}
/* std hyperlink */
a,a:active,a:visited {
color:#176fa1;
text-decoration:none;
}
a:hover {
text-decoration:underline;
}
.infotext {
font-size:11px;
}
/*
* main container
*/
.main {
margin-left:240px;
margin-right:10px;
margin-top:105px;
margin-bottom:0;
background-color:#fff;
padding: 30px 30px 30px 30px;
min-height:400px;
}
.noborder {
width:100%;
border-spacing:0;
border-collapse:separate;
border: 0;
}
.noborder td {
border:0;
}
table {
width:100%;
border-spacing:0;
border:1px solid #d1d5d8;
border-collapse:separate;
box-shadow:0px 0px 0px black !important;
}
table thead th, table th {
border-top: 1px solid #d1d5d8;
border-bottom: 1px solid #d1d5d8;
height: 25px !important;
padding: 5px 0px 5px 8px;
background-color: #e9edf0;
font-weight: bold;
}
table thead:first-child th, table:first-child th {
border-top: none !important;
}
table th {
border-top: 0;
}
th a:hover {
text-decoration: none;
}
th a img {
}
th a:nth-child(odd) img {
position: relative;
top: -5px;
left: 4px;
}
th a:nth-child(even) img {
position: relative;
top: 3px;
left: -7px;
}
table thead:first-child th {
border-top: 0;
}
.disabled td, .disabled td a {
color: #cfcfcf;
}
table tbody td {
border-bottom:1px dotted #ccc;
}
table tbody tr:last-child td {
border-bottom: 0;
}
.formtable {
width: 100%;
border-spacing:0;
border:0;
border-collapse:separate;
margin:0 0 0;
}
.formtable tbody td {
border:0;
border-bottom:1px dotted #ccc;
min-height: 20px;
}
.formtable label {
float:none;
display:block;
padding:0;
margin:0;
width:100%;
text-align:left;
}
td {
padding-top:5px;
padding-left:10px;
padding-right: 10px;
padding-bottom:5px;
min-height: 20px;
}
table tfoot td {
height:25px;
border-top: 1px solid #d1d5d8;
background-color: #f2f8fa;
}
.tfootleft {
text-align:left;
}
.maintitle {
padding-top:20px;
}
/* input elements */
input {
background: #fff url(../img/text_align_left.png) no-repeat 5px 4px;
padding:2px 4px 2px 24px;
height:22px;
border: 1px solid #d9d9d9;
margin-bottom: 5px;
}
textarea {
background:#fff url(../img/text_align_left.png) no-repeat 5px 4px;
padding:4px 4px 2px 24px;
border:1px solid #d9d9d9;
margin-bottom: 5px;
}
input[type="password"] {
background:#fff url(../img/password.png) no-repeat 5px 4px;
}
input[type="button"],input[type="submit"],input[type="reset"] {
background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #79bbff), color-stop(1, #378de5) );
background:-moz-linear-gradient( center top, #79bbff 5%, #378de5 100% );
filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#79bbff', endColorstr='#378de5');
background-color:#79bbff;
-moz-border-radius:5px;
-webkit-border-radius:5px;
border-radius:5px;
display:inline-block;
color:#ffffff;
padding:2px 24px 2px 24px;
text-decoration:none;
text-shadow:1px 1px 0px #528ecc;
height: 26px;
margin: 0 3px 0 3px;
}
input[type="button"]:hover,input[type="submit"]:hover,input[type="reset"]:hover {
background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #378de5), color-stop(1, #79bbff) );
background:-moz-linear-gradient( center top, #378de5 5%, #79bbff 100% );
filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#378de5', endColorstr='#79bbff');
background-color:#378de5;
}
input[type="submit"],input[class="yesbutton"] {
background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #9dce2c), color-stop(1, #8cb82b) );
background:-moz-linear-gradient( center top, #9dce2c 5%, #8cb82b 100% );
filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#9dce2c', endColorstr='#8cb82b');
background-color:#9dce2c;
text-shadow:1px 1px 0px #aade7c;
}
input[type="submit"]:hover,input[class="yesbutton"]:hover {
background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #8cb82b), color-stop(1, #9dce2c) );
background:-moz-linear-gradient( center top, #8cb82b 5%, #9dce2c 100% );
filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#8cb82b', endColorstr='#9dce2c');
background-color:#8cb82b;
}
input[class="nobutton"],input[type="reset"] {
background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #fe1a00), color-stop(1, #ce0100) );
background:-moz-linear-gradient( center top, #fe1a00 5%, #ce0100 100% );
filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#fe1a00', endColorstr='#ce0100');
background-color:#fe1a00;
text-shadow:1px 1px 0px #b23e35;
}
input[class="nobutton"]:hover,input[type="reset"]:hover {
background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #ce0100), color-stop(1, #fe1a00) );
background:-moz-linear-gradient( center top, #ce0100 5%, #fe1a00 100% );
filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#ce0100', endColorstr='#fe1a00');
background-color:#ce0100;
}
input[type="checkbox"] {
background:#dae7ee;
padding: 0;
margin: 0 20px 0 0;
}
input[type="radio"] { /*the span element that immediately follow the radio button */
margin: 0 10px 0 10px;
height:22px;
}
select {
background:#fff;
padding:4px;
border:1px solid #d9d9d9;
margin-bottom: 5px;
}
.maintable {
width:90%;
}
.update_progess {
padding:2em;
text-align:left;
}
.preconfig {
text-align:left;
margin-top:20px;
margin-bottom:5px;
margin-right:15px;
margin-left:15px;
}
.preconfigitem {
padding:.15em;
border-bottom:1px solid #ccc;
}
.preconfdesc {
display:block;
margin-bottom:.5em;
font-size:120%;
}

Binary file not shown.

Before

Width:  |  Height:  |  Size: 1.4 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 2.5 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 3.4 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 198 B

View File

@@ -1,10 +0,0 @@
<p style="margin: 20px 20px 0 !important">{$this->_lng['install']['title']}</p>
<form action="{$formaction}" method="get">
<fieldset>
{$formdata}
<p class="submit">
<input type="hidden" name="check" value="1" />
<input type="submit" name="chooselang" value="{$this->_lng['install']['btn_go']}" />
</p>
</fieldset>
</form>

View File

@@ -1,13 +0,0 @@
<p style="margin: 20px 20px 0 !important">{$this->_lng['install']['welcometext']}</p>
<form action="{$formaction}" method="post">
<hr class="line">
<fieldset>
{$formdata}
</fieldset>
<aside>
<input type="hidden" name="check" value="1" />
<input type="hidden" name="language" value="{$language}" />
<input type="hidden" name="installstep" value="1" />
<input class="bottom" type="submit" name="submitbutton" value="{$this->_lng['click_here_to_continue']}" />
</aside>
</form>

View File

@@ -1,4 +0,0 @@
<p>
<label for="{$fieldname}" style="width:65%;{$style}">{$fieldlabel}:</label>&nbsp;
<input type="{$type}" name="{$fieldname}" id="{$fieldname}" value="{$fieldvalue}" {$required} />
</p>

View File

@@ -1,4 +0,0 @@
<p>
<label for="{$fieldname}" style="width:65%;{$style}">{$this->_lng['install']['webserver']} {$fieldlabel}:</label>
<input type="radio" name="webserver" id="{$fieldname}" value="{$fieldname}" {$checked} /><span>{$fieldlabel}<span>
</p>

View File

@@ -1,2 +0,0 @@
<br />
<h3>{$section}</h3>

View File

@@ -1,7 +0,0 @@
</div>
<footer>
<span> Froxlor &copy; 2009-{$current_year} by <a href="http://www.froxlor.org/" rel="external">the Froxlor Team</a>
</span>
</footer>
</body>
</html>

View File

@@ -1,18 +0,0 @@
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta http-equiv="Default-Style" content="text/css" />
<!--[if lt IE 9]><script src="../js/html5shiv.js"></script><![endif]-->
<link href="templates/assets/css/install.css" rel="stylesheet" type="text/css" />
<!--[if IE]><link rel="stylesheet" href="../templates/{$theme}/css/main_ie.css" type="text/css" /><![endif]-->
<link href="templates/assets/img/favicon.ico" rel="icon" type="image/x-icon" />
<title>Froxlor Server Management Panel - Installation</title>
<style type="text/css">
body {
font-family: Verdana, Geneva, sans-serif;
}
</style>
</head>
<body>
<div class="installsec">

View File

@@ -1,14 +0,0 @@
<form action="{$formaction}" method="get">
<fieldset>
<legend>{$this->_lng['install']['lngtitle']}</legend>
<p>
<label for="language">{$this->_lng['install']['language']}:</label>&nbsp;
<select name="language" id="language">
{$language_options}
</select>
<input type="hidden" name="check" value="1" />
<input type="submit" name="chooselang" value="{$this->_lng['install']['lngbtn_go']}" />
</p>
</fieldset>
</form>
<hr class="line">

View File

@@ -1,11 +0,0 @@
<article class="install bradius">
<header class="dark">
<img src="../templates/{$theme}/assets/img/logo.png" alt="Froxlor Server Management Panel" />
</header>
<section class="installsec">
<h2>{$pagetitle}</h2>
{$pagecontent}
{$pagenavigation}
</section>
</article>

View File

@@ -1,4 +0,0 @@
<h3 style="color:{$msgcolor};text-align: center">{$message}</h3>
<aside>
<a href="{$link}">{$linktext}</a>
</aside>

Some files were not shown because too many files have changed in this diff Show More