Compare commits

..

1 Commits

Author SHA1 Message Date
Michael Kaufmann (d00p)
3b8b973926 Tagging version 0.9.17 2011-01-26 07:24:50 +00:00
1866 changed files with 24388 additions and 85054 deletions

10
.gitignore vendored
View File

@@ -1,10 +0,0 @@
packages/*
lib/classes/htmlpurifier/library/HTMLPurifier/DefinitionCache/Serializer/*/
temp/*
templates/*
install/update.log
.buildpath
.project
.settings/
*.diff
*~

11
COPYING
View File

@@ -2,7 +2,7 @@
Version 2, June 1991 Version 2, June 1991
Copyright (C) 1989, 1991 Free Software Foundation, Inc. Copyright (C) 1989, 1991 Free Software Foundation, Inc.
51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA 675 Mass Ave, Cambridge, MA 02139, USA
Everyone is permitted to copy and distribute verbatim copies Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed. of this license document, but changing it is not allowed.
@@ -55,7 +55,7 @@ patent must be licensed for everyone's free use or not licensed at all.
The precise terms and conditions for copying, distribution and The precise terms and conditions for copying, distribution and
modification follow. modification follow.
GNU GENERAL PUBLIC LICENSE GNU GENERAL PUBLIC LICENSE
TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
@@ -110,7 +110,7 @@ above, provided that you also meet all of these conditions:
License. (Exception: if the Program itself is interactive but License. (Exception: if the Program itself is interactive but
does not normally print such an announcement, your work based on does not normally print such an announcement, your work based on
the Program is not required to print an announcement.) the Program is not required to print an announcement.)
These requirements apply to the modified work as a whole. If These requirements apply to the modified work as a whole. If
identifiable sections of that work are not derived from the Program, identifiable sections of that work are not derived from the Program,
and can be reasonably considered independent and separate works in and can be reasonably considered independent and separate works in
@@ -168,7 +168,7 @@ access to copy from a designated place, then offering equivalent
access to copy the source code from the same place counts as access to copy the source code from the same place counts as
distribution of the source code, even though third parties are not distribution of the source code, even though third parties are not
compelled to copy the source along with the object code. compelled to copy the source along with the object code.
4. You may not copy, modify, sublicense, or distribute the Program 4. You may not copy, modify, sublicense, or distribute the Program
except as expressly provided under this License. Any attempt except as expressly provided under this License. Any attempt
otherwise to copy, modify, sublicense or distribute the Program is otherwise to copy, modify, sublicense or distribute the Program is
@@ -225,7 +225,7 @@ impose that choice.
This section is intended to make thoroughly clear what is believed to This section is intended to make thoroughly clear what is believed to
be a consequence of the rest of this License. be a consequence of the rest of this License.
8. If the distribution and/or use of the Program is restricted in 8. If the distribution and/or use of the Program is restricted in
certain countries either by patents or by copyrighted interfaces, the certain countries either by patents or by copyrighted interfaces, the
original copyright holder who places the Program under this License original copyright holder who places the Program under this License
@@ -278,3 +278,4 @@ PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
POSSIBILITY OF SUCH DAMAGES. POSSIBILITY OF SUCH DAMAGES.
END OF TERMS AND CONDITIONS END OF TERMS AND CONDITIONS

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
return array( return array(
@@ -32,32 +32,6 @@ return array(
'option_options_method' => 'getLanguages', 'option_options_method' => 'getLanguages',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_default_theme' => array(
'label' => array('title' => $lng['panel']['theme'], 'description' => $lng['serversettings']['default_theme']),
'settinggroup' => 'panel',
'varname' => 'default_theme',
'type' => 'option',
'default' => 'Froxlor',
'option_mode' => 'one',
'option_options_method' => 'getThemes',
'save_method' => 'storeSettingDefaultTheme',
),
'panel_allow_theme_change_customer' => array(
'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_customer',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'panel_allow_theme_change_admin' => array(
'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
'settinggroup' => 'panel',
'varname' => 'allow_theme_change_admin',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField'
),
'panel_natsorting' => array( 'panel_natsorting' => array(
'label' => $lng['serversettings']['natsorting'], 'label' => $lng['serversettings']['natsorting'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -93,23 +67,6 @@ return array(
'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']), 'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'use_webfonts' => array(
'label' => $lng['serversettings']['enablewebfonts'],
'settinggroup' => 'panel',
'varname' => 'use_webfonts',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'webfont' => array(
'label' => $lng['serversettings']['definewebfont']['title'],
'settinggroup' => 'panel',
'varname' => 'webfont',
'type' => 'string',
'default' => 'Numans',
'string_emptyallowed' => false,
'save_method' => 'storeSettingField',
),
'panel_adminmail' => array( 'panel_adminmail' => array(
'label' => $lng['serversettings']['adminmail'], 'label' => $lng['serversettings']['adminmail'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -194,6 +151,14 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'admin_froxlor_graphic' => array(
'label' => $lng['admin']['froxlor_graphic'],
'settinggroup' => 'admin',
'varname' => 'froxlor_graphic',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'panel_allow_domain_change_admin' => array( 'panel_allow_domain_change_admin' => array(
'label' => $lng['serversettings']['panel_allow_domain_change_admin'], 'label' => $lng['serversettings']['panel_allow_domain_change_admin'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -210,14 +175,6 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'panel_phpconfigs_hidestdsubdomain' => array(
'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
'settinggroup' => 'panel',
'varname' => 'phpconfigs_hidestdsubdomain',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
), ),
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -27,19 +27,10 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'documentroot_prefix', 'varname' => 'documentroot_prefix',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/webs/', 'default' => '/var/customers/webs/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'plausibility_check_method' => 'checkPathConflicts' 'plausibility_check_method' => 'checkPathConflicts'
), ),
'system_documentroot_use_default_value' => array(
'label' => $lng['serversettings']['documentroot_use_default_value'],
'settinggroup' => 'system',
'varname' => 'documentroot_use_default_value',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
),
'system_ipaddress' => array( 'system_ipaddress' => array(
'label' => $lng['serversettings']['ipaddress'], 'label' => $lng['serversettings']['ipaddress'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -67,7 +58,6 @@ return array(
'type' => 'string', 'type' => 'string',
'default' => '', 'default' => '',
'save_method' => 'storeSettingHostname', 'save_method' => 'storeSettingHostname',
'plausibility_check_method' => 'checkHostname',
), ),
'system_froxlordirectlyviahostname' => array( 'system_froxlordirectlyviahostname' => array(
'label' => $lng['serversettings']['froxlordirectlyviahostname'], 'label' => $lng['serversettings']['froxlordirectlyviahostname'],
@@ -77,14 +67,6 @@ return array(
'default' => false, 'default' => false,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_validatedomain' => array(
'label' => $lng['serversettings']['validate_domain'],
'settinggroup' => 'system',
'varname' => 'validate_domain',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
),
'system_stdsubdomain' => array( 'system_stdsubdomain' => array(
'label' => $lng['serversettings']['stdsubdomainhost'], 'label' => $lng['serversettings']['stdsubdomainhost'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -146,7 +128,7 @@ return array(
'varname' => 'report_webmax', 'varname' => 'report_webmax',
'type' => 'int', 'type' => 'int',
'int_min' => 1, 'int_min' => 1,
'int_max' => 150, 'int_max' => 99,
'default' => 90, 'default' => 90,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
@@ -156,7 +138,7 @@ return array(
'varname' => 'report_trafficmax', 'varname' => 'report_trafficmax',
'type' => 'int', 'type' => 'int',
'int_min' => 1, 'int_min' => 1,
'int_max' => 150, 'int_max' => 99,
'default' => 90, 'default' => 90,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -33,15 +33,6 @@ return array(
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'overview_option' => true 'overview_option' => true
), ),
'system_apache_24' => array(
'label' => $lng['serversettings']['apache_24'],
'settinggroup' => 'system',
'varname' => 'apache24',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2')
),
'system_httpuser' => array( 'system_httpuser' => array(
'label' => $lng['admin']['webserver_user'], 'label' => $lng['admin']['webserver_user'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -81,7 +72,7 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'apacheconf_htpasswddir', 'varname' => 'apacheconf_htpasswddir',
'type' => 'string', 'type' => 'string',
'string_type' => 'confdir', 'string_type' => 'dir',
'default' => '/etc/apache2/htpasswd/', 'default' => '/etc/apache2/htpasswd/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
@@ -94,15 +85,6 @@ return array(
'default' => '/var/customers/logs/', 'default' => '/var/customers/logs/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_customersslpath' => array(
'label' => $lng['serversettings']['customerssl_directory'],
'settinggroup' => 'system',
'varname' => 'customer_ssl_path',
'type' => 'string',
'string_type' => 'confdir',
'default' => '/etc/ssl/froxlor-custom/',
'save_method' => 'storeSettingField',
),
'system_phpappendopenbasedir' => array( 'system_phpappendopenbasedir' => array(
'label' => $lng['serversettings']['phpappendopenbasedir'], 'label' => $lng['serversettings']['phpappendopenbasedir'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -142,7 +124,7 @@ return array(
'label' => $lng['serversettings']['phpreload_command'], 'label' => $lng['serversettings']['phpreload_command'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'phpreload_command', 'varname' => 'phpreload_command',
'type' => 'string', 'type' => (getSetting('phpfpm', 'enabled') == '1') ? 'hidden' : 'string',
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx') 'websrv_avail' => array('nginx')
@@ -151,20 +133,19 @@ return array(
'label' => $lng['serversettings']['nginx_php_backend'], 'label' => $lng['serversettings']['nginx_php_backend'],
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'nginx_php_backend', 'varname' => 'nginx_php_backend',
'type' => 'string', 'type' => (getSetting('phpfpm', 'enabled') == '1') ? 'hidden' : 'string',
'default' => '127.0.0.1:8888', 'default' => '127.0.0.1:8888',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx') 'websrv_avail' => array('nginx')
), ),
'nginx_fastcgiparams' => array( 'system_mod_log_sql' => array(
'label' => $lng['serversettings']['nginx_fastcgiparams'], 'label' => $lng['serversettings']['mod_log_sql'],
'settinggroup' => 'nginx', 'settinggroup' => 'system',
'varname' => 'fastcgiparams', 'varname' => 'mod_log_sql',
'type' => 'string', 'type' => 'bool',
'string_type' => 'file', 'default' => false,
'default' => '/etc/nginx/fastcgi_params',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('nginx') 'websrv_avail' => array('apache2')
), ),
'defaultwebsrverrhandler_enabled' => array( 'defaultwebsrverrhandler_enabled' => array(
'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'], 'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
@@ -228,8 +209,72 @@ return array(
'option_options_method' => 'getRedirectCodes', 'option_options_method' => 'getRedirectCodes',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2', 'lighttpd') 'websrv_avail' => array('apache2', 'lighttpd')
) ),
) ),
) ),
) 'ssl' => array(
'title' => $lng['admin']['sslsettings'],
'fields' => array(
'system_ssl_enabled' => array(
'label' => $lng['serversettings']['ssl']['use_ssl'],
'settinggroup' => 'system',
'varname' => 'use_ssl',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_ssl_cert_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.pem',
'save_method' => 'storeSettingField',
),
'system_ssl_key_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_key_file'],
'settinggroup' => 'system',
'varname' => 'ssl_key_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.key',
'save_method' => 'storeSettingField',
),
'system_ssl_ca_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
'settinggroup' => 'system',
'varname' => 'ssl_ca_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_ssl_cert_chainfile' => array(
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_chainfile',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_ssl_openssl_cnf' => array(
'label' => $lng['serversettings']['ssl']['openssl_cnf'],
'settinggroup' => 'system',
'varname' => 'openssl_cnf',
'type' => 'text',
'default' => '',
'save_method' => 'storeSettingField',
),
),
),
),
); );
?>

View File

@@ -1,86 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'ssl' => array(
'title' => $lng['admin']['sslsettings'],
'fields' => array(
'system_ssl_enabled' => array(
'label' => $lng['serversettings']['ssl']['use_ssl'],
'settinggroup' => 'system',
'varname' => 'use_ssl',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_ssl_cipher_list' => array(
'label' => $lng['serversettings']['ssl']['ssl_cipher_list'],
'settinggroup' => 'system',
'varname' => 'ssl_cipher_list',
'type' => 'string',
'string_emptyallowed' => false,
'default' => 'ECDHE-RSA-AES128-SHA256:AES128-GCM-SHA256:RC4:HIGH:!MD5:!aNULL:!EDH',
'save_method' => 'storeSettingField',
),
'system_ssl_cert_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.pem',
'save_method' => 'storeSettingField',
),
'system_ssl_key_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_key_file'],
'settinggroup' => 'system',
'varname' => 'ssl_key_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '/etc/apache2/apache2.key',
'save_method' => 'storeSettingField',
),
'system_ssl_cert_chainfile' => array(
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
'settinggroup' => 'system',
'varname' => 'ssl_cert_chainfile',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_ssl_ca_file' => array(
'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
'settinggroup' => 'system',
'varname' => 'ssl_ca_file',
'type' => 'string',
'string_type' => 'file',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
)
)
)
)
);

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -36,7 +36,7 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'mod_fcgid_configdir', 'varname' => 'mod_fcgid_configdir',
'type' => 'string', 'type' => 'string',
'string_type' => 'confdir', 'string_type' => 'dir',
'default' => '/var/www/php-fcgi-scripts/', 'default' => '/var/www/php-fcgi-scripts/',
'plausibility_check_method' => 'checkPathConflicts', 'plausibility_check_method' => 'checkPathConflicts',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
@@ -66,7 +66,7 @@ return array(
'settinggroup' => 'system', 'settinggroup' => 'system',
'varname' => 'mod_fcgid_wrapper', 'varname' => 'mod_fcgid_wrapper',
'type' => 'option', 'type' => 'option',
'option_options' => array(0 => 'ScriptAlias', 1=> 'FcgidWrapper'), 'option_options' => array(0 => 'ScriptAlias', 1=> 'FCGIWrapper'),
'default' => 1, 'default' => 1,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2') 'websrv_avail' => array('apache2')
@@ -135,14 +135,6 @@ return array(
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2') 'websrv_avail' => array('apache2')
), ),
'system_mod_fcgid_idle_timeout' => array(
'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
'settinggroup' => 'system',
'varname' => 'mod_fcgid_idle_timeout',
'type' => 'int',
'default' => 30,
'save_method' => 'storeSettingField'
),
) )
) )
) )

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -54,16 +54,9 @@ return array(
'default' => 'froxlorlocal', 'default' => 'froxlorlocal',
'save_method' => 'storeSettingField' 'save_method' => 'storeSettingField'
), ),
'system_phpfpm_defaultini' => array( /*
'label' => $lng['serversettings']['mod_fcgid']['defaultini'], * @TODO implement if phpfpm knows custom php.ini files
'settinggroup' => 'phpfpm', *
'varname' => 'defaultini',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField',
),
'system_phpfpm_defaultini_ownvhost' => array( 'system_phpfpm_defaultini_ownvhost' => array(
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'], 'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
'settinggroup' => 'phpfpm', 'settinggroup' => 'phpfpm',
@@ -74,24 +67,16 @@ return array(
'option_options_method' => 'getPhpConfigs', 'option_options_method' => 'getPhpConfigs',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
*/
'system_phpfpm_configdir' => array( 'system_phpfpm_configdir' => array(
'label' => $lng['serversettings']['phpfpm_settings']['configdir'], 'label' => $lng['serversettings']['phpfpm_settings']['configdir'],
'settinggroup' => 'phpfpm', 'settinggroup' => 'phpfpm',
'varname' => 'configdir', 'varname' => 'configdir',
'type' => 'string', 'type' => 'string',
'string_type' => 'confdir', 'string_type' => 'dir',
'default' => '/etc/php-fpm.d/', 'default' => '/etc/php-fpm.d/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_phpfpm_aliasconfigdir' => array(
'label' => $lng['serversettings']['phpfpm_settings']['aliasconfigdir'],
'settinggroup' => 'phpfpm',
'varname' => 'aliasconfigdir',
'type' => 'string',
'string_type' => 'confdir',
'default' => '/var/www/php-fpm/',
'save_method' => 'storeSettingField',
),
'system_phpfpm_tmpdir' => array( 'system_phpfpm_tmpdir' => array(
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'], 'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
'settinggroup' => 'phpfpm', 'settinggroup' => 'phpfpm',
@@ -125,7 +110,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => 'static', 'default' => 'static',
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array('static' => 'static', 'dynamic' => 'dynamic', 'ondemand' => 'ondemand'), 'option_options' => array('static' => 'static', 'dynamic' => 'dynamic'),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_phpfpm_max_children' => array( 'system_phpfpm_max_children' => array(
@@ -168,14 +153,6 @@ return array(
'default' => 0, 'default' => 0,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_phpfpm_idle_timeout' => array(
'label' => $lng['serversettings']['phpfpm_settings']['idle_timeout'],
'settinggroup' => 'phpfpm',
'varname' => 'idle_timeout',
'type' => 'int',
'default' => 30,
'save_method' => 'storeSettingField'
),
), ),
), ),
), ),

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -43,7 +43,6 @@ return array(
'settinggroup' => 'perl', 'settinggroup' => 'perl',
'varname' => 'suexecpath', 'varname' => 'suexecpath',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/var/www/cgi-bin/', 'default' => '/var/www/cgi-bin/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
'websrv_avail' => array('apache2') 'websrv_avail' => array('apache2')

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -51,16 +51,6 @@ return array(
'default' => '/var/customers/mail/', 'default' => '/var/customers/mail/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_vmail_maildirname' => array(
'label' => $lng['serversettings']['vmail_maildirname'],
'settinggroup' => 'system',
'varname' => 'vmail_maildirname',
'type' => 'string',
'string_type' => 'dir',
'default' => 'Maildir',
'string_emptyallowed' => true,
'save_method' => 'storeSettingField',
),
'panel_sendalternativemail' => array( 'panel_sendalternativemail' => array(
'label' => $lng['serversettings']['sendalternativemail'], 'label' => $lng['serversettings']['sendalternativemail'],
'settinggroup' => 'panel', 'settinggroup' => 'panel',
@@ -100,14 +90,6 @@ return array(
'type' => 'hidden', 'type' => 'hidden',
'default' => 0, 'default' => 0,
), ),
'system_catchall_enabled' => array(
'label' => $lng['serversettings']['catchall_enabled'],
'settinggroup' => 'catchall',
'varname' => 'catchall_enabled',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingResetCatchall',
),
), ),
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id: 220.ftpserver.php 1 2010-04-07 10:00:00Z monotek $
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -22,15 +22,6 @@ return array(
'nameserver' => array( 'nameserver' => array(
'title' => $lng['admin']['nameserversettings'], 'title' => $lng['admin']['nameserversettings'],
'fields' => array( 'fields' => array(
'nameserver_enable' => array(
'label' => $lng['serversettings']['bindenable'],
'settinggroup' => 'system',
'varname' => 'bind_enable',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'system_bindconf_directory' => array( 'system_bindconf_directory' => array(
'label' => $lng['serversettings']['bindconf_directory'], 'label' => $lng['serversettings']['bindconf_directory'],
'settinggroup' => 'system', 'settinggroup' => 'system',
@@ -68,16 +59,6 @@ return array(
'default' => '', 'default' => '',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_axfrservers' => array(
'label' => $lng['serversettings']['axfrservers'],
'settinggroup' => 'system',
'varname' => 'axfrservers',
'type' => 'string',
'string_type' => 'validate_ip',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField',
),
'system_dns_createmailentry' => array( 'system_dns_createmailentry' => array(
'label' => $lng['serversettings']['mail_also_with_mxservers'], 'label' => $lng['serversettings']['mail_also_with_mxservers'],
'settinggroup' => 'system', 'settinggroup' => 'system',

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,11 +14,9 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
global $settings;
return array( return array(
'groups' => array( 'groups' => array(
'dkim' => array( 'dkim' => array(
@@ -38,7 +36,6 @@ return array(
'settinggroup' => 'dkim', 'settinggroup' => 'dkim',
'varname' => 'dkim_prefix', 'varname' => 'dkim_prefix',
'type' => 'string', 'type' => 'string',
'string_type' => 'dir',
'default' => '/etc/postfix/dkim/', 'default' => '/etc/postfix/dkim/',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
@@ -81,10 +78,7 @@ return array(
'save_method' => 'storeSettingFieldInsertBindTask', 'save_method' => 'storeSettingFieldInsertBindTask',
), ),
'dkim_keylength' => array( 'dkim_keylength' => array(
'label' => array( 'label' => $lng['dkim']['dkim_keylength'],
'title' => $lng['dkim']['dkim_keylength']['title'],
'description' => sprintf($lng['dkim']['dkim_keylength']['description'],$settings['dkim']['dkim_prefix'])
),
'settinggroup' => 'dkim', 'settinggroup' => 'dkim',
'varname' => 'dkim_keylength', 'varname' => 'dkim_keylength',
'type' => 'option', 'type' => 'option',

View File

@@ -12,7 +12,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -133,7 +133,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => 2, 'default' => 2,
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array(1 => $lng['ticket']['high'], 2 => $lng['ticket']['normal'], 3 => $lng['ticket']['low']), 'option_options' => array(1 => $lng['ticket']['unf_high'], 2 => $lng['ticket']['unf_normal'], 3 => $lng['ticket']['unf_low']),
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
), ),

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -59,7 +59,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => '', 'default' => '',
'option_mode' => 'multiple', 'option_mode' => 'multiple',
'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring', 'Zend Optimizer' => 'Zend Guard'), 'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring'),
'save_method' => 'storeSettingApsPhpExtensions', 'save_method' => 'storeSettingApsPhpExtensions',
), ),
'aps_php-function' => array( 'aps_php-function' => array(

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings * @package Settings
* * @version $Id$
*/ */
return array( return array(
@@ -38,17 +38,9 @@ return array(
'default' => true, 'default' => true,
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_passwordcryptfunc' => array( ),
'label' => $lng['serversettings']['passwordcryptfunc'], ),
'settinggroup' => 'system', ),
'varname' => 'passwordcryptfunc',
'type' => 'option',
'default' => 0,
'option_mode' => 'one',
'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
'save_method' => 'storeSettingField',
)
)
)
)
); );
?>

View File

@@ -1,118 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'backup' => array(
'title' => $lng['backup'],
'fields' => array(
'backup_enabled' => array(
'label' => $lng['serversettings']['backup_enabled'],
'settinggroup' => 'system',
'varname' => 'backup_enabled',
'type' => 'bool',
'default' => false,
'cronmodule' => 'froxlor/backup',
'save_method' => 'storeSettingField',
'overview_option' => true
),
'backup_dir' => array(
'label' => $lng['serversettings']['backupdir']['description'],
'settinggroup' => 'system',
'varname' => 'backup_dir',
'type' => 'string',
'string_type' => 'dir',
'default' => '/var/customers/backups/',
'string_regexp' => '#^/.*/$#',
'save_method' => 'storeSettingField',
),
'backup_mysqldump_path' => array(
'label' => $lng['serversettings']['mysqldump_path']['description'],
'settinggroup' => 'system',
'varname' => 'backup_mysqldump_path',
'type' => 'string',
'default' => '/usr/bin/mysqldump',
'save_method' => 'storeSettingField',
),
'backup_count' => array(
'label' => $lng['serversettings']['backup_count'],
'settinggroup' => 'system',
'varname' => 'backup_count',
'type' => 'bool',
'default' => 'true',
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_bigfile' => array(
'label' => $lng['serversettings']['backup_bigfile'],
'settinggroup' => 'system',
'varname' => 'backup_bigfile',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_ftp_enabled_' => array(
'label' => $lng['serversettings']['backup_ftp_enabled'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => false
),
'backup_server' => array(
'label' => $lng['serversettings']['backup_ftp_server'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_server',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_user' => array(
'label' => $lng['serversettings']['backup_ftp_user'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_user',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_pass' => array(
'label' => $lng['serversettings']['backup_ftp_pass'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_pass',
'type' => 'hiddenstring',
'default' => '',
'save_method' => 'storeSettingField',
),
'backup_passive_mode' => array(
'label' => $lng['serversettings']['backup_ftp_passive_mode'],
'settinggroup' => 'system',
'varname' => 'backup_ftp_passive',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField',
'overview_option' => false,
),
),
),
),
);
?>

View File

@@ -1,60 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2011- the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2011-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Settings
*
*/
return array(
'groups' => array(
'diskquota' => array(
'title' => $lng['diskquota'],
'fields' => array(
'diskquota_enabled' => array(
'label' => $lng['serversettings']['diskquota_enabled'],
'settinggroup' => 'system',
'varname' => 'diskquota_enabled',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField',
'overview_option' => true
),
'diskquota_repquota_path' => array(
'label' => $lng['serversettings']['diskquota_repquota_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_repquota_path',
'type' => 'string',
'default' => '/usr/sbin/repquota',
'save_method' => 'storeSettingField',
),
'diskquota_quotatool_path' => array(
'label' => $lng['serversettings']['diskquota_quotatool_path']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_quotatool_path',
'type' => 'string',
'default' => '/usr/bin/quotatool',
'save_method' => 'storeSettingField',
),
'diskquota_customer_partition' => array(
'label' => $lng['serversettings']['diskquota_customer_partition']['description'],
'settinggroup' => 'system',
'varname' => 'diskquota_customer_partition',
'type' => 'string',
'default' => '/dev/root',
'save_method' => 'storeSettingField',
),
),
),
),
);
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -47,6 +47,24 @@ if($page == 'admins'
'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')', 'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
'traffic' => $lng['customer']['traffic'], 'traffic' => $lng['customer']['traffic'],
'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')', 'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
'mysqls' => $lng['customer']['mysqls'],
'mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
'ftps' => $lng['customer']['ftps'],
'ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
'tickets' => $lng['customer']['tickets'],
'tickets_used' => $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')',
'subdomains' => $lng['customer']['subdomains'],
'subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
'emails' => $lng['customer']['emails'],
'emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
'email_accounts' => $lng['customer']['accounts'],
'email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
'email_forwarders' => $lng['customer']['forwarders'],
'email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
'email_quota' => $lng['customer']['email_quota'],
'email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
'email_autoresponder' => $lng['customer']['autoresponder'],
'email_autoresponder_used' => $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')',
'deactivated' => $lng['admin']['deactivated'] 'deactivated' => $lng['admin']['deactivated']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
@@ -68,29 +86,6 @@ if($page == 'admins'
$row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']); $row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
$row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']); $row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']); $row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
/**
* percent-values for progressbar
*/
//For Disk usage
if ($row['diskspace'] > 0) {
$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
$disk_doublepercent = round($disk_percent*2, 2);
} else {
$disk_percent = 0;
$disk_doublepercent = 0;
}
//For Traffic usage
if ($row['traffic'] > 0) {
$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
$traffic_doublepercent = round($traffic_percent*2, 2);
} else {
$traffic_percent = 0;
$traffic_doublepercent = 0;
}
/* */
$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets'); $row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets');
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";"); eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";");
@@ -271,7 +266,7 @@ if($page == 'admins'
$number_of_aps_packages = - 1; $number_of_aps_packages = - 1;
} }
$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0; $can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
} }
else else
{ {
@@ -279,21 +274,10 @@ if($page == 'admins'
$can_manage_aps_packages = 0; $can_manage_aps_packages = 0;
} }
$customers_see_all = 0; $customers_see_all = intval($_POST['customers_see_all']);
if(isset($_POST['customers_see_all'])) $domains_see_all = intval($_POST['domains_see_all']);
$customers_see_all = intval($_POST['customers_see_all']); $caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = intval($_POST['change_serversettings']);
$domains_see_all = 0;
if(isset($_POST['domains_see_all']))
$domains_see_all = intval($_POST['domains_see_all']);
$caneditphpsettings = 0;
if(isset($_POST['caneditphpsettings']))
$caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = 0;
if(isset($_POST['change_serversettings']))
$change_serversettings = intval($_POST['change_serversettings']);
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
@@ -309,10 +293,6 @@ if($page == 'admins'
$traffic = - 1; $traffic = - 1;
} }
$tickets_see_all = 0;
if(isset($_POST['tickets_see_all']))
$tickets_see_all = intval($_POST['tickets_see_all']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
$ipaddress = intval_ressource($_POST['ipaddress']); $ipaddress = intval_ressource($_POST['ipaddress']);
@@ -380,43 +360,8 @@ if($page == 'admins'
$change_serversettings = '0'; $change_serversettings = '0';
} }
if ($tickets_see_all != '1') { $result = $db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` (`loginname`, `password`, `name`, `email`, `def_language`, `change_serversettings`, `customers`, `customers_see_all`, `domains`, `domains_see_all`, `caneditphpsettings`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `ip`, `can_manage_aps_packages`, `aps_packages`, `email_autoresponder`)
$tickets_see_all = '0'; VALUES ('" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($email) . "','" . $db->escape($def_language) . "', '" . $db->escape($change_serversettings) . "', '" . $db->escape($customers) . "', '" . $db->escape($customers_see_all) . "', '" . $db->escape($domains) . "', '" . $db->escape($domains_see_all) . "', '" . (int)$caneditphpsettings . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '" . (int)$ipaddress . "', " . (int)$can_manage_aps_packages . ", " . (int)$number_of_aps_packages . ", " . $db->escape($email_autoresponder) . ")");
}
$_theme = $settings['panel']['default_theme'];
$result = $db->query("INSERT INTO
`" . TABLE_PANEL_ADMINS . "`
SET
`loginname` = '" . $db->escape($loginname) . "',
`password` = '" . md5($password) . "',
`name` = '" . $db->escape($name) . "',
`email` = '" . $db->escape($email) . "',
`def_language` = '" . $db->escape($def_language) . "',
`change_serversettings` = '" . $db->escape($change_serversettings) . "',
`customers` = '" . $db->escape($customers) . "',
`customers_see_all` = '" . $db->escape($customers_see_all) . "',
`domains` = '" . $db->escape($domains) . "',
`domains_see_all` = '" . $db->escape($domains_see_all) . "',
`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
`diskspace` = '" . $db->escape($diskspace) . "',
`traffic` = '" . $db->escape($traffic) . "',
`subdomains` = '" . $db->escape($subdomains) . "',
`emails` = '" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders` = '" . $db->escape($email_forwarders) . "',
`email_quota` = '" . $db->escape($email_quota) . "',
`ftps` = '" . $db->escape($ftps) . "',
`tickets` = '" . $db->escape($tickets) . "',
`tickets_see_all` = '" . $db->escape($tickets_see_all) . "',
`mysqls` = '" . $db->escape($mysqls) . "',
`ip` = '" . (int)$ipaddress . "',
`can_manage_aps_packages` = '" . (int)$can_manage_aps_packages . "',
`aps_packages` = '" . (int)$number_of_aps_packages . "',
`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
`theme` = '".$db->escape($_theme)."';
");
$adminid = $db->insert_id(); $adminid = $db->insert_id();
$log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -462,21 +407,13 @@ if($page == 'admins'
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
/*
$change_serversettings = makeyesno('change_serversettings', '1', '0', '0'); $change_serversettings = makeyesno('change_serversettings', '1', '0', '0');
$customers_see_all = makeyesno('customers_see_all', '1', '0', '0'); $customers_see_all = makeyesno('customers_see_all', '1', '0', '0');
$domains_see_all = makeyesno('domains_see_all', '1', '0', '0'); $domains_see_all = makeyesno('domains_see_all', '1', '0', '0');
$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0'); $caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0');
$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0'); $can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0');
*/
$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$admin_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_add.php';
$admin_add_form = htmlform::genHTMLForm($admin_add_data);
$title = $admin_add_data['admin_add']['title'];
$image = $admin_add_data['admin_add']['image'];
eval("echo \"" . getTemplate("admins/admins_add") . "\";"); eval("echo \"" . getTemplate("admins/admins_add") . "\";");
} }
} }
@@ -509,7 +446,6 @@ if($page == 'admins'
$ftps = $result['ftps']; $ftps = $result['ftps'];
$tickets = $result['tickets']; $tickets = $result['tickets'];
$mysqls = $result['mysqls']; $mysqls = $result['mysqls'];
$tickets_see_all = $result['tickets_see_all'];
$customers_see_all = $result['customers_see_all']; $customers_see_all = $result['customers_see_all'];
$domains_see_all = $result['domains_see_all']; $domains_see_all = $result['domains_see_all'];
$caneditphpsettings = $result['caneditphpsettings']; $caneditphpsettings = $result['caneditphpsettings'];
@@ -524,113 +460,130 @@ if($page == 'admins'
{ {
$password = validate($_POST['admin_password'], 'new password'); $password = validate($_POST['admin_password'], 'new password');
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$deactivated = isset($_POST['deactivated']) ? 1 : 0; $deactivated = intval($_POST['deactivated']);
$customers = intval_ressource($_POST['customers']); $customers = intval_ressource($_POST['customers']);
if (isset($_POST['customers_ul'])) {
$customers = -1; if(isset($_POST['customers_ul']))
{
$customers = - 1;
} }
$domains = intval_ressource($_POST['domains']); $domains = intval_ressource($_POST['domains']);
if (isset($_POST['domains_ul'])) {
$domains = -1; if(isset($_POST['domains_ul']))
{
$domains = - 1;
} }
$subdomains = intval_ressource($_POST['subdomains']); $subdomains = intval_ressource($_POST['subdomains']);
if (isset($_POST['subdomains_ul'])) {
$subdomains = -1; if(isset($_POST['subdomains_ul']))
{
$subdomains = - 1;
} }
$emails = intval_ressource($_POST['emails']); $emails = intval_ressource($_POST['emails']);
if (isset($_POST['emails_ul'])) {
$emails = -1; if(isset($_POST['emails_ul']))
{
$emails = - 1;
} }
$email_accounts = intval_ressource($_POST['email_accounts']); $email_accounts = intval_ressource($_POST['email_accounts']);
if (isset($_POST['email_accounts_ul'])) {
$email_accounts = -1; if(isset($_POST['email_accounts_ul']))
{
$email_accounts = - 1;
} }
$email_forwarders = intval_ressource($_POST['email_forwarders']); $email_forwarders = intval_ressource($_POST['email_forwarders']);
if (isset($_POST['email_forwarders_ul'])) {
$email_forwarders = -1; if(isset($_POST['email_forwarders_ul']))
{
$email_forwarders = - 1;
} }
if ($settings['system']['mail_quota_enabled'] == '1') { if($settings['system']['mail_quota_enabled'] == '1')
{
$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', '')); $email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
if (isset($_POST['email_quota_ul'])) {
$email_quota = -1; if(isset($_POST['email_quota_ul']))
{
$email_quota = - 1;
} }
} else { }
$email_quota = -1; else
{
$email_quota = - 1;
} }
if ($settings['autoresponder']['autoresponder_active'] == '1') { if($settings['autoresponder']['autoresponder_active'] == '1')
{
$email_autoresponder = intval_ressource($_POST['email_autoresponder']); $email_autoresponder = intval_ressource($_POST['email_autoresponder']);
if (isset($_POST['email_autoresponder_ul'])) {
$email_autoresponder = -1; if(isset($_POST['email_autoresponder_ul']))
{
$email_autoresponder = - 1;
} }
} else { }
else
{
$email_autoresponder = 0; $email_autoresponder = 0;
} }
$ftps = intval_ressource($_POST['ftps']); $ftps = intval_ressource($_POST['ftps']);
if (isset($_POST['ftps_ul'])) {
$ftps = -1; if(isset($_POST['ftps_ul']))
{
$ftps = - 1;
} }
if ($settings['ticket']['enabled'] == 1) { if($settings['ticket']['enabled'] == 1)
{
$tickets = intval_ressource($_POST['tickets']); $tickets = intval_ressource($_POST['tickets']);
if (isset($_POST['tickets_ul'])) {
$tickets = -1; if(isset($_POST['tickets_ul']))
{
$tickets = - 1;
} }
} else { }
else
{
$tickets = 0; $tickets = 0;
} }
$mysqls = intval_ressource($_POST['mysqls']); $mysqls = intval_ressource($_POST['mysqls']);
if (isset($_POST['mysqls_ul'])) {
if(isset($_POST['mysqls_ul']))
{
$mysqls = - 1; $mysqls = - 1;
} }
if ($settings['aps']['aps_active'] == '1') { $number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
if (isset($_POST['number_of_aps_packages_ul'])) { if(isset($_POST['number_of_aps_packages_ul']))
$number_of_aps_packages = -1; {
} $number_of_aps_packages = - 1;
$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
} else {
$number_of_aps_packages = 0;
} }
$customers_see_all = 0; $customers_see_all = intval($_POST['customers_see_all']);
if(isset($_POST['customers_see_all'])) $domains_see_all = intval($_POST['domains_see_all']);
$customers_see_all = intval($_POST['customers_see_all']); $caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = intval($_POST['change_serversettings']);
$domains_see_all = 0; $can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
if(isset($_POST['domains_see_all']))
$domains_see_all = intval($_POST['domains_see_all']);
$caneditphpsettings = 0;
if(isset($_POST['caneditphpsettings']))
$caneditphpsettings = intval($_POST['caneditphpsettings']);
$change_serversettings = 0;
if(isset($_POST['change_serversettings']))
$change_serversettings = isset($_POST['change_serversettings']) ? 1 : 0;
$tickets_see_all = 0;
if (isset($_POST['tickets_see_all']))
$tickets_see_all = intval($_POST['tickets_see_all']);
$diskspace = intval($_POST['diskspace']); $diskspace = intval($_POST['diskspace']);
if (isset($_POST['diskspace_ul'])) {
$diskspace = -1; if(isset($_POST['diskspace_ul']))
{
$diskspace = - 1;
} }
$traffic = doubleval_ressource($_POST['traffic']); $traffic = doubleval_ressource($_POST['traffic']);
if (isset($_POST['traffic_ul'])) {
$traffic = -1; if(isset($_POST['traffic_ul']))
{
$traffic = - 1;
} }
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
@@ -687,88 +640,7 @@ if($page == 'admins'
$change_serversettings = '0'; $change_serversettings = '0';
} }
if ($tickets_see_all != '1') { $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `name`='" . $db->escape($name) . "', `email`='" . $db->escape($email) . "', `def_language`='" . $db->escape($def_language) . "', `change_serversettings` = '" . $db->escape($change_serversettings) . "', `customers` = '" . $db->escape($customers) . "', `customers_see_all` = '" . $db->escape($customers_see_all) . "', `domains` = '" . $db->escape($domains) . "', `domains_see_all` = '" . $db->escape($domains_see_all) . "', `caneditphpsettings` = '" . (int)$caneditphpsettings . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `email_quota`='" . $db->escape($email_quota) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `ip`='" . (int)$ipaddress . "', `deactivated`='" . $db->escape($deactivated) . "', `can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ", `aps_packages`=" . (int)$number_of_aps_packages . " WHERE `adminid`='" . $db->escape($id) . "'");
$tickets_see_all = '0';
}
// check if a resource was set to something lower
// than actually used by the admin/reseller
$res_warning = "";
if ($customers != $result['customers'] && $customers < $result['customers_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'customers');
}
if ($domains != $result['domains'] && $domains < $result['domains_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'domains');
}
if ($diskspace != $result['diskspace'] && ($diskspace / 1024) != -1 && $diskspace < $result['diskspace_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'diskspace');
}
if ($traffic != $result['traffic'] && ($traffic / 1024 / 1024) != -1 && $traffic < $result['traffic_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'traffic');
}
if ($emails != $result['emails'] && $emails < $result['emails_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'emails');
}
if ($email_accounts != $result['email_accounts'] && $email_accounts < $result['email_accounts_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email accounts');
}
if ($email_forwarders != $result['email_forwarders'] && $email_forwarders < $result['email_forwarders_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email forwarders');
}
if ($email_quota != $result['email_quota'] && $email_quota < $result['email_quota_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email quota');
}
if ($email_autoresponder != $result['email_autoresponder'] && $email_autoresponder < $result['email_autoresponder_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email autoresponder');
}
if ($ftps != $result['ftps'] && $ftps < $result['ftps_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'ftps');
}
if ($tickets != $result['tickets'] && $tickets < $result['tickets_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'tickets');
}
if ($mysqls != $result['mysqls'] && $mysqls < $result['mysqls_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'mysqls');
}
if ($number_of_aps_packages != $result['aps_packages'] && $number_of_aps_packages < $result['aps_packages_used']) {
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'aps packages');
}
if ($res_warning != "") {
$link = '';
$error = $res_warning;
eval("echo \"" . getTemplate('misc/error', '1') . "\";");
exit;
}
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET
`name`='" . $db->escape($name) . "',
`email`='" . $db->escape($email) . "',
`def_language`='" . $db->escape($def_language) . "',
`change_serversettings` = '" . $db->escape($change_serversettings) . "',
`customers` = '" . $db->escape($customers) . "',
`customers_see_all` = '" . $db->escape($customers_see_all) . "',
`domains` = '" . $db->escape($domains) . "',
`domains_see_all` = '" . $db->escape($domains_see_all) . "',
`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
`password` = '" . $password . "',
`diskspace`='" . $db->escape($diskspace) . "',
`traffic`='" . $db->escape($traffic) . "',
`subdomains`='" . $db->escape($subdomains) . "',
`emails`='" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders`='" . $db->escape($email_forwarders) . "',
`email_quota`='" . $db->escape($email_quota) . "',
`email_autoresponder`='" . $db->escape($email_autoresponder) . "',
`ftps`='" . $db->escape($ftps) . "',
`tickets`='" . $db->escape($tickets) . "',
`tickets_see_all`='".$db->escape($tickets_see_all) . "',
`mysqls`='" . $db->escape($mysqls) . "',
`ip`='" . (int)$ipaddress . "',
`deactivated`='" . $db->escape($deactivated) . "',
`can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ",
`aps_packages`=" . (int)$number_of_aps_packages . "
WHERE `adminid`='" . $db->escape($id) . "'");
$log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'");
$redirect_props = Array( $redirect_props = Array(
'page' => $page, 'page' => $page,
@@ -906,22 +778,14 @@ if($page == 'admins'
} }
} }
/*
$change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']); $change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']);
$customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']); $customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']);
$domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']); $domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']);
$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']); $caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']);
$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']); $deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']); $can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']);
*/
$result = htmlentities_array($result); $result = htmlentities_array($result);
$admin_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_edit.php';
$admin_edit_form = htmlform::genHTMLForm($admin_edit_data);
$title = $admin_edit_data['admin_edit']['title'];
$image = $admin_edit_data['admin_edit']['image'];
eval("echo \"" . getTemplate("admins/admins_edit") . "\";"); eval("echo \"" . getTemplate("admins/admins_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
// Required code // Required code

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -97,10 +97,7 @@ if($userinfo['change_serversettings'] == '1')
'<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'], '<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'],
'<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '', '<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '',
'<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? makeCorrectDir($settings['system']['mod_fcgid_tmpdir']) : '/tmp/', '<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? makeCorrectDir($settings['system']['mod_fcgid_tmpdir']) : '/tmp/',
'<BASE_PATH>' => makeCorrectDir(dirname(__FILE__)), '<BASE_PATH>' => makeCorrectDir(dirname(__FILE__))
'<BIND_CONFIG_PATH>' => makeCorrectDir($settings['system']['bindconf_directory']),
'<WEBSERVER_RELOAD_CMD>' => $settings['system']['apachereload_command'],
'<CUSTOMER_LOGS>' => makeCorrectDir($settings['system']['logfiles_directory'])
); );
$files = ''; $files = '';
$configpage = ''; $configpage = '';

View File

@@ -12,21 +12,28 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
require_once('./lib/init.php');
if (isset($_POST['id'])) { require_once("./lib/init.php");
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'cronjobs' || $page == 'overview') { if($page == 'cronjobs'
if ($action == '') { || $page == 'overview')
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs'); {
if($action == '')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_cronjobs");
$fields = array( $fields = array(
'c.lastrun' => $lng['cron']['lastrun'], 'c.lastrun' => $lng['cron']['lastrun'],
@@ -49,41 +56,61 @@ if ($page == 'cronjobs' || $page == 'overview') {
$i = 0; $i = 0;
$count = 0; $count = 0;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($paging->checkDisplay($i)) { {
if($paging->checkDisplay($i))
{
$row = htmlentities_array($row); $row = htmlentities_array($row);
$row['lastrun'] = date('d.m.Y H:i', $row['lastrun']); $row['lastrun'] = date('d.m.Y H:i', $row['lastrun']);
$row['isactive'] = ((int)$row['isactive'] == 1) ? $lng['panel']['yes'] : $lng['panel']['no'];
if((int)$row['isactive'] == 1)
{
$row['isactive'] = $lng['panel']['yes'];
}
else
{
$row['isactive'] = $lng['panel']['no'];
}
$description = $lng['crondesc'][$row['desc_lng_key']]; $description = $lng['crondesc'][$row['desc_lng_key']];
eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjob') . "\";"); eval("\$crons.=\"" . getTemplate("cronjobs/cronjobs_cronjob") . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate('cronjobs/cronjobs') . "\";"); eval("echo \"" . getTemplate("cronjobs/cronjobs") . "\";");
} elseif ($action == 'new') { }
elseif($action == 'new')
{
/* /*
* @TODO later * @TODO later
*/ */
} elseif ($action == 'edit' && $id != 0) { }
elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'");
if ($result['cronfile'] != '') {
if (isset($_POST['send']) && $_POST['send'] == 'send') { if ($result['cronfile'] != '')
$isactive = isset($_POST['isactive']) ? 1 : 0; {
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$isactive = intval($_POST['isactive']);
$interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty'); $interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty');
$interval_interval = validate($_POST['interval_interval'], 'interval_interval'); $interval_interval = validate($_POST['interval_interval'], 'interval_interval');
if ($isactive != 1) { if($isactive != 1)
{
$isactive = 0; $isactive = 0;
} }
$interval = $interval_value . ' ' . strtoupper($interval_interval); $interval = $interval_value.' '.strtoupper($interval_interval);
$db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "` $db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "`
SET `isactive` = '".(int)$isactive."', SET `isactive` = '".(int)$isactive."',
@@ -91,39 +118,40 @@ if ($page == 'cronjobs' || $page == 'overview') {
WHERE `id` = '" . (int)$id . "'"); WHERE `id` = '" . (int)$id . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
//$isactive = makeyesno('isactive', '1', '0', $result['isactive']); else
{
$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
// interval // interval
$interval_nfo = explode(' ', $result['interval']); $interval_nfo = explode(' ', $result['interval']);
$interval_value = $interval_nfo[0]; $interval_value = $interval_nfo[0];
$interval_interval = ''; $interval_interval = '';
$interval_interval .= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
$interval_interval .= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]); $interval_interval.= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
// end of interval // end of interval
$change_cronfile = false; $change_cronfile = false;
if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor') { if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor')
{
$change_cronfile = true; $change_cronfile = true;
} }
$cronjobs_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/cronjobs/formfield.cronjobs_edit.php'; eval("echo \"" . getTemplate("cronjobs/cronjob_edit") . "\";");
$cronjobs_edit_form = htmlform::genHTMLForm($cronjobs_edit_data);
$title = $cronjobs_edit_data['cronjobs_edit']['title'];
$image = $cronjobs_edit_data['cronjobs_edit']['image'];
eval("echo \"" . getTemplate('cronjobs/cronjob_edit') . "\";");
} }
} }
} }
elseif ($action == 'delete' && $id != 0) { elseif($action == 'delete'
&& $id != 0)
{
/* /*
* @TODO later * @TODO later
*/ */
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -40,30 +40,52 @@ if($page == 'customers'
{ {
if($action == '') if($action == '')
{ {
// clear request data
unset($_SESSION['requestData']);
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers"); $log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers");
$fields = array( $fields = array(
'c.loginname' => $lng['login']['username'], 'c.loginname' => $lng['login']['username'],
'a.loginname' => $lng['admin']['admin'], 'a.loginname' => $lng['admin']['admin'],
'c.name' => $lng['customer']['name'], 'c.name' => $lng['customer']['name'],
'c.email' => $lng['customer']['email'],
'c.firstname' => $lng['customer']['firstname'], 'c.firstname' => $lng['customer']['firstname'],
'c.company' => $lng['customer']['company'], 'c.company' => $lng['customer']['company'],
'c.diskspace' => $lng['customer']['diskspace'], 'c.diskspace' => $lng['customer']['diskspace'],
'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')', 'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
'c.traffic' => $lng['customer']['traffic'], 'c.traffic' => $lng['customer']['traffic'],
'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')' 'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
'c.mysqls' => $lng['customer']['mysqls'],
'c.mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
'c.ftps' => $lng['customer']['ftps'],
'c.ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
'c.subdomains' => $lng['customer']['subdomains'],
'c.subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
'c.emails' => $lng['customer']['emails'],
'c.emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
'c.email_accounts' => $lng['customer']['accounts'],
'c.email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
'c.email_forwarders' => $lng['customer']['forwarders'],
'c.email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
'c.email_quota' => $lng['customer']['email_quota'],
'c.email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
'c.deactivated' => $lng['admin']['deactivated'],
'c.lastlogin_succ' => $lng['admin']['lastlogin_succ'],
'c.phpenabled' => $lng['admin']['phpenabled'],
'c.perlenabled' => $lng['admin']['perlenabled']
); );
if ($settings['system']['backup_enabled'] == '1') { if($settings['ticket']['enabled'] == 1)
$field['c.backup_allowed'] = $lng['backup_allowed']; {
$fields['c.tickets'] = $lng['customer']['tickets'];
$fields['c.tickets_used'] = $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')';
}
if($settings['autoresponder']['autoresponder_active'] == 1)
{
$fields['c.email_autoresponder'] = $lng['customer']['autoresponder'];
$fields['c.email_autoresponder_used'] = $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')';
} }
$paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$customers = ''; $customers = '';
$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy($settings['panel']['natsorting']) . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng, true); $sortcode = $paging->getHtmlSortCode($lng, true);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -84,31 +106,13 @@ if($page == 'customers'
$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']); $row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
$last_login = ((int)$row['lastlogin_succ'] == 0) ? $lng['panel']['neverloggedin'] : date('d.m.Y', $row['lastlogin_succ']); $last_login = ((int)$row['lastlogin_succ'] == 0) ? $lng['panel']['neverloggedin'] : date('d.m.Y', $row['lastlogin_succ']);
/** $column_style = '';
* percent-values for progressbar $unlock_link = '';
*/
//For Disk usage
if ($row['diskspace'] > 0) {
$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
$disk_doublepercent = round($disk_percent*2, 2);
} else {
$disk_percent = 0;
$disk_doublepercent = 0;
}
if ($row['traffic'] > 0) {
$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
$traffic_doublepercent = round($traffic_percent*2, 2);
} else {
$traffic_percent = 0;
$traffic_doublepercent = 0;
}
$islocked = 0;
if($row['loginfail_count'] >= $settings['login']['maxloginattempts'] if($row['loginfail_count'] >= $settings['login']['maxloginattempts']
&& $row['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']) && $row['lastlogin_fail'] > (time() - $settings['login']['deactivatetime'])
) { ) {
$islocked = 1; $column_style = ' style="background-color: #f99122;"';
$unlock_link = '<a href="'.$filename.'?s='.$s.'&amp;page='.$page.'&amp;action=unlock&amp;id='.$row['customerid'].'">'.$lng['panel']['unlock'].'</a><br />';
} }
$row = str_replace_array('-1', 'UL', $row, 'diskspace traffic mysqls emails email_accounts email_forwarders ftps tickets subdomains email_autoresponder'); $row = str_replace_array('-1', 'UL', $row, 'diskspace traffic mysqls emails email_accounts email_forwarders ftps tickets subdomains email_autoresponder');
@@ -131,14 +135,11 @@ if($page == 'customers'
if($destination_user != '') if($destination_user != '')
{ {
if ($result['deactivated'] == '1') {
standard_error("usercurrentlydeactivated", $destination_user);
}
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'");
$s = md5(uniqid(microtime(), 1)); $s = md5(uniqid(microtime(), 1));
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')"); $db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
$log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'");
redirectTo('customer_index.php', Array('s' => $s), true); redirectTo('customer_index.php', Array('s' => $s));
} }
else else
{ {
@@ -182,6 +183,7 @@ if($page == 'customers'
{ {
$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`"); $databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], ''); $db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
unset($db_root->password);
$last_dbserver = 0; $last_dbserver = 0;
while($row_database = $db->fetch_array($databases)) while($row_database = $db->fetch_array($databases))
@@ -191,20 +193,16 @@ if($page == 'customers'
$db_root->query('FLUSH PRIVILEGES;'); $db_root->query('FLUSH PRIVILEGES;');
$db_root->close(); $db_root->close();
$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], ''); $db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
unset($db_root->password);
$last_dbserver = $row_database['dbserver']; $last_dbserver = $row_database['dbserver'];
} }
if(mysql_get_server_info() < '5.0.2') { foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
}
$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($row_database['databasename']) . "'");
while($host = $db_root->fetch_array($host_res))
{ {
// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+) $mysql_access_host = trim($mysql_access_host);
$db_root->query('DROP USER \'' . $db_root->escape($row_database['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true); $db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($row_database['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
} }
$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`'); $db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`');
@@ -280,7 +278,7 @@ if($page == 'customers'
if($result['email_autoresponder'] != '-1') if($result['email_autoresponder'] != '-1')
{ {
$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` - 0" . (int)$result['email_autoresponder']; $admin_update_query.= ", `email_autoresponder` = `email_autoresponder` - 0" . (int)$result['email_autoresponder'];
} }
if($result['subdomains'] != '-1') if($result['subdomains'] != '-1')
@@ -300,7 +298,7 @@ if($page == 'customers'
if($result['aps_packages'] != '-1') if($result['aps_packages'] != '-1')
{ {
$admin_update_query.= ", `aps_packages_used` = `aps_packages_used` - 0" . (int)$result['aps_packages']; $admin_update_query.= ", `aps_packages` = `aps_packages` - 0" . (int)$result['aps_packages'];
} }
if(($result['diskspace'] / 1024) != '-1') if(($result['diskspace'] / 1024) != '-1')
@@ -312,19 +310,14 @@ if($page == 'customers'
$db->query($admin_update_query); $db->query($admin_update_query);
$log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
if (isset($_POST['delete_userfiles']) if(isset($_POST['delete_userfiles'])
&& (int)$_POST['delete_userfiles'] == 1 && (int)$_POST['delete_userfiles'] == 1)
) { {
inserttask('6', $result['loginname']); inserttask('6', $result['loginname']);
} }
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
/* /*
* move old tickets to archive * move old tickets to archive
*/ */
@@ -372,7 +365,6 @@ if($page == 'customers'
$customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di'); $customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di');
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
$gender = intval_ressource($_POST['gender']);
if(isset($_POST['diskspace_ul'])) if(isset($_POST['diskspace_ul']))
{ {
@@ -442,17 +434,9 @@ if($page == 'customers'
$email_autoresponder = 0; $email_autoresponder = 0;
} }
$email_imap = 0; $email_imap = intval_ressource($_POST['email_imap']);
if(isset($_POST['email_imap'])) $email_pop3 = intval_ressource($_POST['email_pop3']);
$email_imap = intval_ressource($_POST['email_imap']); $ftps = intval_ressource($_POST['ftps']);
$email_pop3 = 0;
if(isset($_POST['email_pop3']))
$email_pop3 = intval_ressource($_POST['email_pop3']);
$ftps = 0;
if(isset($_POST['ftps']))
$ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['ftps_ul'])) if(isset($_POST['ftps_ul']))
{ {
@@ -488,9 +472,7 @@ if($page == 'customers'
$number_of_aps_packages = 0; $number_of_aps_packages = 0;
} }
$createstdsubdomain = 0; $createstdsubdomain = intval($_POST['createstdsubdomain']);
if(isset($_POST['createstdsubdomain']))
$createstdsubdomain = intval($_POST['createstdsubdomain']);
$password = validate($_POST['new_customer_password'], 'password'); $password = validate($_POST['new_customer_password'], 'password');
// only check if not empty, // only check if not empty,
// cause empty == generate password automatically // cause empty == generate password automatically
@@ -498,37 +480,10 @@ if($page == 'customers'
{ {
$password = validatePassword($password); $password = validatePassword($password);
} }
$sendpassword = intval($_POST['sendpassword']);
$backup_allowed = 0; $phpenabled = intval($_POST['phpenabled']);
if(isset($_POST['backup_allowed'])) $perlenabled = intval($_POST['perlenabled']);
$backup_allowed = intval($_POST['backup_allowed']); $store_defaultindex = intval($_POST['store_defaultindex']);
if ($backup_allowed != 0)
{
$backup_allowed = 1;
}
// gender out of range? [0,2]
if ($gender < 0 || $gender > 2) {
$gender = 0;
}
$sendpassword = 0;
if(isset($_POST['sendpassword']))
$sendpassword = intval($_POST['sendpassword']);
$phpenabled = 0;
if(isset($_POST['phpenabled']))
$phpenabled = intval($_POST['phpenabled']);
$perlenabled = 0;
if(isset($_POST['perlenabled']))
$perlenabled = intval($_POST['perlenabled']);
$store_defaultindex = 0;
if(isset($_POST['store_defaultindex']))
$store_defaultindex = intval($_POST['store_defaultindex']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
@@ -593,11 +548,6 @@ if($page == 'customers'
{ {
standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']); standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
} }
//Additional filtering for Bug #962
if(function_exists('posix_getpwnam') && !in_array("posix_getpwnam",explode(",",ini_get('disable_functions'))) && posix_getpwnam($loginname)) {
standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
}
} }
else else
{ {
@@ -648,47 +598,7 @@ if($page == 'customers'
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} }
$_theme = $settings['panel']['default_theme']; $result = $db->query("INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` (`adminid`, `loginname`, `password`, `name`, `firstname`, `company`, `street`, `zipcode`, `city`, `phone`, `fax`, `email`, `customernumber`, `def_language`, `documentroot`, `guid`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `standardsubdomain`, `phpenabled`, `imap`, `pop3`, `aps_packages`, `perlenabled`, `email_autoresponder`) VALUES ('" . (int)$userinfo['adminid'] . "', '" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($firstname) . "', '" . $db->escape($company) . "', '" . $db->escape($street) . "', '" . $db->escape($zipcode) . "', '" . $db->escape($city) . "', '" . $db->escape($phone) . "', '" . $db->escape($fax) . "', '" . $db->escape($email) . "', '" . $db->escape($customernumber) . "','" . $db->escape($def_language) . "', '" . $db->escape($documentroot) . "', '" . $db->escape($guid) . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '0', '" . $db->escape($phpenabled) . "', '" . $db->escape($email_imap) . "', '" . $db->escape($email_pop3) . "', '" . (int)$number_of_aps_packages . "', '" . $db->escape($perlenabled) . "', '" . $db->escape($email_autoresponder) . "')");
$result = $db->query(
"INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` SET
`adminid` = '" . (int)$userinfo['adminid'] . "',
`loginname` = '" . $db->escape($loginname) . "',
`password` = '" . md5($password) . "',
`name` = '" . $db->escape($name) . "',
`firstname` = '" . $db->escape($firstname) . "',
`gender` = '" . (int)$gender . "',
`company` = '" . $db->escape($company) . "',
`street` = '" . $db->escape($street) . "',
`zipcode` = '" . $db->escape($zipcode) . "',
`city` = '" . $db->escape($city) . "',
`phone` = '" . $db->escape($phone) . "',
`fax` = '" . $db->escape($fax) . "',
`email` = '" . $db->escape($email) . "',
`customernumber` = '" . $db->escape($customernumber) . "',
`def_language` = '" . $db->escape($def_language) . "',
`documentroot` = '" . $db->escape($documentroot) . "',
`guid` = '" . $db->escape($guid) . "',
`diskspace` = '" . $db->escape($diskspace) . "',
`traffic` = '" . $db->escape($traffic) . "',
`subdomains` = '" . $db->escape($subdomains) . "',
`emails` = '" . $db->escape($emails) . "',
`email_accounts` = '" . $db->escape($email_accounts) . "',
`email_forwarders` = '" . $db->escape($email_forwarders) . "',
`email_quota` = '" . $db->escape($email_quota) . "',
`ftps` = '" . $db->escape($ftps) . "',
`tickets` = '" . $db->escape($tickets) . "',
`mysqls` = '" . $db->escape($mysqls) . "',
`standardsubdomain` = '0',
`phpenabled` = '" . $db->escape($phpenabled) . "',
`imap` = '" . $db->escape($email_imap) . "',
`pop3` = '" . $db->escape($email_pop3) . "',
`aps_packages` = '" . (int)$number_of_aps_packages . "',
`perlenabled` = '" . $db->escape($perlenabled) . "',
`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
`backup_allowed` = '" . $db->escape($backup_allowed) . "',
`theme` = '" . $db->escape($_theme) . "'"
);
$customerid = $db->insert_id(); $customerid = $db->insert_id();
$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1"; $admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1";
@@ -761,10 +671,8 @@ if($page == 'customers'
$log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'");
inserttask('2', $loginname, $guid, $guid, $store_defaultindex); inserttask('2', $loginname, $guid, $guid, $store_defaultindex);
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
// Add htpasswd for the webalizer stats // Add htpasswd for the webalizer stats
if(CRYPT_STD_DES == 1) if(CRYPT_STD_DES == 1)
{ {
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2); $saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
@@ -787,8 +695,7 @@ if($page == 'customers'
} }
inserttask('1'); inserttask('1');
$cryptPassword = makeCryptPassword($password); $result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')"); $result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')");
$result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')"); $result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'");
@@ -810,21 +717,17 @@ if($page == 'customers'
"`customerid` = '" . (int)$customerid . "', " . "`customerid` = '" . (int)$customerid . "', " .
"`adminid` = '" . (int)$userinfo['adminid'] . "', " . "`adminid` = '" . (int)$userinfo['adminid'] . "', " .
"`parentdomainid` = '-1', " . "`parentdomainid` = '-1', " .
"`ipandport` = '" . $db->escape($settings['system']['defaultip']) . "', " .
"`documentroot` = '" . $db->escape($documentroot) . "', " . "`documentroot` = '" . $db->escape($documentroot) . "', " .
"`zonefile` = '', " . "`zonefile` = '', " .
"`isemaildomain` = '0', " . "`isemaildomain` = '0', " .
"`caneditdomain` = '0', " . "`caneditdomain` = '0', " .
"`openbasedir` = '1', " . "`openbasedir` = '1', " .
"`safemode` = '1', " .
"`speciallogfile` = '0', " . "`speciallogfile` = '0', " .
"`specialsettings` = '', " . "`specialsettings` = '', " .
"`add_date` = '".date('Y-m-d')."'"); "`add_date` = '".date('Y-m-d')."'");
$domainid = $db->insert_id(); $domainid = $db->insert_id();
// set ip <-> domain connection
$db->query("INSERT INTO `".TABLE_DOMAINTOIP."` SET
`id_domain` = '".$domainid."',
`id_ipandports` = '".(int)$settings['system']['defaultip']."'"
);
$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$customerid . '\''); $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$customerid . '\'');
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $loginname . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $loginname . "'");
inserttask('1'); inserttask('1');
@@ -896,17 +799,13 @@ if($page == 'customers'
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true); $number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', '1');
$gender_options = makeoption($lng['gender']['undef'], 0, true, true, true); $email_imap = makeyesno('email_imap', '1', '0', '1');
$gender_options .= makeoption($lng['gender']['male'], 1, null, true, true); $email_pop3 = makeyesno('email_pop3', '1', '0', '1');
$gender_options .= makeoption($lng['gender']['female'], 2, null, true, true); $sendpassword = makeyesno('sendpassword', '1', '0', '1');
$phpenabled = makeyesno('phpenabled', '1', '0', '1');
$customer_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_add.php'; $perlenabled = makeyesno('perlenabled', '1', '0', '0');
$customer_add_form = htmlform::genHTMLForm($customer_add_data); $store_defaultindex = makeyesno('store_defaultindex', '1', '0', '1');
$title = $customer_add_data['customer_add']['title'];
$image = $customer_add_data['customer_add']['image'];
eval("echo \"" . getTemplate("customers/customers_add") . "\";"); eval("echo \"" . getTemplate("customers/customers_add") . "\";");
} }
} }
@@ -934,7 +833,6 @@ if($page == 'customers'
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
$password = validate($_POST['new_customer_password'], 'new password'); $password = validate($_POST['new_customer_password'], 'new password');
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
$gender = intval_ressource($_POST['gender']);
if(isset($_POST['diskspace_ul'])) if(isset($_POST['diskspace_ul']))
{ {
@@ -1004,17 +902,9 @@ if($page == 'customers'
$email_autoresponder = 0; $email_autoresponder = 0;
} }
$email_imap = 0; $email_imap = intval_ressource($_POST['email_imap']);
if(isset($_POST['email_imap'])) $email_pop3 = intval_ressource($_POST['email_pop3']);
$email_imap = intval_ressource($_POST['email_imap']); $ftps = intval_ressource($_POST['ftps']);
$email_pop3 = 0;
if(isset($_POST['email_pop3']))
$email_pop3 = intval_ressource($_POST['email_pop3']);
$ftps = 0;
if(isset($_POST['ftps']))
$ftps = intval_ressource($_POST['ftps']);
if(isset($_POST['ftps_ul'])) if(isset($_POST['ftps_ul']))
{ {
@@ -1029,22 +919,7 @@ if($page == 'customers'
$tickets = - 1; $tickets = - 1;
} }
$backup_allowed = 0; $mysqls = intval_ressource($_POST['mysqls']);
if (isset($_POST['backup_allowed']))
$backup_allowed = intval($_POST['backup_allowed']);
if($backup_allowed != '0'){
$backup_allowed = 1;
}
// gender out of range? [0,2]
if ($gender < 0 || $gender > 2) {
$gender = 0;
}
$mysqls = 0;
if(isset($_POST['mysqls']))
$mysqls = intval_ressource($_POST['mysqls']);
if(isset($_POST['mysqls_ul'])) if(isset($_POST['mysqls_ul']))
{ {
@@ -1065,21 +940,10 @@ if($page == 'customers'
$number_of_aps_packages = 0; $number_of_aps_packages = 0;
} }
$createstdsubdomain = 0; $createstdsubdomain = intval($_POST['createstdsubdomain']);
if(isset($_POST['createstdsubdomain'])) $deactivated = intval($_POST['deactivated']);
$createstdsubdomain = intval($_POST['createstdsubdomain']); $phpenabled = intval($_POST['phpenabled']);
$perlenabled = intval($_POST['perlenabled']);
$deactivated = 0;
if(isset($_POST['deactivated']))
$deactivated = intval($_POST['deactivated']);
$phpenabled = 0;
if(isset($_POST['phpenabled']))
$phpenabled = intval($_POST['phpenabled']);
$perlenabled = 0;
if(isset($_POST['perlenabled']))
$perlenabled = intval($_POST['perlenabled']);
$diskspace = $diskspace * 1024; $diskspace = $diskspace * 1024;
$traffic = $traffic * 1024 * 1024; $traffic = $traffic * 1024 * 1024;
@@ -1160,30 +1024,9 @@ if($page == 'customers'
$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname']; $_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname'];
} }
$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `safemode`, `speciallogfile`, `specialsettings`, `add_date`) " . "VALUES ('" . $db->escape($_stdsubdomain) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '1', '0', '', '".date('Y-m-d')."')");
`domain` = '" . $db->escape($_stdsubdomain) . "',
`customerid` = '" . (int)$result['customerid'] . "',
`adminid` = '" . (int)$userinfo['adminid'] . "',
`parentdomainid` = '-1',
`documentroot` = '" . $db->escape($result['documentroot']) . "',
`zonefile` = '',
`isemaildomain` = '0',
`caneditdomain` = '0',
`openbasedir` = '1',
`speciallogfile` = '0',
`specialsettings` = '',
`add_date` = '".date('Y-m-d')."'"
);
$domainid = $db->insert_id(); $domainid = $db->insert_id();
// set ip <-> domain connection $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
$db->query("INSERT INTO `".TABLE_DOMAINTOIP."` SET
`id_domain` = '".$domainid."',
`id_ipandports` = '".(int)$settings['system']['defaultip']."'"
);
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET
`standardsubdomain`='" . (int)$domainid . "'
WHERE `customerid`='" . (int)$result['customerid'] . "'"
);
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
} }
@@ -1191,12 +1034,8 @@ if($page == 'customers'
if($createstdsubdomain == '0' if($createstdsubdomain == '0'
&& $result['standardsubdomain'] != '0') && $result['standardsubdomain'] != '0')
{ {
$db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` $db->query('DELETE FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `id`=\'' . (int)$result['standardsubdomain'] . '\'');
WHERE `id`='" . (int)$result['standardsubdomain'] . "'"); $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'0\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
$db->query("DELETE FROM `" . TABLE_DOMAINTOIP . "`
WHERE `id_domain`='" . (int)$result['standardsubdomain'] . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET
`standardsubdomain`= '0' WHERE `customerid`= '" . (int)$result['customerid'] . "'");
$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically deleted standardsubdomain for user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_NOTICE, "automatically deleted standardsubdomain for user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
} }
@@ -1224,48 +1063,9 @@ if($page == 'customers'
if($deactivated != $result['deactivated']) if($deactivated != $result['deactivated'])
{ {
$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : (int)$result['pop3']) . "', `imap`='" . (($deactivated) ? '0' : (int)$result['imap']) . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : '1') . "', `imap`='" . (($deactivated) ? '0' : '1') . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'");
/* Retrieve customer's databases */
$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
$last_dbserver = 0;
/* For each of them */
while($row_database = $db->fetch_array($databases))
{
if($last_dbserver != $row_database['dbserver'])
{
$db_root->query('FLUSH PRIVILEGES;');
$db_root->close();
$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
$last_dbserver = $row_database['dbserver'];
}
foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$mysql_access_host = trim($mysql_access_host);
/* Prevent access, if deactivated */
if($deactivated)
{
// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
}
else /* Otherwise grant access */
{
$db_root->query('GRANT ALL PRIVILEGES ON `' . $db_root->escape($row_database['databasename']) .'`.* TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
}
}
}
/* At last flush the new privileges */
$db_root->query('FLUSH PRIVILEGES;');
$db_root->close();
$log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'"); $log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'");
inserttask('1'); inserttask('1');
} }
@@ -1284,13 +1084,9 @@ if($page == 'customers'
$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'");
} }
// $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `gender`='" . $db->escape($gender) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `backup_allowed`='" . $db->escape($backup_allowed) . "' WHERE `customerid`='" . (int)$id . "'");
$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` "; $admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` ";
// Using filesystem - quota, insert a task which cleans the filesystem - quota
inserttask('10');
if($mysqls != '-1' if($mysqls != '-1'
|| $result['mysqls'] != '-1') || $result['mysqls'] != '-1')
{ {
@@ -1574,18 +1370,14 @@ if($page == 'customers'
$result['aps_packages'] = ''; $result['aps_packages'] = '';
} }
$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', (($result['standardsubdomain'] != '0') ? '1' : '0'));
$phpenabled = makeyesno('phpenabled', '1', '0', $result['phpenabled']);
$perlenabled = makeyesno('perlenabled', '1', '0', $result['perlenabled']);
$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
$email_imap = makeyesno('email_imap', '1', '0', $result['imap']);
$email_pop3 = makeyesno('email_pop3', '1', '0', $result['pop3']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$gender_options = makeoption($lng['gender']['undef'], 0, ($result['gender'] == '0' ? true : false), true, true);
$gender_options .= makeoption($lng['gender']['male'], 1, ($result['gender'] == '1' ? true : false), true, true);
$gender_options .= makeoption($lng['gender']['female'], 2, ($result['gender'] == '2' ? true : false), true, true);
$customer_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_edit.php';
$customer_edit_form = htmlform::genHTMLForm($customer_edit_data);
$title = $customer_edit_data['customer_edit']['title'];
$image = $customer_edit_data['customer_edit']['image'];
eval("echo \"" . getTemplate("customers/customers_edit") . "\";"); eval("echo \"" . getTemplate("customers/customers_edit") . "\";");
} }
} }

File diff suppressed because it is too large Load Diff

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -104,13 +104,11 @@ if($page == 'overview')
$_message = isset($latestversion[1]) ? $latestversion[1] : ''; $_message = isset($latestversion[1]) ? $latestversion[1] : '';
$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes'); $_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
// add the branding so debian guys are not gettings confused $lookfornewversion_lable = $_version;
// about their version-number
$lookfornewversion_lable = $_version.$branding;
$lookfornewversion_link = $_link; $lookfornewversion_link = $_link;
$lookfornewversion_addinfo = $_message; $lookfornewversion_addinfo = $_message;
if (version_compare2($version, $_version) == -1) { if (version_compare($version, $_version) == -1) {
$isnewerversion = 1; $isnewerversion = 1;
} else { } else {
$isnewerversion = 0; $isnewerversion = 0;
@@ -148,6 +146,18 @@ if($page == 'overview')
$cron_last_runs = getCronjobsLastRun(); $cron_last_runs = getCronjobsLastRun();
$outstanding_tasks = getOutstandingTasks(); $outstanding_tasks = getOutstandingTasks();
$opentickets = 0;
$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
WHERE `answerto` = "0" AND (`status` = "0" OR `status` = "1")
AND `lastreplier`="0" AND `adminid` = "' . $userinfo['adminid'] . '"');
$awaitingtickets = $opentickets['count'];
$awaitingtickets_text = '';
if($opentickets > 0)
{
$awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="admin_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>'));
}
if(function_exists('sys_getloadavg')) if(function_exists('sys_getloadavg'))
{ {
$loadArray = sys_getloadavg(); $loadArray = sys_getloadavg();
@@ -285,34 +295,5 @@ elseif($page == 'change_language')
eval("echo \"" . getTemplate("index/change_language") . "\";"); eval("echo \"" . getTemplate("index/change_language") . "\";");
} }
} }
elseif($page == 'change_theme')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send'
) {
$theme = validate($_POST['theme'], 'theme');
$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `adminid`='" . (int)$userinfo['adminid'] . "'"); ?>
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(ADM_ACTION, LOG_NOTICE, "changed his/her theme to '" . $theme . "'");
redirectTo($filename, Array('s' => $s));
}
else
{
$theme_options = '';
$default_theme = $settings['panel']['default_theme'];
if($userinfo['theme'] != '') {
$default_theme = $userinfo['theme'];
}
$themes_avail = getThemes();
foreach($themes_avail as $t)
{
$theme_options.= makeoption($t, $t, $default_theme, true);
}
eval("echo \"" . getTemplate("index/change_theme") . "\";");
}
}

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -83,7 +83,7 @@ if($page == 'ipsandports'
if(isset($result['id']) if(isset($result['id'])
&& $result['id'] == $id) && $result['id'] == $id)
{ {
$result_checkdomain = $db->query_first("SELECT `id_domain` as `id` FROM `" . TABLE_DOMAINTOIP . "` WHERE `id_ipandports`='" . (int)$id . "'"); $result_checkdomain = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `ipandport`='" . (int)$id . "'");
if($result_checkdomain['id'] == '') if($result_checkdomain['id'] == '')
{ {
@@ -102,16 +102,9 @@ if($page == 'ipsandports'
&& $_POST['send'] == 'send') && $_POST['send'] == 'send')
{ {
$db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'");
// also, remove connections to domains (multi-stack)
$db->query("DELETE FROM `".TABLE_DOMAINTOIP."` WHERE `id_ipandports`='".(int)$id."'");
$log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
else else
@@ -143,11 +136,11 @@ if($page == 'ipsandports'
{ {
$ip = validate_ip($_POST['ip']); $ip = validate_ip($_POST['ip']);
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport')); $port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0; $listen_statement = intval($_POST['listen_statement']);
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0; $namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0; $vhostcontainer = intval($_POST['vhostcontainer']);
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/'); $specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0; $vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/'); $default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
$docroot = validate($_POST['docroot'], 'docroot'); $docroot = validate($_POST['docroot'], 'docroot');
if((int)$settings['system']['use_ssl'] == 1) if((int)$settings['system']['use_ssl'] == 1)
@@ -252,29 +245,17 @@ if($page == 'ipsandports'
$log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
/*
$enable_ssl = makeyesno('ssl', '1', '0', '0'); $enable_ssl = makeyesno('ssl', '1', '0', '0');
$listen_statement = makeyesno('listen_statement', '1', '0', '1'); $listen_statement = makeyesno('listen_statement', '1', '0', '1');
$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1'); $namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1');
$vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1'); $vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1');
$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1'); $vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1');
*/
$ipsandports_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_add.php';
$ipsandports_add_form = htmlform::genHTMLForm($ipsandports_add_data);
$title = $ipsandports_add_data['ipsandports_add']['title'];
$image = $ipsandports_add_data['ipsandports_add']['image'];
eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";"); eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";");
} }
} }
@@ -292,23 +273,16 @@ if($page == 'ipsandports'
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport')); $port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'"); $result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");
$result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'"); $result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'");
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0; $listen_statement = intval($_POST['listen_statement']);
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0; $namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0; $vhostcontainer = intval($_POST['vhostcontainer']);
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/'); $specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0; $vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/'); $default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
$docroot = validate($_POST['docroot'], 'docroot'); $docroot = validate($_POST['docroot'], 'docroot');
if((int)$settings['system']['use_ssl'] == 1)
if((int)$settings['system']['use_ssl'] == 1 {
/* $ssl = intval($_POST['ssl']);
* check here if ssl is even checked, cause if not, we don't need
* to validate and set all the $ssl_*_file vars
*/
&& isset($_POST['ssl'])
&& $_POST['ssl'] != 0
) {
$ssl = 1;
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file'); $ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file'); $ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file'); $ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
@@ -410,30 +384,18 @@ if($page == 'ipsandports'
$log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'"); $log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
else else
{ {
$result = htmlentities_array($result);
/*
$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']); $enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
$result = htmlentities_array($result);
$listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']); $listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']);
$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']); $namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']);
$vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']); $vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']);
$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']); $vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']);
*/
$ipsandports_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_edit.php';
$ipsandports_edit_form = htmlform::genHTMLForm($ipsandports_edit_data);
$title = $ipsandports_edit_data['ipsandports_edit']['title'];
$image = $ipsandports_edit_data['ipsandports_edit']['image'];
eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";"); eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -22,17 +22,19 @@ define('AREA', 'admin');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if ($page == 'log' require ("./lib/init.php");
&& $userinfo['change_serversettings'] == '1'
) { if($page == 'log'
if ($action == '') { && $userinfo['change_serversettings'] == '1')
{
if($action == '')
{
$fields = array( $fields = array(
'action' => $lng['logger']['action'],
'date' => $lng['logger']['date'], 'date' => $lng['logger']['date'],
'type' => $lng['logger']['type'], 'type' => $lng['logger']['type'],
'user' => $lng['logger']['user'], 'user' => $lng['logger']['user']
'text' => $lng['logger']['action']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$paging->sortfield = 'date'; $paging->sortfield = 'date';
@@ -45,21 +47,24 @@ if ($page == 'log'
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s); $pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
$clog = array(); $clog = array();
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if (!isset($clog[$row['action']]) {
|| !is_array($clog[$row['action']]) if(!isset($clog[$row['action']])
) { || !is_array($clog[$row['action']]))
{
$clog[$row['action']] = array(); $clog[$row['action']] = array();
} }
$clog[$row['action']][$row['logid']] = $row; $clog[$row['action']][$row['logid']] = $row;
} }
if ($paging->sortfield == 'date' if($paging->sortfield == 'date'
&& $paging->sortorder == 'desc' && $paging->sortorder == 'desc')
) { {
krsort($clog); krsort($clog);
} else { }
else
{
ksort($clog); ksort($clog);
} }
@@ -67,15 +72,20 @@ if ($page == 'log'
$count = 0; $count = 0;
$log_count = 0; $log_count = 0;
$log = ''; $log = '';
foreach ($clog as $action => $logrows) { foreach($clog as $action => $logrows)
{
$_action = 0; $_action = 0;
foreach ($logrows as $row) { foreach($logrows as $row)
if ($paging->checkDisplay($i)) { {
if($paging->checkDisplay($i))
{
$row = htmlentities_array($row); $row = htmlentities_array($row);
$row['date'] = date("d.m.y H:i:s", $row['date']); $row['date'] = date("d.m.y H:i:s", $row['date']);
if ($_action != $action) { if($_action != $action)
switch ($action) { {
switch($action)
{
case USR_ACTION: case USR_ACTION:
$_action = $lng['admin']['customer']; $_action = $lng['admin']['customer'];
break; break;
@@ -97,14 +107,15 @@ if ($page == 'log'
} }
$row['action'] = $_action; $row['action'] = $_action;
eval("\$log.=\"" . getTemplate('logger/logger_action') . "\";"); eval("\$log.=\"" . getTemplate("logger/logger_action") . "\";");
} }
$log_count++; $log_count++;
$type = $row['type']; $type = $row['type'];
$_type = 'unknown'; $_type = 'unknown';
switch ($type) { switch($type)
{
case LOG_INFO: case LOG_INFO:
$_type = 'Information'; $_type = 'Information';
break; break;
@@ -126,28 +137,35 @@ if ($page == 'log'
} }
$row['type'] = $_type; $row['type'] = $_type;
eval("\$log.=\"" . getTemplate('logger/logger_log') . "\";"); eval("\$log.=\"" . getTemplate("logger/logger_log") . "\";");
$count++; $count++;
$_action = $action; $_action = $action;
} }
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate('logger/logger') . "\";"); eval("echo \"" . getTemplate("logger/logger") . "\";");
} elseif ($action == 'truncate') { }
if (isset($_POST['send']) elseif($action == 'truncate')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$yesterday = time() - (60 * 10); $yesterday = time() - (60 * 10);
/* (60*60*24); */ /* (60*60*24); */
$db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'");
$log->logAction(ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)'); $log->logAction(ADM_ACTION, LOG_WARNING, "truncated the system-log (mysql)");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
else
{
ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG); ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG);
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -22,60 +22,79 @@ define('AREA', 'admin');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if (isset($_POST['id'])) { require ("./lib/init.php");
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif (isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'message') { if($page == 'message')
if ($action == '') { {
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed panel_message'); if($action == '')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed panel_message");
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
if ($_POST['receipient'] == 0 if($_POST['receipient'] == 0
&& $userinfo['customers_see_all'] == '1' && $userinfo['customers_see_all'] == '1')
) { {
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to admins'); $log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to admins");
$result = $db->query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`"); $result = $db->query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`");
} elseif ($_POST['receipient'] == 1) { }
if ($userinfo['customers_see_all'] == '1') { elseif($_POST['receipient'] == 1)
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers'); {
if($userinfo['customers_see_all'] == "1")
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to ALL customers");
$result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`"); $result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`");
} else { }
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to customers'); else
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to customers");
$result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'"); $result = $db->query('SELECT `firstname`, `name`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'");
} }
} else { }
else
{
standard_error('noreceipientsgiven'); standard_error('noreceipientsgiven');
} }
$subject = $_POST['subject']; $subject = $_POST['subject'];
$message = wordwrap($_POST['message'], 70); $message = wordwrap($_POST['message'], 70);
if (!empty($message)) { if(!empty($message))
{
$mailcounter = 0; $mailcounter = 0;
$mail->Body = $message; $mail->Body = $message;
$mail->Subject = $subject; $mail->Subject = $subject;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']); $mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']);
$mail->From = $userinfo['email']; $mail->From = $userinfo['email'];
$mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name']; $mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name'];
if (!$mail->Send()) { if(!$mail->Send())
if ($mail->ErrorInfo != '') { {
if($mail->ErrorInfo != '')
{
$mailerr_msg = $mail->ErrorInfo; $mailerr_msg = $mail->ErrorInfo;
} else { }
$mailerr_msg = $row['email']; else
{
$mailerr_msg = $row["email"];
} }
$log->logAction(ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg); $log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
standard_error('errorsendingmail', $row['email']); standard_error('errorsendingmail', $row["email"]);
} }
$mailcounter++; $mailcounter++;
@@ -83,34 +102,47 @@ if ($page == 'message') {
} }
redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter)); redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter));
} else { }
else
{
standard_error('nomessagetosend'); standard_error('nomessagetosend');
} }
} }
} }
if ($action == 'showsuccess') { if($action == 'showsuccess')
{
$success = 1; $success = 1;
$sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0; $sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0;
if ($sentitems == 0) { if($sentitems == 0)
{
$successmessage = $lng['message']['noreceipients']; $successmessage = $lng['message']['noreceipients'];
} else { }
else
{
$successmessage = str_replace('%s', $sentitems, $lng['message']['success']); $successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
} }
} else {
$action = '';
}
else
{
$success = 0; $success = 0;
$sentitems = 0; $sentitems = 0;
$successmessage = ''; $successmessage = '';
$action = '';
} }
$action = '';
$receipients = ''; $receipients = '';
if ($userinfo['customers_see_all'] == '1') { if($userinfo['customers_see_all'] == "1")
{
$receipients.= makeoption($lng['panel']['reseller'], 0); $receipients.= makeoption($lng['panel']['reseller'], 0);
} }
$receipients .= makeoption($lng['panel']['customer'], 1); $receipients.= makeoption($lng['panel']['customer'], 1);
eval("echo \"" . getTemplate('message/message') . "\";"); eval("echo \"" . getTemplate("message/message") . "\";");
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -25,58 +25,49 @@ define('AREA', 'admin');
require ("./lib/init.php"); require ("./lib/init.php");
if (isset($_POST['id'])) { if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif (isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
if ($action == '') { if($action == '')
{
$tablecontent = ''; $tablecontent = '';
$count = 0;
$result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`"); $result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$domainresult = false; $domainresult = false;
$query = "SELECT * FROM `".TABLE_PANEL_DOMAINS."` if((int)$userinfo['domains_see_all'] == 0)
WHERE `phpsettingid` = '".(int)$row['id']."' {
AND `parentdomainid` = '0'"; $domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `adminid` = " . (int)$userinfo['userid'] . " AND `phpsettingid` = " . (int)$row['id']);
if ((int)$userinfo['domains_see_all'] == 0) {
$query .= " AND `adminid` = '".(int)$userinfo['userid']."'";
} }
else
if ((int)$settings['panel']['phpconfigs_hidestdsubdomain'] == 1) { {
$query2 = "SELECT DISTINCT `standardsubdomain` $domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `phpsettingid` = " . (int)$row['id']);
FROM `".TABLE_PANEL_CUSTOMERS."`
WHERE `standardsubdomain` > 0 ORDER BY `standardsubdomain` ASC;";
$ssdids_res = $db->query($query2);
$ssdids = array();
while ($ssd = $db->fetch_array($ssdids_res)) {
$ssdids[] = $ssd['standardsubdomain'];
}
if (count($ssdids) > 0) {
$query .= " AND `id` NOT IN (".implode(', ', $ssdids).")";
}
} }
$domainresult = $db->query($query);
$domains = ''; $domains = '';
if ($db->num_rows($domainresult) > 0) {
while ($row2 = $db->fetch_array($domainresult)) { if($db->num_rows($domainresult) > 0)
{
while($row2 = $db->fetch_array($domainresult))
{
$domains.= $row2['domain'] . '<br/>'; $domains.= $row2['domain'] . '<br/>';
} }
} else { }
else
{
$domains = $lng['admin']['phpsettings']['notused']; $domains = $lng['admin']['phpsettings']['notused'];
} }
$count ++;
eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";"); eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";");
} }
@@ -112,13 +103,6 @@ if ($page == 'overview') {
else else
{ {
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1"); $result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1");
$phpconfig_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_add.php';
$phpconfig_add_form = htmlform::genHTMLForm($phpconfig_add_data);
$title = $phpconfig_add_data['phpconfig_add']['title'];
$image = $phpconfig_add_data['phpconfig_add']['image'];
eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";"); eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";");
} }
} }
@@ -188,12 +172,6 @@ if ($page == 'overview') {
} }
else else
{ {
$phpconfig_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_edit.php';
$phpconfig_edit_form = htmlform::genHTMLForm($phpconfig_edit_data);
$title = $phpconfig_edit_data['phpconfig_edit']['title'];
$image = $phpconfig_edit_data['phpconfig_edit']['image'];
eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";"); eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -65,11 +65,6 @@ if(($page == 'settings' || $page == 'overview')
$only_enabledisable = true; $only_enabledisable = true;
} }
// check if the session timeout is too low #815
if (isset($_POST['session_sessiontimeout']) && $_POST['session_sessiontimeout'] <= 60) {
standard_error($lng['error']['session_timeout'], $lng['error']['session_timeout_desc']);
}
if(processFormEx( if(processFormEx(
$settings_data, $settings_data,
$_POST, $_POST,
@@ -82,9 +77,8 @@ if(($page == 'settings' || $page == 'overview')
) { ) {
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting"); $log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
inserttask('5');
standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page)); standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page));
} }
} }
@@ -115,50 +109,6 @@ if(($page == 'settings' || $page == 'overview')
} }
} }
elseif($page == 'phpinfo'
&& $userinfo['change_serversettings'] == '1'
) {
ob_start();
phpinfo();
$phpinfo = array('phpinfo' => array());
if (preg_match_all(
'#(?:<h2>(?:<a name=".*?">)?(.*?)(?:</a>)?</h2>)|(?:<tr(?: class=".*?")?><t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>)?)?</tr>)#s',
ob_get_clean(), $matches, PREG_SET_ORDER
)
) {
foreach ($matches as $match) {
$end = array_keys($phpinfo);
$end = end($end);
if (strlen($match[1])) {
$phpinfo[$match[1]] = array();
} elseif (isset($match[3])) {
$phpinfo[$end][$match[2]] = isset($match[4]) ? array($match[3], $match[4]) : $match[3];
} else {
$phpinfo[$end][] = $match[2];
}
}
$phpinfohtml = '';
foreach ($phpinfo as $name => $section) {
$phpinfoentries = "";
foreach ($section as $key => $val) {
if (is_array($val)) {
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_3") . "\";");
} elseif (is_string($key)) {
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_2") . "\";");
} else {
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_1") . "\";");
}
}
// first header -> show actual php version
if (strtolower($name) == "phpinfo") {
$name = "PHP ".PHP_VERSION;
}
eval("\$phpinfohtml .= \"" . getTemplate("settings/phpinfo/phpinfo_table") . "\";");
}
$phpinfo = $phpinfohtml;
}
eval("echo \"" . getTemplate("settings/phpinfo") . "\";");
}
elseif($page == 'rebuildconfigs' elseif($page == 'rebuildconfigs'
&& $userinfo['change_serversettings'] == '1') && $userinfo['change_serversettings'] == '1')
{ {
@@ -167,11 +117,9 @@ elseif($page == 'rebuildconfigs'
{ {
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles"); $log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles");
inserttask('1'); inserttask('1');
inserttask('10');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
inserttask('5');
standard_success('rebuildingconfigs', '', array('filename' => 'admin_index.php')); redirectTo('admin_index.php', array('s' => $s));
} }
else else
{ {

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -48,28 +48,17 @@ elseif(isset($_GET['id']))
$available_templates = array( $available_templates = array(
'createcustomer', 'createcustomer',
'pop_success', 'pop_success',
'trafficmaxpercent',
'diskmaxpercent',
'new_ticket_by_customer',
'new_ticket_for_customer',
'new_ticket_by_staff',
'new_reply_ticket_by_customer',
'new_reply_ticket_by_staff',
'new_database_by_customer', 'new_database_by_customer',
'new_ftpaccount_by_customer', 'new_ftpaccount_by_customer',
'password_reset' 'password_reset'
); );
// only show templates of features that are enabled #1191
if ((int)$settings['system']['report_enable'] == 1) {
array_push($available_templates,
'trafficmaxpercent',
'diskmaxpercent'
);
}
if ((int)$settings['ticket']['enabled'] == 1) {
array_push($available_templates,
'new_ticket_by_customer',
'new_ticket_for_customer',
'new_ticket_by_staff',
'new_reply_ticket_by_customer',
'new_reply_ticket_by_staff'
);
}
$file_templates = array( $file_templates = array(
'index_html' 'index_html'
); );
@@ -163,7 +152,7 @@ elseif($action == 'delete'
} }
} }
} }
elseif($action == 'deletef' elseif($action == 'delete'
&& $id != 0) && $id != 0)
{ {
//file templates //file templates
@@ -220,12 +209,6 @@ elseif($action == 'add')
$template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true); $template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true);
} }
$template_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_add.php';
$template_add_form = htmlform::genHTMLForm($template_add_data);
$title = $template_add_data['template_add']['title'];
$image = $template_add_data['template_add']['image'];
eval("echo \"" . getTemplate("templates/templates_add_2") . "\";"); eval("echo \"" . getTemplate("templates/templates_add_2") . "\";");
} }
elseif(isset($_POST['send']) elseif(isset($_POST['send'])
@@ -329,12 +312,6 @@ elseif($action == 'add')
$free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true); $free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true);
} }
$filetemplate_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_add.php';
$filetemplate_add_form = htmlform::genHTMLForm($filetemplate_add_data);
$title = $filetemplate_add_data['filetemplate_add']['title'];
$image = $filetemplate_add_data['filetemplate_add']['image'];
eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";"); eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";");
} }
} }
@@ -367,18 +344,11 @@ elseif($action == 'edit'
$result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'"); $result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'");
$result = htmlentities_array($result); $result = htmlentities_array($result);
$mailbody = $result['value']; $mailbody = $result['value'];
$template_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_edit.php';
$template_edit_form = htmlform::genHTMLForm($template_edit_data);
$title = $template_edit_data['template_edit']['title'];
$image = $template_edit_data['template_edit']['image'];
eval("echo \"" . getTemplate("templates/templates_edit") . "\";"); eval("echo \"" . getTemplate("templates/templates_edit") . "\";");
} }
} }
} }
elseif($action == 'editf' elseif($action == 'edit'
&& $id != 0) && $id != 0)
{ {
//file templates //file templates
@@ -402,13 +372,6 @@ elseif($action == 'editf'
else else
{ {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$filetemplate_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_edit.php';
$filetemplate_edit_form = htmlform::genHTMLForm($filetemplate_edit_data);
$title = $filetemplate_edit_data['filetemplate_edit']['title'];
$image = $filetemplate_edit_data['filetemplate_edit']['image'];
eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";"); eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";");
} }
} }
@@ -418,3 +381,5 @@ elseif($action == 'editf'
exit; exit;
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
@@ -32,22 +32,6 @@ if(isset($_POST['id']))
elseif(isset($_GET['id'])) elseif(isset($_GET['id']))
{ {
$id = intval($_GET['id']); $id = intval($_GET['id']);
// only check if this is not a category-id
if (!isset($_GET['page']) || (isset($_GET['page']) && $_GET['page'] != 'categories')) {
if (!$userinfo['customers_see_all']) {
/*
* Check if the current user is allowed to see the current ticket.
*/
$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `adminid` = '".$userinfo['admindid']."'";
$result = $db->query_first($sql);
if ($result == null) {
// no rights to see the requested ticket
standard_error(array('ticketnotaccessible'));
}
}
}
} }
if($page == 'tickets' if($page == 'tickets'
@@ -118,20 +102,16 @@ if($page == 'tickets'
if($_cid != $row['customerid']) if($_cid != $row['customerid'])
{ {
$cid = $row['customerid']; $cid = $row['customerid'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '` $usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'); WHERE `customerid` = "' . (int)$cid . '"');
if(isset($usr['loginname'])) if(isset($usr['loginname'])) {
{ $customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
$customer = getCorrectFullUserDetails($usr); //$customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
$customerloginname = $usr['loginname']; } else {
$customerid = $usr['customerid'];
}
else
{
$customer = $lng['ticket']['nonexistingcustomer']; $customer = $lng['ticket']['nonexistingcustomer'];
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
} }
$tickets_count++; $tickets_count++;
@@ -166,7 +146,7 @@ if($page == 'tickets'
$row['subject'] = substr($row['subject'], 0, 17) . '...'; $row['subject'] = substr($row['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
$count++; $count++;
$_cid = $row['customerid']; $_cid = $row['customerid'];
} }
@@ -175,7 +155,7 @@ if($page == 'tickets'
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/tickets") . "\";"); eval("echo \"" . getTemplate("ticket/tickets") . "\";");
} }
elseif($action == 'new') elseif($action == 'new')
{ {
@@ -190,7 +170,7 @@ if($page == 'tickets'
$newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false); $newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
$newticket->Set('category', validate($_POST['category'], 'category'), true, false); $newticket->Set('category', validate($_POST['category'], 'category'), true, false);
$newticket->Set('customer', (int)$_POST['customer'], true, false); $newticket->Set('customer', (int)$_POST['customer'], true, false);
$newticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false); $newticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
if($newticket->Get('subject') == null) if($newticket->Get('subject') == null)
{ {
@@ -219,16 +199,12 @@ if($page == 'tickets'
else else
{ {
$categories = ''; $categories = '';
$where = ''; $result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
if ($userinfo['tickets_see_all'] != '1') {
$where = 'WHERE `adminid` = "' . $userinfo['adminid'] . '"';
}
$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');
if(isset($result['name']) if(isset($result['name'])
&& $result['name'] != '') && $result['name'] != '')
{ {
$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC'); $result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
while($row = $db->fetch_array($result2)) while($row = $db->fetch_array($result2))
{ {
@@ -248,17 +224,10 @@ if($page == 'tickets'
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']); $customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
} }
$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']); $priorities = makeoption($lng['ticket']['unf_high'], '1', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_normal'], '2', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_low'], '3', $settings['ticket']['default_priority']);
eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
$ticket_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_new.php';
$ticket_new_form = htmlform::genHTMLForm($ticket_new_data);
$title = $ticket_new_data['ticket_new']['title'];
$image = $ticket_new_data['ticket_new']['image'];
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
} }
} }
else else
@@ -275,7 +244,7 @@ if($page == 'tickets'
$replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1); $replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1);
$replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false); $replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
$replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false); $replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
$replyticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false); $replyticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
if($replyticket->Get('message') == null) if($replyticket->Get('message') == null)
{ {
@@ -326,25 +295,18 @@ if($page == 'tickets'
$isclosed = 1; $isclosed = 1;
} }
if ($mainticket->Get('by') == '1') if($mainticket->Get('by') == '1')
{ {
$by = $lng['ticket']['staff']; $by = $lng['ticket']['staff'];
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -361,19 +323,12 @@ if($page == 'tickets'
} }
else else
{ {
$cid = $subticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -383,13 +338,8 @@ if($page == 'tickets'
$ticket_replies_count = $db->num_rows($andere) + 1; $ticket_replies_count = $db->num_rows($andere) + 1;
// don't forget the main-ticket! // don't forget the main-ticket!
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_reply.php';
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
$title = $ticket_reply_data['ticket_reply']['title']; eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
$image = $ticket_reply_data['ticket_reply']['image'];
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
} }
} }
elseif($action == 'close' elseif($action == 'close'
@@ -475,16 +425,11 @@ elseif($page == 'categories'
'name' => $lng['ticket']['category'], 'name' => $lng['ticket']['category'],
'logicalorder' => $lng['ticket']['logicalorder'] 'logicalorder' => $lng['ticket']['logicalorder']
); );
$where = '1'; // WHERE 1 is like no 'where-clause'
if ($userinfo['tickets_see_all'] != '1') {
$where = " `main`.`adminid` = '" . (int)$userinfo['adminid'] . "'";
}
$paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, ( $result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, (
SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub` SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub`
WHERE `sub`.`category` = `main`.`id` WHERE `sub`.`category` = `main`.`id`
AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "') AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
as `ticketcount`, ( as `ticketcount`, (
SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2` SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2`
WHERE `sub2`.`category` = `main`.`id` WHERE `sub2`.`category` = `main`.`id`
@@ -492,7 +437,7 @@ elseif($page == 'categories'
AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2') AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2')
AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "' AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "'
) as `ticketcountnotclosed` ) as `ticketcountnotclosed`
FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE " . $where . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE `main`.`adminid` = '" . (int)$userinfo['adminid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -509,14 +454,14 @@ elseif($page == 'categories'
{ {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']); $closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']);
eval("\$ticketcategories.=\"" . getTemplate("tickets/tickets_categories") . "\";"); eval("\$ticketcategories.=\"" . getTemplate("ticket/tickets_categories") . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/categories") . "\";"); eval("echo \"" . getTemplate("ticket/categories") . "\";");
} }
elseif($action == 'addcategory') elseif($action == 'addcategory')
{ {
@@ -529,7 +474,7 @@ elseif($page == 'categories'
if($order < 1 || $order >= 1000) if($order < 1 || $order >= 1000)
{ {
// use the latest available // use the latest available
$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1; $order = ticket::getHighestOrderNumber($db) + 1;
} }
if($category == '') if($category == '')
@@ -545,15 +490,8 @@ elseif($page == 'categories'
} }
else else
{ {
$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1; $order = ticket::getHighestOrderNumber($db) + 1;
eval("echo \"" . getTemplate("ticket/tickets_newcategory") . "\";");
$category_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_new.php';
$category_new_form = htmlform::genHTMLForm($category_new_data);
$title = $category_new_data['category_new']['title'];
$image = $category_new_data['category_new']['image'];
eval("echo \"" . getTemplate("tickets/tickets_newcategory") . "\";");
} }
} }
elseif($action == 'editcategory' elseif($action == 'editcategory'
@@ -584,14 +522,7 @@ elseif($page == 'categories'
else else
{ {
$row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"'); $row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"');
eval("echo \"" . getTemplate("ticket/tickets_editcategory") . "\";");
$category_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_edit.php';
$category_edit_form = htmlform::genHTMLForm($category_edit_data);
$title = $category_edit_data['category_edit']['title'];
$image = $category_edit_data['category_edit']['image'];
eval("echo \"" . getTemplate("tickets/tickets_editcategory") . "\";");
} }
} }
elseif($action == 'deletecategory' elseif($action == 'deletecategory'
@@ -640,7 +571,8 @@ elseif($page == 'archive'
{ {
$categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : ''; $categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : '';
} }
$query = ticket::getArchiveSearchStatement($db, $subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
$query = ticket::getArchiveSearchStatement($subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
$fields = array( $fields = array(
'lastchange' => $lng['ticket']['lastchange'], 'lastchange' => $lng['ticket']['lastchange'],
'ticket_answers' => $lng['ticket']['ticket_answers'], 'ticket_answers' => $lng['ticket']['ticket_answers'],
@@ -698,39 +630,25 @@ elseif($page == 'archive'
{ {
if($paging->checkDisplay($i)) if($paging->checkDisplay($i))
{ {
$ticket = htmlentities_array($ticket);
$ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']); $ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']);
if($_cid != $ticket['customerid']) if($_cid != $ticket['customerid'])
{ {
$cid = $ticket['customerid']; $cid = $ticket['customerid'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '` $usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'); WHERE `customerid` = "' . (int)$cid . '"');
if(isset($usr['loginname'])) if(isset($usr['loginname'])) {
{ $customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
$customer = getCorrectFullUserDetails($usr); } else {
$customerloginname = $usr['loginname'];
$customerid = $usr['customerid'];
}
else
{
$customer = $lng['ticket']['nonexistingcustomer']; $customer = $lng['ticket']['nonexistingcustomer'];
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
} }
$tickets_count++; $tickets_count++;
switch ($ticket['priority'])
{
case 1: $ticket['display'] = 'high';
break;
case 2: $ticket['display'] = 'normal';
break;
case 3: $ticket['display'] = 'low';
break;
default: $ticket['display'] = 'unknown';
}
$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']); $ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);
if($ticket['lastreplier'] == '1') if($ticket['lastreplier'] == '1')
@@ -746,8 +664,8 @@ elseif($page == 'archive'
{ {
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...'; $ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
} }
$ticket = htmlentities_array($ticket);
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
$count++; $count++;
$_cid = $ticket['customerid']; $_cid = $ticket['customerid'];
} }
@@ -756,7 +674,7 @@ elseif($page == 'archive'
$i++; $i++;
} }
eval("echo \"" . getTemplate("tickets/archivesearch") . "\";"); eval("echo \"" . getTemplate("ticket/archivesearch") . "\";");
} }
else else
{ {
@@ -785,13 +703,13 @@ elseif($page == 'archive'
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...'; $ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
} }
} }
$priorities_options = makecheckbox('priority1', $lng['ticket']['high'], '1'); $priorities_options = makecheckbox('priority1', $lng['ticket']['unf_high'], '1');
$priorities_options.= makecheckbox('priority2', $lng['ticket']['normal'], '2'); $priorities_options.= makecheckbox('priority2', $lng['ticket']['unf_normal'], '2');
$priorities_options.= makecheckbox('priority3', $lng['ticket']['low'], '3'); $priorities_options.= makecheckbox('priority3', $lng['ticket']['unf_low'], '3');
$category_options = ''; $category_options = '';
$ccount = 0; $ccount = 0;
$result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC'); $result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
@@ -810,7 +728,7 @@ elseif($page == 'archive'
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']); $customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
} }
eval("echo \"" . getTemplate("tickets/archive") . "\";"); eval("echo \"" . getTemplate("ticket/archive") . "\";");
} }
} }
elseif($action == 'view' elseif($action == 'view'
@@ -830,19 +748,12 @@ elseif($page == 'archive'
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -859,29 +770,23 @@ elseif($page == 'archive'
} }
else else
{ {
$cid = $subticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
$by .= getCorrectFullUserDetails($usr).'</a>';
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', htmlentities($mainticket->Get('priority')), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
$priorities.= makeoption($lng['ticket']['normal'], '2', htmlentities($mainticket->Get('priority')), true, true); $priorities.= makeoption($lng['ticket']['normal'], '2', $mainticket->Get('priority'), true, true);
$priorities.= makeoption($lng['ticket']['low'], '3', htmlentities($mainticket->Get('priority')), true, true); $priorities.= makeoption($lng['ticket']['low'], '3', $mainticket->Get('priority'), true, true);
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$ticket_replies_count = $db->num_rows($andere) + 1; $ticket_replies_count = $db->num_rows($andere) + 1;
// don't forget the main-ticket! // don't forget the main-ticket!
eval("echo \"" . getTemplate("tickets/tickets_view") . "\";");
eval("echo \"" . getTemplate("ticket/tickets_view") . "\";");
} }
elseif($action == 'delete' elseif($action == 'delete'
&& $id != 0) && $id != 0)
@@ -900,6 +805,6 @@ elseif($page == 'archive'
ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject')); ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
} }
} }
} else {
standard_error('nocustomerforticket');
} }
?>

View File

@@ -1,148 +0,0 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Morton Jonuschat <m.jonuschat@chrome-it.de>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package Panel
*
*/
define('AREA', 'admin');
/**
* Include our init.php, which manages Sessions, Language etc.
*/
require ("./lib/init.php");
if($action == 'logout')
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['adminid'] . "' AND `adminsession` = '1'");
redirectTo('index.php');
exit;
}
if(isset($_POST['id']))
{
$id = intval($_POST['id']);
}
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']);
}
$months = array(
'0' => 'empty',
'1' => 'jan',
'2' => 'feb',
'3' => 'mar',
'4' => 'apr',
'5' => 'may',
'6' => 'jun',
'7' => 'jul',
'8' => 'aug',
'9' => 'sep',
'10' => 'oct',
'11' => 'nov',
'12' => 'dec',
);
if($page == 'overview' || $page == 'customers')
{
if($action == 'su' && $id != 0)
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$id . "' " . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' "));
if($result['loginname'] != '')
{
$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "'");
$s = md5(uniqid(microtime(), 1));
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
redirectTo('customer_traffic.php', Array(
's' => $s
));
}
else
{
redirectTo('index.php', Array(
'action' => 'login'
));
}
}
$customerview = 1;
$stats_tables = '';
$minyear = $db->query_first("SELECT `year` FROM `". TABLE_PANEL_TRAFFIC . "` ORDER BY `year` ASC LIMIT 1");
if (!isset($minyear['year']) || $minyear['year'] == 0)
{
$maxyears = 0;
}
else
{
$maxyears = date("Y") - $minyear['year'];
}
for($years = 0; $years<=$maxyears; $years++) {
$overview['year'] = date("Y")-$years;
$overview['type'] = $lng['traffic']['customer'];
$domain_list = '';
$customer_name_list = $db->query("SELECT `customerid`,`company`,`name`,`firstname` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' ") . " ORDER BY name");
$totals = array(
'jan' => 0,
'feb' => 0,
'mar' => 0,
'apr' => 0,
'may' => 0,
'jun' => 0,
'jul' => 0,
'aug' => 0,
'sep' => 0,
'oct' => 0,
'nov' => 0,
'dec' => 0,
);
while($customer_name = $db->fetch_array($customer_name_list)) {
$virtual_host = array(
'name' => ($customer_name['company'] == '' ? $customer_name['name'] . ", " . $customer_name['firstname'] : $customer_name['company']),
'customerid' => $customer_name['customerid'],
'jan' => '-',
'feb' => '-',
'mar' => '-',
'apr' => '-',
'may' => '-',
'jun' => '-',
'jul' => '-',
'aug' => '-',
'sep' => '-',
'oct' => '-',
'nov' => '-',
'dec' => '-',
);
$traffic_list = $db->query("SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE year = " . (date("Y")-$years) . " AND `customerid` = '" . $customer_name['customerid'] . "' GROUP BY month ORDER BY month");
while($traffic_month = $db->fetch_array($traffic_list)) {
$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s');
$totals[$months[(int)$traffic_month['month']]] += $traffic_month['traffic'];
}
eval("\$domain_list .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
}
// sum up totals
$virtual_host = array(
'name' => $lng['traffic']['months']['total'],
);
foreach($totals as $month => $bytes) {
$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s'));
}
$customerview = 0;
eval("\$total_list = sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
eval("\$stats_tables .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table") . "\");");
}
eval("echo \"" . getTemplate("traffic/index") . "\";");
}

View File

@@ -12,13 +12,14 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'admin'); define('AREA', 'admin');
require('./lib/init.php'); require ("./lib/init.php");
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates"); $log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates");
/** /**
@@ -28,13 +29,13 @@ if ($page == 'overview') {
*/ */
if (!isFroxlor()) { if (!isFroxlor()) {
if (!isset($settings['panel']['version']) if (!isset($settings['panel']['version'])
|| $settings['panel']['version'] == '' || $settings['panel']['version'] == ''
) { ) {
$settings['panel']['version'] = '1.4.2.1'; $settings['panel']['version'] = '1.4.2.1';
$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')"); $db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')");
} }
if (!isset($settings['system']['dbversion']) if (!isset($settings['system']['dbversion'])
|| $settings['system']['dbversion'] == '' || $settings['system']['dbversion'] == ''
) { ) {
/** /**
* for syscp-stable (1.4.2.1) this value has to be 0 * for syscp-stable (1.4.2.1) this value has to be 0
@@ -42,9 +43,11 @@ if ($page == 'overview') {
* and the svn-version has its value in the database * and the svn-version has its value in the database
* -> bug #54 * -> bug #54
*/ */
$result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'"); $result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'");
if (isset($result['value'])) { if(isset($result['value']))
{
$settings['system']['dbversion'] = (int)$result['value']; $settings['system']['dbversion'] = (int)$result['value'];
} else { } else {
$settings['system']['dbversion'] = 0; $settings['system']['dbversion'] = 0;
@@ -52,36 +55,40 @@ if ($page == 'overview') {
} }
} }
if (hasUpdates($version)) { if(hasUpdates($version))
{
$successful_update = false; $successful_update = false;
$message = ''; $message = '';
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
if ((isset($_POST['update_preconfig']) if((isset($_POST['update_preconfig'])
&& isset($_POST['update_changesagreed']) && isset($_POST['update_changesagreed'])
&& intval($_POST['update_changesagreed']) != 0) && intval($_POST['update_changesagreed']) != 0)
|| !isset($_POST['update_preconfig']) || !isset($_POST['update_preconfig'])
) { ) {
eval("echo \"" . getTemplate('update/update_start') . "\";"); eval("echo \"" . getTemplate("update/update_start") . "\";");
include_once './install/updatesql.php'; include_once './install/updatesql.php';
$redirect_url = 'admin_index.php?s=' . $s; $redirect_url = 'admin_index.php?s=' . $s;
eval("echo \"" . getTemplate('update/update_end') . "\";"); eval("echo \"" . getTemplate("update/update_end") . "\";");
updateCounters(); updateCounters();
inserttask('1'); inserttask('1');
@chmod('./lib/userdata.inc.php', 0440); @chmod('./lib/userdata.inc.php', 0440);
$successful_update = true; $successful_update = true;
} else { }
$message = '<br /><strong style="color: red">You have to agree that you have read the update notifications.</strong>'; else
{
$message = '<br /><strong style="color:#ff0000;">You have to agree that you have read the update notifications.</strong>';
} }
} }
if (!$successful_update) { if(!$successful_update)
{
$current_version = $settings['panel']['version']; $current_version = $settings['panel']['version'];
$new_version = $version; $new_version = $version;
@@ -92,20 +99,26 @@ if ($page == 'overview') {
include_once './install/updates/preconfig.php'; include_once './install/updates/preconfig.php';
$preconfig = getPreConfig($current_version); $preconfig = getPreConfig($current_version);
if ($preconfig != '') { if($preconfig != '')
$update_information .= '<br />' . $preconfig . $message; {
$update_information .= '<br />'.$preconfig.$message;
} }
$update_information .= $lng['update']['update_information']['part_b']; $update_information .= $lng['update']['update_information']['part_b'];
eval("echo \"" . getTemplate('update/index') . "\";"); eval("echo \"" . getTemplate("update/index") . "\";");
} }
} else { }
else
{
/* /*
* @TODO version-webcheck check here * @TODO version-webcheck check here
*/ */
$success_message = $lng['update']['noupdatesavail']; $success_message = $lng['update']['noupdatesavail'];
$redirect_url = 'admin_index.php?s=' . $s; $redirect_url = 'admin_index.php?s=' . $s;
eval("echo \"" . getTemplate('update/noupdatesavail') . "\";"); eval("echo \"" . getTemplate("update/noupdatesavail") . "\";");
} }
} }
?>

1
cache/.gitignore vendored
View File

@@ -1 +0,0 @@
*

0
cache/.keep vendored
View File

File diff suppressed because one or more lines are too long

View File

@@ -1 +0,0 @@
.jqplot-target{position:relative;color:#666;font-family:"Trebuchet MS",Arial,Helvetica,sans-serif;font-size:1em}.jqplot-axis{font-size:.75em}.jqplot-xaxis{margin-top:10px}.jqplot-x2axis{margin-bottom:10px}.jqplot-yaxis{margin-right:10px}.jqplot-y2axis,.jqplot-y3axis,.jqplot-y4axis,.jqplot-y5axis,.jqplot-y6axis,.jqplot-y7axis,.jqplot-y8axis,.jqplot-y9axis,.jqplot-yMidAxis{margin-left:10px;margin-right:10px}.jqplot-axis-tick,.jqplot-xaxis-tick,.jqplot-yaxis-tick,.jqplot-x2axis-tick,.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick,.jqplot-yMidAxis-tick{position:absolute;white-space:pre}.jqplot-xaxis-tick{top:0;left:15px;vertical-align:top}.jqplot-x2axis-tick{bottom:0;left:15px;vertical-align:bottom}.jqplot-yaxis-tick{right:0;top:15px;text-align:right}.jqplot-yaxis-tick.jqplot-breakTick{right:-20px;margin-right:0;padding:1px 5px 1px 5px;z-index:2;font-size:1.5em}.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{left:0;top:15px;text-align:left}.jqplot-yMidAxis-tick{text-align:center;white-space:nowrap}.jqplot-xaxis-label{margin-top:10px;font-size:11pt;position:absolute}.jqplot-x2axis-label{margin-bottom:10px;font-size:11pt;position:absolute}.jqplot-yaxis-label{margin-right:10px;font-size:11pt;position:absolute}.jqplot-yMidAxis-label{font-size:11pt;position:absolute}.jqplot-y2axis-label,.jqplot-y3axis-label,.jqplot-y4axis-label,.jqplot-y5axis-label,.jqplot-y6axis-label,.jqplot-y7axis-label,.jqplot-y8axis-label,.jqplot-y9axis-label{font-size:11pt;margin-left:10px;position:absolute}.jqplot-meterGauge-tick{font-size:.75em;color:#999}.jqplot-meterGauge-label{font-size:1em;color:#999}table.jqplot-table-legend{margin-top:12px;margin-bottom:12px;margin-left:12px;margin-right:12px}table.jqplot-table-legend,table.jqplot-cursor-legend{background-color:rgba(255,255,255,0.6);border:1px solid #ccc;position:absolute;font-size:.75em}td.jqplot-table-legend{vertical-align:middle}td.jqplot-seriesToggle:hover,td.jqplot-seriesToggle:active{cursor:pointer}.jqplot-table-legend .jqplot-series-hidden{text-decoration:line-through}div.jqplot-table-legend-swatch-outline{border:1px solid #ccc;padding:1px}div.jqplot-table-legend-swatch{width:0;height:0;border-top-width:5px;border-bottom-width:5px;border-left-width:6px;border-right-width:6px;border-top-style:solid;border-bottom-style:solid;border-left-style:solid;border-right-style:solid}.jqplot-title{top:0;left:0;padding-bottom:.5em;font-size:1.2em}table.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em}.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-highlighter-tooltip,.jqplot-canvasOverlay-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-point-label{font-size:.75em;z-index:2}td.jqplot-cursor-legend-swatch{vertical-align:middle;text-align:center}div.jqplot-cursor-legend-swatch{width:1.2em;height:.7em}.jqplot-error{text-align:center}.jqplot-error-message{position:relative;top:46%;display:inline-block}div.jqplot-bubble-label{font-size:.8em;padding-left:2px;padding-right:2px;color:rgb(20%,20%,20%)}div.jqplot-bubble-label.jqplot-bubble-label-highlight{background:rgba(90%,90%,90%,0.7)}div.jqplot-noData-container{text-align:center;background-color:rgba(96%,96%,96%,0.3)}

View File

@@ -14,21 +14,21 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
// Required code
define('AREA', 'customer'); define('AREA', 'customer');
require ('./lib/init.php'); require ("./lib/init.php");
$Id = 0; $Id = 0;
if (isset($_GET['id'])) {
$Id = (int)$_GET['id'];
}
if (isset($_POST['id'])) {
$Id = (int)$_POST['id'];
}
eval("echo \"" . getTemplate('aps/header') . "\";"); if(isset($_GET['id']))$Id = (int)$_GET['id'];
if(isset($_POST['id']))$Id = (int)$_POST['id'];
eval("echo \"" . getTemplate("aps/header") . "\";");
$Aps = new ApsParser($userinfo, $settings, $db); $Aps = new ApsParser($userinfo, $settings, $db);
$Aps->MainHandler($action); $Aps->MainHandler($action);
eval("echo \"" . getTemplate('aps/footer') . "\";"); eval("echo \"" . getTemplate("aps/footer") . "\";");
?>

View File

@@ -14,17 +14,21 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); // Required code
require('./lib/init.php');
if ($action == 'add') { define('AREA', 'customer');
// Create new autoresponder require ("./lib/init.php");
if (isset($_POST['send'])
&& $_POST['send'] == 'send' // Create new autoresponder
) {
if($action == "add")
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$account = trim($_POST['account']); $account = trim($_POST['account']);
$subject = trim($_POST['subject']); $subject = trim($_POST['subject']);
$message = trim($_POST['message']); $message = trim($_POST['message']);
@@ -38,31 +42,39 @@ if ($action == 'add') {
$ts_from = -1; $ts_from = -1;
$ts_until = -1; $ts_until = -1;
if ($date_from_off > -1) { if($date_from_off > -1)
{
$date_from = $_POST['date_from']; $date_from = $_POST['date_from'];
$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4)); $ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
} }
if ($date_until_off > -1) { if($date_until_off > -1)
{
$date_until = $_POST['date_until']; $date_until = $_POST['date_until'];
$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4)); $ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
} }
if (empty($account) if(empty($account)
|| empty($subject) || empty($subject)
|| empty($message) || empty($message))
) { {
standard_error('missingfields'); standard_error('missingfields');
} }
// Does account exist? // Does account exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('accountnotexisting'); standard_error('accountnotexisting');
} }
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 1) {
if($db->num_rows($result) == 1)
{
standard_error('autoresponderalreadyexists'); standard_error('autoresponderalreadyexists');
} }
@@ -80,33 +92,36 @@ if ($action == 'add') {
} }
// Get accounts // Get accounts
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('noemailaccount'); standard_error('noemailaccount');
} }
$accounts = ''; $accounts = '';
while ($row = $db->fetch_array($result)) {
$accounts .= '<option value="' . $row['email'] . '">' . $row['email'] . '</option>'; while($row = $db->fetch_array($result))
{
$accounts.= "<option value=\"" . $row['email'] . "\">" . $row['email'] . "</option>";
} }
$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true); $date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true); $date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
//$isactive = makeyesno('active', '1', '0', '1'); eval("echo \"" . getTemplate("email/autoresponder_add") . "\";");
}
$autoresponder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_add.php'; // Edit autoresponder
$autoresponder_add_form = htmlform::genHTMLForm($autoresponder_add_data);
$title = $autoresponder_add_data['autoresponder_add']['title']; else
$image = $autoresponder_add_data['autoresponder_add']['image'];
eval("echo \"" . getTemplate('autoresponder/autoresponder_add') . "\";"); if($action == "edit")
} elseif ($action == 'edit') { {
// Edit autoresponder if(isset($_POST['send'])
if (isset($_POST['send']) && $_POST['send'] == 'send')
&& $_POST['send'] == 'send' {
) {
$account = trim($_POST['account']); $account = trim($_POST['account']);
$subject = trim($_POST['subject']); $subject = trim($_POST['subject']);
$message = trim($_POST['message']); $message = trim($_POST['message']);
@@ -120,36 +135,49 @@ if ($action == 'add') {
$ts_from = -1; $ts_from = -1;
$ts_until = -1; $ts_until = -1;
if ($date_from_off > -1) { if($date_from_off > -1)
{
$date_from = $_POST['date_from']; $date_from = $_POST['date_from'];
$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4)); $ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
} }
if ($date_until_off > -1) { if($date_until_off > -1)
{
$date_until = $_POST['date_until']; $date_until = $_POST['date_until'];
$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4)); $ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
} }
if (empty($account) if(empty($account)
|| empty($subject) || empty($subject)
|| empty($message) || empty($message))
) { {
standard_error('missingfields'); standard_error('missingfields');
} }
// Does account exist? // Does account exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0)
if($db->num_rows($result) == 0)
{ {
standard_error('accountnotexisting'); standard_error('accountnotexisting');
} }
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
$ResponderActive = (isset($_POST['active']) && $_POST['active'] == '1') ? 1 : 0; $ResponderActive = 0;
if(isset($_POST['active'])
&& $_POST['active'] == '1')
{
$ResponderActive = 1;
}
$db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "` $db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "`
SET `message` = '" . $db->escape($message) . "', SET `message` = '" . $db->escape($message) . "',
@@ -166,8 +194,11 @@ if ($action == 'add') {
$email = trim(htmlspecialchars($_GET['email'])); $email = trim(htmlspecialchars($_GET['email']));
// Get account data // Get account data
$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1"); $result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
@@ -178,43 +209,56 @@ if ($action == 'add') {
$date_from = (int)$row['date_from']; $date_from = (int)$row['date_from'];
$date_until = (int)$row['date_until']; $date_until = (int)$row['date_until'];
if ($date_from == -1) { if($date_from == -1)
{
$deactivated = '-1'; $deactivated = '-1';
$date_from = ''; }
} else { else
{
$deactivated = '0'; $deactivated = '0';
$date_from = date('d-m-Y', $date_from); $date_from = date('d-m-Y', $date_from);
} }
$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true); $date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
if ($date_until == -1) { if($date_until == -1)
{
$deactivated = '-1'; $deactivated = '-1';
$date_until = ''; $date_until = '-1';
} else { }
else
{
$deactivated = '0'; $deactivated = '0';
$date_until = date('d-m-Y', $date_until); $date_until = date('d-m-Y', $date_until);
} }
$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true); $date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
//$isactive = makeyesno('active', '1', '0', $row['enabled']); $checked = '';
$autoresponder_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_edit.php'; if($row['enabled'] == 1)
$autoresponder_edit_form = htmlform::genHTMLForm($autoresponder_edit_data); {
$checked = "checked=\"checked\"";
}
$title = $autoresponder_edit_data['autoresponder_edit']['title']; eval("echo \"" . getTemplate("email/autoresponder_edit") . "\";");
$image = $autoresponder_edit_data['autoresponder_edit']['image']; }
eval("echo \"" . getTemplate('autoresponder/autoresponder_edit') . "\";"); // Delete autoresponder
} elseif ($action == 'delete') {
// Delete autoresponder else
if (isset($_POST['send'])
&& $_POST['send'] == 'send' if($action == "delete")
) { {
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$account = trim($_POST['account']); $account = trim($_POST['account']);
// Does autoresponder exist? // Does autoresponder exist?
$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1"); $result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
if ($db->num_rows($result) == 0) {
if($db->num_rows($result) == 0)
{
standard_error('invalidautoresponder'); standard_error('invalidautoresponder');
} }
@@ -228,25 +272,37 @@ if ($action == 'add') {
$email = trim(htmlspecialchars($_GET['email'])); $email = trim(htmlspecialchars($_GET['email']));
ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email)); ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email));
} else { }
// List existing autoresponders
// List existing autoresponders
else
{
$autoresponder = ''; $autoresponder = '';
$count = 0;
$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC"); $result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($row['date_from'] == -1 && $row['date_until'] == -1) { {
if($row['date_from'] == -1 && $row['date_until'] == -1)
{
$activated_date = $lng['panel']['not_activated']; $activated_date = $lng['panel']['not_activated'];
} elseif($row['date_from'] == -1 && $row['date_until'] != -1) { }
elseif($row['date_from'] == -1 && $row['date_until'] != -1)
{
$activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']); $activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']);
} elseif($row['date_from'] != -1 && $row['date_until'] == -1) { }
elseif($row['date_from'] != -1 && $row['date_until'] == -1)
{
$activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']); $activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']);
} else { }
else
{
$activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']); $activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']);
} }
eval("\$autoresponder.=\"" . getTemplate('autoresponder/autoresponder_autoresponder') . "\";"); eval("\$autoresponder.=\"" . getTemplate("email/autoresponder_autoresponder") . "\";");
$count++;
} }
eval("echo \"" . getTemplate('autoresponder/autoresponder') . "\";"); eval("echo \"" . getTemplate("email/autoresponder") . "\";");
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -45,7 +45,9 @@ elseif($page == 'domains')
{ {
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains");
$fields = array( $fields = array(
'd.domain' => $lng['domains']['domainname'] 'd.domain' => $lng['domains']['domainname'],
'd.documentroot' => $lng['panel']['path'],
'd.aliasdomain' => $lng['domains']['aliasdomain']
); );
$paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
@@ -71,33 +73,17 @@ elseif($page == 'domains')
$parentdomains_count++; $parentdomains_count++;
} }
/**
* check for set ssl-certs to show different state-icons
*/
// nothing (ssl_global)
$row['domain_hascert'] = 0;
$ssl_result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`='".(int)$row['id']."';");
if (is_array($ssl_result)
&& isset($ssl_result['ssl_cert_file'])
&& $ssl_result['ssl_cert_file'] != ''
) {
// own certificate (ssl_customer_green)
$row['domain_hascert'] = 1;
} else {
// check if it's parent has one set (shared)
if ($row['parentdomainid'] != 0) {
$ssl_result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`='".(int)$row['parentdomainid']."';");
if (is_array($ssl_result)
&& isset($ssl_result['ssl_cert_file'])
&& $ssl_result['ssl_cert_file'] != ''
) {
// parent has a certificate (ssl_shared)
$row['domain_hascert'] = 2;
}
}
}
$domains_count++; $domains_count++;
/*
$domainparts = explode('.', $row['domain']);
$domainparts = array_reverse($domainparts);
$sortkey = '';
foreach($domainparts as $key => $part)
{
$sortkey.= $part . '.';
}
$domain_array[$sortkey] = $row;
*/
$domain_array[$row['domain']] = $row; $domain_array[$row['domain']] = $row;
} }
@@ -165,14 +151,6 @@ elseif($page == 'domains')
$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot']))); $row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
} }
// get ssl-ips if activated
$show_ssledit = false;
if ($settings['system']['use_ssl'] == '1'
&& domainHasSslIpPort($row['id'])
&& $row['caneditdomain'] == '1'
) {
$show_ssledit = true;
}
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";"); eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
} }
@@ -218,10 +196,7 @@ elseif($page == 'domains')
$result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
else else
@@ -256,7 +231,7 @@ elseif($page == 'domains')
if($aliasdomain != 0) if($aliasdomain != 0)
{ {
// also check ip/port combination to be the same, #176 // also check ip/port combination to be the same, #176
$aliasdomain_check = $db->query_first("SELECT `d`.`id` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` = '".(int)$aliasdomain."' AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`customerid` = '" . (int)$userinfo['customerid'] . "' AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '".(int)$aliasdomain."') GROUP BY `d`.`domain` ORDER BY `d`.`domain` ASC;"); $aliasdomain_check = $db->query_first('SELECT `id` FROM `' . TABLE_PANEL_DOMAINS . '` `d`,`' . TABLE_PANEL_CUSTOMERS . '` `c` WHERE `d`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`aliasdomain` IS NULL AND `d`.`id`<>`c`.`standardsubdomain` AND `c`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`id`=\'' . (int)$aliasdomain . '\' AND `d`.`ipandport` = \''.(int)$domain_check['ipandport'].'\'');
} }
if(isset($_POST['url']) if(isset($_POST['url'])
@@ -274,17 +249,8 @@ elseif($page == 'domains')
if(!preg_match('/^https?\:\/\//', $path) if(!preg_match('/^https?\:\/\//', $path)
|| !validateUrl($idna_convert->encode($path))) || !validateUrl($idna_convert->encode($path)))
{ {
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, $path = $userinfo['documentroot'] . '/' . $path;
// set default path to subdomain or domain name $path = makeCorrectDir($path);
if((($path == '') || ($path == '/'))
&& $settings['system']['documentroot_use_default_value'] == 1)
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
}
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
}
if (strstr($path, ":") !== FALSE) if (strstr($path, ":") !== FALSE)
{ {
standard_error('pathmaynotcontaincolon'); standard_error('pathmaynotcontaincolon');
@@ -358,18 +324,18 @@ elseif($page == 'domains')
`customerid` = '" . (int)$userinfo['customerid'] . "', `customerid` = '" . (int)$userinfo['customerid'] . "',
`domain` = '" . $db->escape($completedomain) . "', `domain` = '" . $db->escape($completedomain) . "',
`documentroot` = '" . $db->escape($path) . "', `documentroot` = '" . $db->escape($path) . "',
`ipandport` = '" . $db->escape($domain_check['ipandport']) . "',
`aliasdomain` = ".(($aliasdomain != 0) ? "'" . $db->escape($aliasdomain) . "'" : "NULL") .", `aliasdomain` = ".(($aliasdomain != 0) ? "'" . $db->escape($aliasdomain) . "'" : "NULL") .",
`parentdomainid` = '" . (int)$domain_check['id'] . "', `parentdomainid` = '" . (int)$domain_check['id'] . "',
`isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', `isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "',
`openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "', `openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "',
`openbasedir_path` = '" . $db->escape($openbasedir_path) . "', `openbasedir_path` = '" . $db->escape($openbasedir_path) . "',
`safemode` = '" . $db->escape($domain_check['safemode']) . "',
`speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "', `speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "',
`specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "', `specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "',
`ssl_redirect` = '" . $ssl_redirect . "', `ssl_redirect` = '" . $ssl_redirect . "',
`phpsettingid` = '" . $phpsid_result['phpsettingid'] . "'"); `phpsettingid` = '" . $phpsid_result['phpsettingid'] . "'");
$result = $db->query("INSERT INTO `".TABLE_DOMAINTOIP."` (`id_domain`, `id_ipandports`) SELECT LAST_INSERT_ID(), `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '" . (int)$domain_check['id'] . "';");
if($_doredirect) if($_doredirect)
{ {
$did = $db->insert_id(); $did = $db->insert_id();
@@ -380,10 +346,7 @@ elseif($page == 'domains')
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} }
@@ -405,9 +368,9 @@ elseif($page == 'domains')
$aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']); $aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
} }
$redirectcode = '';
if($settings['customredirect']['enabled'] == '1') if($settings['customredirect']['enabled'] == '1')
{ {
$redirectcode = '';
$codes = getRedirectCodesArray(); $codes = getRedirectCodesArray();
foreach($codes as $rc) foreach($codes as $rc)
{ {
@@ -415,22 +378,9 @@ elseif($page == 'domains')
} }
} }
// check if we at least have one ssl-ip/port, #1179 $ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
$ssl_ipsandports = '';
$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
$ssl_ipsandports = 'notempty';
}
$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true); $openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php';
$subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data);
$title = $subdomain_add_data['domain_add']['title'];
$image = $subdomain_add_data['domain_add']['image'];
eval("echo \"" . getTemplate("domains/domains_add") . "\";"); eval("echo \"" . getTemplate("domains/domains_add") . "\";");
} }
} }
@@ -438,7 +388,7 @@ elseif($page == 'domains')
elseif($action == 'edit' elseif($action == 'edit'
&& $id != 0) && $id != 0)
{ {
$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`wwwserveralias`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'"); $result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
$alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\''); $alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\'');
$alias_check = $alias_check['count']; $alias_check = $alias_check['count'];
$_doredirect = false; $_doredirect = false;
@@ -464,17 +414,8 @@ elseif($page == 'domains')
if(!preg_match('/^https?\:\/\//', $path) if(!preg_match('/^https?\:\/\//', $path)
|| !validateUrl($idna_convert->encode($path))) || !validateUrl($idna_convert->encode($path)))
{ {
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, $path = $userinfo['documentroot'] . '/' . $path;
// set default path to subdomain or domain name $path = makeCorrectDir($path);
if((($path == '') || ($path == '/'))
&& $settings['system']['documentroot_use_default_value'] == 1)
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
}
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
}
if (strstr($path, ":") !== FALSE) if (strstr($path, ":") !== FALSE)
{ {
standard_error('pathmaynotcontaincolon'); standard_error('pathmaynotcontaincolon');
@@ -487,14 +428,15 @@ elseif($page == 'domains')
$aliasdomain = intval($_POST['alias']); $aliasdomain = intval($_POST['alias']);
if(isset($_POST['selectserveralias']) if(isset($_POST['iswildcarddomain'])
&& $_POST['iswildcarddomain'] == '1'
&& $result['parentdomainid'] == '0' && $result['parentdomainid'] == '0'
) { ){
$iswildcarddomain = ($_POST['selectserveralias'] == '0') ? '1' : '0'; $iswildcarddomain = '1';
$wwwserveralias = ($_POST['selectserveralias'] == '1') ? '1' : '0'; }
} else { else
{
$iswildcarddomain = '0'; $iswildcarddomain = '0';
$wwwserveralias = '0';
} }
if($result['parentdomainid'] != '0' if($result['parentdomainid'] != '0'
@@ -564,28 +506,15 @@ elseif($page == 'domains')
if($path != $result['documentroot'] if($path != $result['documentroot']
|| $isemaildomain != $result['isemaildomain'] || $isemaildomain != $result['isemaildomain']
|| $wwwserveralias != $result['wwwserveralias']
|| $iswildcarddomain != $result['iswildcarddomain'] || $iswildcarddomain != $result['iswildcarddomain']
|| $aliasdomain != $result['aliasdomain'] || $aliasdomain != $result['aliasdomain']
|| $openbasedir_path != $result['openbasedir_path'] || $openbasedir_path != $result['openbasedir_path']
|| $ssl_redirect != $result['ssl_redirect']) || $ssl_redirect != $result['ssl_redirect'])
{ {
$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'"); $log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET $result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
`documentroot`='" . $db->escape($path) . "',
`isemaildomain`='" . (int)$isemaildomain . "',
`wwwserveralias`='" . (int)$wwwserveralias . "',
`iswildcarddomain`='" . (int)$iswildcarddomain . "',
`aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",
`openbasedir_path`='" . $db->escape($openbasedir_path) . "',
`ssl_redirect`='" . $ssl_redirect . "'
WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"
);
inserttask('1'); inserttask('1');
// Using nameserver, insert a task which rebuilds the server config
inserttask('4'); inserttask('4');
} }
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -594,10 +523,9 @@ elseif($page == 'domains')
else else
{ {
$result['domain'] = $idna_convert->decode($result['domain']); $result['domain'] = $idna_convert->decode($result['domain']);
$domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true); $domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true);
// also check ip/port combination to be the same, #176 // also check ip/port combination to be the same, #176
$result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` <> '".(int)$result['id']."' AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`customerid` = '" . (int)$userinfo['customerid'] . "' AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '".(int)$result['id']."') GROUP BY `d`.`domain` ORDER BY `d`.`domain` ASC"); $result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id`<>'" . (int)$result['id'] . "' AND `c`.`standardsubdomain`<>`d`.`id` AND `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `c`.`customerid`=`d`.`customerid` AND `d`.`ipandport` = '".(int)$result['ipandport']."' ORDER BY `d`.`domain` ASC");
while($row_domain = $db->fetch_array($result_domains)) while($row_domain = $db->fetch_array($result_domains))
{ {
@@ -606,17 +534,10 @@ elseif($page == 'domains')
if(preg_match('/^https?\:\/\//', $result['documentroot']) if(preg_match('/^https?\:\/\//', $result['documentroot'])
&& validateUrl($idna_convert->encode($result['documentroot'])) && validateUrl($idna_convert->encode($result['documentroot']))
) { && $settings['panel']['pathedit'] == 'Dropdown')
if($settings['panel']['pathedit'] == 'Dropdown') {
{ $urlvalue = $result['documentroot'];
$urlvalue = $result['documentroot']; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
}
else
{
$urlvalue = '';
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot'], true);
}
} }
else else
{ {
@@ -624,10 +545,10 @@ elseif($page == 'domains')
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']);
} }
$redirectcode = '';
if($settings['customredirect']['enabled'] == '1') if($settings['customredirect']['enabled'] == '1')
{ {
$def_code = getDomainRedirectId($id); $def_code = getDomainRedirectId($id);
$redirectcode = '';
$codes = getRedirectCodesArray(); $codes = getRedirectCodesArray();
foreach($codes as $rc) foreach($codes as $rc)
{ {
@@ -635,42 +556,19 @@ elseif($page == 'domains')
} }
} }
// check if we at least have one ssl-ip/port, #1179 $ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
$ssl_ipsandports = ''; $iswildcarddomain = makeyesno('iswildcarddomain', '1', '0', $result['iswildcarddomain']);
$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'"); $isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
$ssl_ipsandports = 'notempty';
}
$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true); $openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
// create serveralias options $result_ipandport = $db->query_first("SELECT `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` WHERE `id`='".(int)$result['ipandport']."'");
$serveraliasoptions = ""; if(filter_var($result_ipandport['ip'], FILTER_VALIDATE_IP, FILTER_FLAG_IPV6))
$_value = '2'; {
if ($result['iswildcarddomain'] == '1') { $result_ipandport['ip'] = '[' . $result_ipandport['ip'] . ']';
$_value = '0';
} elseif ($result['wwwserveralias'] == '1') {
$_value = '1';
} }
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_wildcard'], '0', $_value, true, true);
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_www'], '1', $_value, true, true);
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_none'], '2', $_value, true, true);
$resultips = $db->query("SELECT `p`.`ip` AS `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` `p` LEFT JOIN `".TABLE_DOMAINTOIP."` `dip` ON ( `dip`.`id_ipandports` = `p`.`id` ) WHERE `dip`.`id_domain` = '".(int)$result['id']."' GROUP BY `p`.`ip`");
$result_ipandport['ip'] = '';
while ($rowip = $db->fetch_array($resultips)) {
$result_ipandport['ip'] .= $rowip['ip'] . "<br />";
}
$domainip = $result_ipandport['ip']; $domainip = $result_ipandport['ip'];
$result = htmlentities_array($result); $result = htmlentities_array($result);
$subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php';
$subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data);
$title = $subdomain_edit_data['domain_edit']['title'];
$image = $subdomain_edit_data['domain_edit']['image'];
eval("echo \"" . getTemplate("domains/domains_edit") . "\";"); eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
} }
} }
@@ -680,126 +578,5 @@ elseif($page == 'domains')
} }
} }
} }
elseif ($page == 'domainssleditor') {
if ($action == '' ?>
|| $action == 'view'
) {
if (isset($_POST['send'])
&& $_POST['send'] == 'send'
) {
$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
if ($ssl_cert_file != '' && $ssl_key_file == '') {
standard_error('sslcertificateismissingprivatekey');
}
$do_verify = true;
// no cert-file given -> forget everything
if ($ssl_cert_file == '') {
$ssl_key_file = '';
$ssl_ca_file = '';
$ssl_cert_chainfile = '';
$do_verify = false;
}
// verify certificate content
if ($do_verify) {
// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
// openssl_x509_parse() returns information about the supplied x509cert, including fields such as
// subject name, issuer name, purposes, valid from and valid to dates etc.
$cert_content = openssl_x509_parse($ssl_cert_file);
if (is_array($cert_content)
&& isset($cert_content['subject'])
&& isset($cert_content['subject']['CN'])
) {
// TODO self-signed certs might differ and don't need/want this
/*
$domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'");
if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) {
standard_error('sslcertificatewrongdomain');
}
*/
// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
// Checks whether the given key is the private key that corresponds to cert.
if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
standard_error('sslcertificateinvalidcertkeypair');
}
// check optional stuff
if ($ssl_ca_file != '') {
$ca_content = openssl_x509_parse($ssl_ca_file);
if (!is_array($ca_content)) {
// invalid
standard_error('sslcertificateinvalidca');
}
}
if ($ssl_cert_chainfile != '') {
$chain_content = openssl_x509_parse($ssl_cert_chainfile);
if (!is_array($chain_content)) {
// invalid
standard_error('sslcertificateinvalidchain');
}
}
} else {
standard_error('sslcertificateinvalidcert');
}
}
// Add/Update database entry
$qrystart = "UPDATE ";
$qrywhere = "WHERE ";
if ($do_insert) {
$qrystart = "INSERT INTO ";
$qrywhere = ", ";
}
$db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
`ssl_cert_file` = '".$db->escape($ssl_cert_file)."',
`ssl_key_file` = '".$db->escape($ssl_key_file)."',
`ssl_ca_file` = '".$db->escape($ssl_ca_file)."',
`ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."'
".$qrywhere." `domainid`='".(int)$id."';"
);
// insert task to re-generate webserver-configs (#1260)
inserttask('1');
// back to domain overview
redirectTo($filename, array('page' => 'domains', 's' => $s));
}
$result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
WHERE `domainid`='".(int)$id."';"
);
$do_insert = false;
// if no entry can be found, behave like we have empty values
if (!is_array($result) || !isset($result['ssl_cert_file'])) {
$result = array(
'ssl_cert_file' => '',
'ssl_key_file' => '',
'ssl_ca_file' => '',
'ssl_cert_chainfile' => ''
);
$do_insert = true;
}
$result = htmlentities_array($result);
$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
$title = $ssleditor_data['domain_ssleditor']['title'];
$image = $ssleditor_data['domain_ssleditor']['image'];
eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
}
}

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -50,7 +50,7 @@ elseif($page == 'emails')
'm.destination' => $lng['emails']['forwarders'] 'm.destination' => $lng['emails']['forwarders']
); );
$paging = new paging($userinfo, $db, TABLE_MAIL_VIRTUAL, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_MAIL_VIRTUAL, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query('SELECT `m`.`id`, `m`.`domainid`, `m`.`email`, `m`.`email_full`, `m`.`iscatchall`, `u`.`quota`, `m`.`destination`, `m`.`popaccountid`, `d`.`domain`, `u`.`mboxsize` FROM `' . TABLE_MAIL_VIRTUAL . '` `m` LEFT JOIN `' . TABLE_PANEL_DOMAINS . '` `d` ON (`m`.`domainid` = `d`.`id`) LEFT JOIN `' . TABLE_MAIL_USERS . '` `u` ON (`m`.`popaccountid` = `u`.`id`) WHERE `m`.`customerid`="' . $db->escape($userinfo['customerid']) . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query('SELECT `m`.`id`, `m`.`domainid`, `m`.`email`, `m`.`email_full`, `m`.`iscatchall`, `u`.`quota`, `m`.`destination`, `m`.`popaccountid`, `d`.`domain` FROM `' . TABLE_MAIL_VIRTUAL . '` `m` LEFT JOIN `' . TABLE_PANEL_DOMAINS . '` `d` ON (`m`.`domainid` = `d`.`id`) LEFT JOIN `' . TABLE_MAIL_USERS . '` `u` ON (`m`.`popaccountid` = `u`.`id`) WHERE `m`.`customerid`="' . $db->escape($userinfo['customerid']) . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -66,7 +66,6 @@ elseif($page == 'emails')
$emails[$row['domain']] = array(); $emails[$row['domain']] = array();
} }
$row['mboxsize'] = size_readable($row['mboxsize']);
$emails[$row['domain']][$row['email_full']] = $row; $emails[$row['domain']][$row['email_full']] = $row;
} }
@@ -238,7 +237,7 @@ elseif($page == 'emails')
standard_error('emailiswrong', $email_full); standard_error('emailiswrong', $email_full);
} }
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE (`email` = '" . strtolower($db->escape($email)) . "' OR `email_full` = '" . strtolower($db->escape($email_full)) . "') AND `customerid`='" . (int)$userinfo['customerid'] . "'"); $email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE ( `email`='" . $db->escape($email) . "' OR `email_full` = '" . $db->escape($email_full) . "' ) AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email == '' if($email == ''
|| $email_full == '' || $email_full == ''
@@ -254,7 +253,7 @@ elseif($page == 'emails')
{ {
standard_error('maindomainnonexist', $domain); standard_error('maindomainnonexist', $domain);
} }
elseif(strtolower($email_check['email_full']) == strtolower($email_full)) elseif($email_check['email_full'] == $email_full)
{ {
standard_error('emailexistalready', $email_full); standard_error('emailexistalready', $email_full);
} }
@@ -282,20 +281,7 @@ elseif($page == 'emails')
$domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']); $domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']);
} }
//$iscatchall = makeyesno('iscatchall', '1', '0', '0'); $iscatchall = makeyesno('iscatchall', '1', '0', '0');
$email_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_add.php';
if ( $settings['catchall']['catchall_enabled'] != '1' )
{
unset($email_add_data['emails_add']['sections']['section_a']['fields']['iscatchall']);
}
$email_add_form = htmlform::genHTMLForm($email_add_data);
$title = $email_add_data['emails_add']['title'];
$image = $email_add_data['emails_add']['image'];
eval("echo \"" . getTemplate("email/emails_add") . "\";"); eval("echo \"" . getTemplate("email/emails_add") . "\";");
} }
} }
@@ -335,60 +321,40 @@ elseif($page == 'emails')
$destinations_count = count($result['destination']); $destinations_count = count($result['destination']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$email_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_edit.php';
if ( $settings['catchall']['catchall_enabled'] != '1' )
{
unset($email_edit_data['emails_edit']['sections']['section_a']['fields']['mail_catchall']);
}
$email_edit_form = htmlform::genHTMLForm($email_edit_data);
$title = $email_edit_data['emails_edit']['title'];
$image = $email_edit_data['emails_edit']['image'];
eval("echo \"" . getTemplate("email/emails_edit") . "\";"); eval("echo \"" . getTemplate("email/emails_edit") . "\";");
} }
} }
elseif($action == 'togglecatchall' elseif($action == 'togglecatchall'
&& $id != 0) && $id != 0)
{ {
if ( $settings['catchall']['catchall_enabled'] == '1' ) $result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
{
$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if(isset($result['email']) if(isset($result['email'])
&& $result['email'] != '') && $result['email'] != '')
{
if($result['iscatchall'] == '1')
{ {
if($result['iscatchall'] == '1') $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
}
else
{
$email_parts = explode('@', $result['email_full']);
$email = '@' . $email_parts[1];
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email_check['email'] == $email)
{ {
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'"); standard_error('youhavealreadyacatchallforthisdomain');
exit;
} }
else else
{ {
$email_parts = explode('@', $result['email_full']); $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
$email = '@' . $email_parts[1]; $log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if($email_check['email'] == $email)
{
standard_error('youhavealreadyacatchallforthisdomain');
exit;
}
else
{
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
}
} }
redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
} }
}
else redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
{
standard_error(array('operationnotpermitted', 'featureisdisabled'), 'Catchall');
} }
} }
} }
@@ -459,42 +425,11 @@ elseif($page == 'accounts')
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} }
$cryptPassword = makeCryptPassword($password); $db->query("INSERT INTO `" . TABLE_MAIL_USERS . "` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($email_full) . "', '" . $db->escape($username) . "', " . ($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "'," : '') . " ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_full . '/') . "', '" . (int)$settings['system']['vmail_uid'] . "', '" . (int)$settings['system']['vmail_gid'] . "', '" . (int)$result['domainid'] . "', 'y', '" . (int)$quota . "', '" . (int)$userinfo['imap'] . "', '" . (int)$userinfo['pop3'] . "')");
$email_user=substr($email_full,0,strrpos($email_full,"@"));
$email_domain=substr($email_full,strrpos($email_full,"@")+1);
$maildirname=trim($settings['system']['vmail_maildirname']);
// Add trailing slash to Maildir if needed
$maildirpath=$maildirname;
if (!empty($maildirname) and substr($maildirname,-1) != "/") $maildirpath.="/";
$db->query("INSERT INTO `" . TABLE_MAIL_USERS .
"` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) ".
"VALUES (".
"'" . (int)$userinfo['customerid'] . "', ".
"'" . $db->escape($email_full) . "', ".
"'" . $db->escape($username) . "', " .
($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "', " : '') .
"'" . $db->escape($cryptPassword) . "', ".
"'" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_domain . "/" . $email_user . "/" . $maildirpath) . "', ".
"'" . (int)$settings['system']['vmail_uid'] . "', ".
"'" . (int)$settings['system']['vmail_gid'] . "', ".
"'" . (int)$result['domainid'] . "', ".
"'y', ".
"'" . (int)$quota . "', ".
"'" . (int)$userinfo['imap'] . "', ".
"'" . (int)$userinfo['pop3'] . "')");
$popaccountid = $db->insert_id(); $popaccountid = $db->insert_id();
$result['destination'].= ' ' . $email_full; $result['destination'].= ' ' . $email_full;
$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET ". $db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', `popaccountid` = '" . (int)$popaccountid . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
"`destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', ". $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used`=`email_accounts_used`+1, `email_quota_used`=`email_quota_used`+" . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
"`popaccountid` = '" . (int)$popaccountid . "' ".
"WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET ".
"`email_accounts_used`=`email_accounts_used`+1, ".
"`email_quota_used`=`email_quota_used`+" . (int)$quota . " ".
"WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'");
$replace_arr = array( $replace_arr = array(
'EMAIL' => $email_full, 'EMAIL' => $email_full,
@@ -513,7 +448,7 @@ elseif($page == 'accounts')
$mail->Subject = $mail_subject; $mail->Subject = $mail_subject;
$mail->AltBody = $mail_body; $mail->AltBody = $mail_body;
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body)); $mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
$mail->AddAddress($email_full); $mail->AddAddress($email_full, getCorrectUserSalutation($userinfo));
$mail->Send(); $mail->Send();
} catch(phpmailerException $e) { } catch(phpmailerException $e) {
$mailerr_msg = $e->errorMessage(); $mailerr_msg = $e->errorMessage();
@@ -570,13 +505,6 @@ elseif($page == 'accounts')
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$quota = $settings['system']['mail_quota']; $quota = $settings['system']['mail_quota'];
$account_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addaccount.php';
$account_add_form = htmlform::genHTMLForm($account_add_data);
$title = $account_add_data['emails_addaccount']['title'];
$image = $account_add_data['emails_addaccount']['image'];
eval("echo \"" . getTemplate("email/account_add") . "\";"); eval("echo \"" . getTemplate("email/account_add") . "\";");
} }
} }
@@ -608,21 +536,13 @@ elseif($page == 'accounts')
$password = validatePassword($password); $password = validatePassword($password);
$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'");
$cryptPassword = makeCryptPassword($password); $result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s)); redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
} }
else else
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$account_changepw_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangepasswd.php';
$account_changepw_form = htmlform::genHTMLForm($account_changepw_data);
$title = $account_changepw_data['emails_accountchangepasswd']['title'];
$image = $account_changepw_data['emails_accountchangepasswd']['image'];
eval("echo \"" . getTemplate("email/account_changepw") . "\";"); eval("echo \"" . getTemplate("email/account_changepw") . "\";");
} }
} }
@@ -664,13 +584,6 @@ elseif($page == 'accounts')
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$quota_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangequota.php';
$quota_edit_form = htmlform::genHTMLForm($quota_edit_data);
$title = $quota_edit_data['emails_accountchangequota']['title'];
$image = $quota_edit_data['emails_accountchangequota']['image'];
eval("echo \"" . getTemplate("email/account_changequota") . "\";"); eval("echo \"" . getTemplate("email/account_changequota") . "\";");
} }
} }
@@ -765,13 +678,6 @@ elseif($page == 'forwarders')
{ {
$result['email_full'] = $idna_convert->decode($result['email_full']); $result['email_full'] = $idna_convert->decode($result['email_full']);
$result = htmlentities_array($result); $result = htmlentities_array($result);
$forwarder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addforwarder.php';
$forwarder_add_form = htmlform::genHTMLForm($forwarder_add_data);
$title = $forwarder_add_data['emails_addforwarder']['title'];
$image = $forwarder_add_data['emails_addforwarder']['image'];
eval("echo \"" . getTemplate("email/forwarder_add") . "\";"); eval("echo \"" . getTemplate("email/forwarder_add") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -39,30 +39,6 @@ if($page == 'overview')
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras");
eval("echo \"" . getTemplate("extras/extras") . "\";"); eval("echo \"" . getTemplate("extras/extras") . "\";");
} }
elseif($page == 'backup')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras_backup");
$result = $db->query("SELECT `backup_enabled` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$row = $db->fetch_array($result);
$backup_enabled = makeyesno('backup_enabled', '1', '0', $row['backup_enabled']);
if(isset($_POST['send']) && $_POST['send'] == 'send'){
$backup_enabled = ($_POST['backup_enabled'] == '1' ? '1' : '0');
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `backup_enabled`='" . $backup_enabled . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
redirectTo($filename, Array('page' => $page, 's' => $s));
}
$backup_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.backup.php';
$backup_form = htmlform::genHTMLForm($backup_data);
$title = $backup_data['backup']['title'];
$image = $backup_data['backup']['image'];
eval("echo \"" . getTemplate("extras/backup") . "\";");
}
elseif($page == 'htpasswds') elseif($page == 'htpasswds')
{ {
if($action == '') if($action == '')
@@ -185,13 +161,6 @@ elseif($page == 'htpasswds')
else else
{ {
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$htpasswd_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_add.php';
$htpasswd_add_form = htmlform::genHTMLForm($htpasswd_add_data);
$title = $htpasswd_add_data['htpasswd_add']['title'];
$image = $htpasswd_add_data['htpasswd_add']['image'];
eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";"); eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";");
} }
} }
@@ -251,13 +220,6 @@ elseif($page == 'htpasswds')
} }
$result = htmlentities_array($result); $result = htmlentities_array($result);
$htpasswd_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_edit.php';
$htpasswd_edit_form = htmlform::genHTMLForm($htpasswd_edit_data);
$title = $htpasswd_edit_data['htpasswd_edit']['title'];
$image = $htpasswd_edit_data['htpasswd_edit']['image'];
eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";"); eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";");
} }
} }
@@ -352,28 +314,18 @@ elseif($page == 'htaccess')
standard_error('invalidpath'); standard_error('invalidpath');
} }
if(isset($_POST['options_cgi']) if(isset($_POST['options_cgi']))
&& (int)$_POST['options_cgi'] != 0 {
) { $options_cgi = intval($_POST['options_cgi']);
$options_cgi = '1';
} }
else else
{ {
$options_cgi = '0'; $options_cgi = '0';
} }
$error404path = ''; $error404path = correctErrorDocument($_POST['error404path']);
if (isset($_POST['error404path'])) { $error403path = correctErrorDocument($_POST['error403path']);
$error404path = correctErrorDocument($_POST['error404path']); $error500path = correctErrorDocument($_POST['error500path']);
}
$error403path = '';
if (isset($_POST['error403path'])) {
$error403path = correctErrorDocument($_POST['error403path']);
}
$error500path = '';
if (isset($_POST['error500path'])) {
$error500path = correctErrorDocument($_POST['error500path']);
}
if($path_dupe_check['path'] == $path) if($path_dupe_check['path'] == $path)
{ {
@@ -402,18 +354,9 @@ elseif($page == 'htaccess')
else else
{ {
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
/*
$options_indexes = makeyesno('options_indexes', '1', '0', '0'); $options_indexes = makeyesno('options_indexes', '1', '0', '0');
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
$options_cgi = makeyesno('options_cgi', '1', '0', '0'); $options_cgi = makeyesno('options_cgi', '1', '0', '0');
*/
$htaccess_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_add.php';
$htaccess_add_form = htmlform::genHTMLForm($htaccess_add_data);
$title = $htaccess_add_data['htaccess_add']['title'];
$image = $htaccess_add_data['htaccess_add']['image'];
eval("echo \"" . getTemplate("extras/htaccess_add") . "\";"); eval("echo \"" . getTemplate("extras/htaccess_add") . "\";");
} }
} }
@@ -471,19 +414,10 @@ elseif($page == 'htaccess')
$result['error404path'] = $result['error404path']; $result['error404path'] = $result['error404path'];
$result['error403path'] = $result['error403path']; $result['error403path'] = $result['error403path'];
$result['error500path'] = $result['error500path']; $result['error500path'] = $result['error500path'];
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
/*
$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']); $options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']); $options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
*/
$result = htmlentities_array($result); $result = htmlentities_array($result);
$htaccess_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_edit.php';
$htaccess_edit_form = htmlform::genHTMLForm($htaccess_edit_data);
$title = $htaccess_edit_data['htaccess_edit']['title'];
$image = $htaccess_edit_data['htaccess_edit']['image'];
eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";"); eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";");
} }
} }

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,27 +22,34 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
$id = 0; require ("./lib/init.php");
if (isset($_POST['id'])) {
if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
eval("echo \"" . getTemplate('ftp/ftp') . "\";"); eval("echo \"" . getTemplate("ftp/ftp") . "\";");
} elseif ($page == 'accounts') { }
if ($action == '') { elseif($page == 'accounts')
{
if($action == '')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
$fields = array( $fields = array(
'username' => $lng['login']['username'], 'username' => $lng['login']['username'],
'homedir' => $lng['panel']['path'] 'homedir' => $lng['panel']['path']
); );
$paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' AND `username` NOT LIKE '%_backup'" . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -52,18 +59,23 @@ if ($page == 'overview') {
$count = 0; $count = 0;
$accounts = ''; $accounts = '';
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
if ($paging->checkDisplay($i)) { {
if (strpos($row['homedir'], $userinfo['documentroot']) === 0) { if($paging->checkDisplay($i))
{
if(strpos($row['homedir'], $userinfo['documentroot']) === 0)
{
$row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot'])); $row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot']));
} else { }
else
{
$row['documentroot'] = $row['homedir']; $row['documentroot'] = $row['homedir'];
} }
$row['documentroot'] = makeCorrectDir($row['documentroot']); $row['documentroot'] = makeCorrectDir($row['documentroot']);
$row = htmlentities_array($row); $row = htmlentities_array($row);
eval("\$accounts.=\"" . getTemplate('ftp/accounts_account') . "\";"); eval("\$accounts.=\"" . getTemplate("ftp/accounts_account") . "\";");
$count++; $count++;
} }
@@ -71,87 +83,118 @@ if ($page == 'overview') {
} }
$ftps_count = $db->num_rows($result); $ftps_count = $db->num_rows($result);
eval("echo \"" . getTemplate('ftp/accounts') . "\";"); eval("echo \"" . getTemplate("ftp/accounts") . "\";");
} elseif ($action == 'delete' && $id != 0) { }
elseif($action == 'delete'
&& $id != 0)
{
$result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if (isset($result['username']) if(isset($result['username'])
&& $result['username'] != $userinfo['loginname'] && $result['username'] != $userinfo['loginname'])
) { {
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'"); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'");
$result = $db->query_first("SELECT `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query("SELECT `username` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($result['username']) . "'"); while($row = $db->fetch_array($result))
{
$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($row['username']) . "'");
}
$db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
$log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'");
$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$resetaccnumber = ($userinfo['ftps_used'] == '1') ? " , `ftp_lastaccountnumber`='0'" : ''; if($userinfo['ftps_used'] == '1')
{
$resetaccnumber = " , `ftp_lastaccountnumber`='0'";
}
else
{
$resetaccnumber = '';
}
// refs #293 // refs #293
if (isset($_POST['delete_userfiles']) if(isset($_POST['delete_userfiles'])
&& (int)$_POST['delete_userfiles'] == 1 && (int)$_POST['delete_userfiles'] == 1)
) { {
inserttask('8', $userinfo['loginname'], $result['homedir']); inserttask('8', $userinfo['loginname'], $result['homedir']);
} }
$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
else
{
ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']); ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
} }
} else { }
else
{
standard_error('ftp_cantdeletemainaccount'); standard_error('ftp_cantdeletemainaccount');
} }
} elseif ($action == 'add') { }
if ($userinfo['ftps_used'] < $userinfo['ftps'] elseif($action == 'add')
|| $userinfo['ftps'] == '-1' {
) { if($userinfo['ftps_used'] < $userinfo['ftps']
if (isset($_POST['send']) || $userinfo['ftps'] == '-1')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
// @FIXME use a good path-validating regex here (refs #1231) && $_POST['send'] == 'send')
{
$path = validate($_POST['path'], 'path'); $path = validate($_POST['path'], 'path');
$password = validate($_POST['ftp_password'], 'password'); $password = validate($_POST['ftp_password'], 'password');
$password = validatePassword($password); $password = validatePassword($password);
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0; $sendinfomail = intval($_POST['sendinfomail']);
if ($sendinfomail != 1) { if($sendinfomail != 1)
{
$sendinfomail = 0; $sendinfomail = 0;
} }
if ($settings['customer']['ftpatdomain'] == '1') { if($settings['customer']['ftpatdomain'] == '1')
{
$ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/'); $ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
if ($ftpusername == '') { if($ftpusername == '')
{
standard_error(array('stringisempty', 'username')); standard_error(array('stringisempty', 'username'));
} }
$ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain')); $ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain'));
$ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'"); $ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
if ($ftpdomain_check['domain'] != $ftpdomain) { if($ftpdomain_check['domain'] != $ftpdomain)
{
standard_error('maindomainnonexist', $domain); standard_error('maindomainnonexist', $domain);
} }
$username = $ftpusername . "@" . $ftpdomain; $username = $ftpusername . "@" . $ftpdomain;
} else { }
else
{
$username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1); $username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1);
} }
$username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\''); $username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\'');
if (!empty($username_check) && $username_check['username'] = $username) { if(!empty($username_check) && $username_check['username'] = $username)
{
standard_error('usernamealreadyexists', $username); standard_error('usernamealreadyexists', $username);
} elseif ($password == '') { }
elseif($password == '')
{
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
} elseif ($path == '') { }
elseif($path == '')
{
standard_error('patherror'); standard_error('patherror');
} else { }
else
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
$cryptPassword = makeCryptPassword($password); $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
$result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'"); $result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'");
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')"); $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')");
} }
$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'"); $db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'");
@@ -160,10 +203,10 @@ if ($page == 'overview') {
$log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'"); $log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'");
inserttask(5); inserttask(5);
if ($sendinfomail == 1) { if($sendinfomail == 1)
{
$replace_arr = array( $replace_arr = array(
'SALUTATION' => getCorrectUserSalutation($userinfo), 'CUST_NAME' => getCorrectUserSalutation($userinfo),
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
'USR_NAME' => $username, 'USR_NAME' => $username,
'USR_PASS' => $password, 'USR_PASS' => $password,
'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot']))) 'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot'])))
@@ -200,81 +243,84 @@ if ($page == 'overview') {
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} else { }
else
{
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/'); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/');
if ($settings['customer']['ftpatdomain'] == '1') { if($settings['customer']['ftpatdomain'] == '1')
{
$domainlist = array(); $domainlist = array();
$domains = ''; $domains = '';
$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
while ($row_domain = $db->fetch_array($result_domains)) { while($row_domain = $db->fetch_array($result_domains))
{
$domainlist[] = $row_domain['domain']; $domainlist[] = $row_domain['domain'];
} }
sort($domainlist); sort($domainlist);
if (isset($domainlist[0]) && $domainlist[0] != '') { if(isset($domainlist[0]) && $domainlist[0] != '')
foreach ($domainlist as $dom) { {
foreach($domainlist as $dom)
{
$domains .= makeoption($idna_convert->decode($dom), $dom); $domains .= makeoption($idna_convert->decode($dom), $dom);
} }
} }
} }
//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0'); $sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
$ftp_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_add.php'; eval("echo \"" . getTemplate("ftp/accounts_add") . "\";");
$ftp_add_form = htmlform::genHTMLForm($ftp_add_data);
$title = $ftp_add_data['ftp_add']['title'];
$image = $ftp_add_data['ftp_add']['image'];
eval("echo \"" . getTemplate('ftp/accounts_add') . "\";");
} }
} }
} elseif ($action == 'edit' && $id != 0) { }
elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
if (isset($result['username']) if(isset($result['username'])
&& $result['username'] != '' && $result['username'] != '')
) { {
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// @FIXME use a good path-validating regex here (refs #1231)
$path = validate($_POST['path'], 'path'); $path = validate($_POST['path'], 'path');
$_setnewpass = false; $_setnewpass = false;
if (isset($_POST['ftp_password']) && $_POST['ftp_password'] != '') { if(isset($_POST['ftp_password']) && $_POST['ftp_password'] != '')
{
$password = validate($_POST['ftp_password'], 'password'); $password = validate($_POST['ftp_password'], 'password');
$password = validatePassword($password); $password = validatePassword($password);
$_setnewpass = true; $_setnewpass = true;
} }
if ($_setnewpass) { if($_setnewpass)
if ($password == '') { {
if($password == '')
{
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
exit; exit;
} }
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'"); else
$cryptPassword = makeCryptPassword($password); {
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
// also update customers backup user password if password of main ftp user is changed
if(!preg_match('/' . $settings['customer']['ftpprefix'] . '/', $result['username'])){
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $result['username'] . "_backup'");
} }
} }
if ($path != '') { if($path != '')
{
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
if ($path != $result['homedir']) { if($path != $result['homedir'])
if (!file_exists($path)) { {
// it's the task for "new ftp" but that will if(!file_exists($path))
// create all directories and correct their permissions {
inserttask(5); mkDirWithCorrectOwnership($userinfo['documentroot'], $path, $result['uid'], $result['gid']);
} }
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'");
@@ -283,34 +329,37 @@ if ($page == 'overview') {
} }
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
if (strpos($result['homedir'], $userinfo['documentroot']) === 0) { else
{
if(strpos($result['homedir'], $userinfo['documentroot']) === 0)
{
$homedir = substr($result['homedir'], strlen($userinfo['documentroot'])); $homedir = substr($result['homedir'], strlen($userinfo['documentroot']));
} else { }
else
{
$homedir = $result['homedir']; $homedir = $result['homedir'];
} }
$homedir = makeCorrectDir($homedir); $homedir = makeCorrectDir($homedir);
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir);
if ($settings['customer']['ftpatdomain'] == '1') { if($settings['customer']['ftpatdomain'] == '1')
{
$domains = ''; $domains = '';
$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
while ($row_domain = $db->fetch_array($result_domains)) { while($row_domain = $db->fetch_array($result_domains))
$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']); {
$domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
} }
} }
$ftp_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_edit.php'; eval("echo \"" . getTemplate("ftp/accounts_edit") . "\";");
$ftp_edit_form = htmlform::genHTMLForm($ftp_edit_data);
$title = $ftp_edit_data['ftp_edit']['title'];
$image = $ftp_edit_data['ftp_edit']['image'];
eval("echo \"" . getTemplate('ftp/accounts_edit') . "\";");
} }
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,32 +22,40 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require('./lib/init.php');
if ($action == 'logout') { require ("./lib/init.php");
$log->logAction(USR_ACTION, LOG_NOTICE, 'logged out');
$query = "DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'"; if($action == 'logout')
if ($settings['session']['allow_multiple_login'] == '1') { {
$query .= " AND `hash` = '" . $s . "'"; $log->logAction(USR_ACTION, LOG_NOTICE, "logged out");
if($settings['session']['allow_multiple_login'] == '1')
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0' AND `hash` = '" . $s . "'");
} }
$db->query($query); else
{
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'");
}
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index");
$domains = ''; $domains = '';
$result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' "); $result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' ");
$domainArray = array(); $domainArray = array();
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$domainArray[] = $idna_convert->decode($row['domain']); $domainArray[] = $idna_convert->decode($row['domain']);
} }
natsort($domainArray); natsort($domainArray);
$domains = implode(',<br />', $domainArray); $domains = implode(', ', $domainArray);
$userinfo['email'] = $idna_convert->decode($userinfo['email']); $userinfo['email'] = $idna_convert->decode($userinfo['email']);
$yesterday = time() - (60 * 60 * 24); $yesterday = time() - (60 * 60 * 24);
$month = date('M Y', $yesterday); $month = date('M Y', $yesterday);
@@ -60,46 +68,76 @@ if ($page == 'overview') {
$userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']); $userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
$userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']); $userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']);
$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps tickets subdomains aps_packages'); $userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps tickets subdomains aps_packages');
$opentickets = 0;
$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
WHERE `customerid` = "' . $userinfo['customerid'] . '"
AND `answerto` = "0"
AND (`status` = "0" OR `status` = "2")
AND `lastreplier`="1"');
$awaitingtickets = $opentickets['count'];
$awaitingtickets_text = '';
eval("echo \"" . getTemplate('index/index') . "\";"); if($opentickets > 0)
} elseif ($page == 'change_password') { {
if (isset($_POST['send']) && $_POST['send'] == 'send') { $awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>'));
}
eval("echo \"" . getTemplate("index/index") . "\";");
}
elseif($page == 'change_password')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$old_password = validate($_POST['old_password'], 'old password'); $old_password = validate($_POST['old_password'], 'old password');
if (md5($old_password) != $userinfo['password']) {
if(md5($old_password) != $userinfo['password'])
{
standard_error('oldpasswordnotcorrect'); standard_error('oldpasswordnotcorrect');
exit; exit;
} }
$new_password = validatePassword($_POST['new_password'], 'new password'); $new_password = validate($_POST['new_password'], 'new password');
$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm'); $new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
if ($old_password == '') { if($old_password == '')
{
standard_error(array('stringisempty', 'oldpassword')); standard_error(array('stringisempty', 'oldpassword'));
} elseif($new_password == '') { }
elseif($new_password == '')
{
standard_error(array('stringisempty', 'newpassword')); standard_error(array('stringisempty', 'newpassword'));
} elseif($new_password_confirm == '') { }
elseif($new_password_confirm == '')
{
standard_error(array('stringisempty', 'newpasswordconfirm')); standard_error(array('stringisempty', 'newpasswordconfirm'));
} elseif($new_password != $new_password_confirm) { }
elseif($new_password != $new_password_confirm)
{
standard_error('newpasswordconfirmerror'); standard_error('newpasswordconfirmerror');
} else { }
else
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed password'); $log->logAction(USR_ACTION, LOG_NOTICE, 'changed password');
if (isset($_POST['change_main_ftp']) if(isset($_POST['change_main_ftp'])
&& $_POST['change_main_ftp'] == 'true' && $_POST['change_main_ftp'] == 'true')
) { {
$cryptPassword = makeCryptPassword($new_password); $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($new_password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password'); $log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password');
} }
if (isset($_POST['change_webalizer']) if(isset($_POST['change_webalizer'])
&& $_POST['change_webalizer'] == 'true' && $_POST['change_webalizer'] == 'true')
) { {
if (CRYPT_STD_DES == 1) { if(CRYPT_STD_DES == 1)
{
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2); $saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
$new_webalizer_password = crypt($new_password, $saltfordescrypt); $new_webalizer_password = crypt($new_password, $saltfordescrypt);
} else { }
else
{
$new_webalizer_password = crypt($new_password); $new_webalizer_password = crypt($new_password);
} }
@@ -108,52 +146,44 @@ if ($page == 'overview') {
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} }
} else {
eval("echo \"" . getTemplate('index/change_password') . "\";");
} }
} elseif ($page == 'change_language') { else
if (isset($_POST['send']) && $_POST['send'] == 'send') { {
eval("echo \"" . getTemplate("index/change_password") . "\";");
}
}
elseif($page == 'change_language')
{
if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$def_language = validate($_POST['def_language'], 'default language'); $def_language = validate($_POST['def_language'], 'default language');
if (isset($languages[$def_language])) {
if(isset($languages[$def_language]))
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'"); $db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
} }
redirectTo($filename, Array('s' => $s)); redirectTo($filename, Array('s' => $s));
} else { }
else
{
$language_options = '';
$default_lang = $settings['panel']['standardlanguage']; $default_lang = $settings['panel']['standardlanguage'];
if ($userinfo['def_language'] != '') { if($userinfo['def_language'] != '') {
$default_lang = $userinfo['def_language']; $default_lang = $userinfo['def_language'];
} }
$language_options = ''; while(list($language_file, $language_name) = each($languages))
while (list($language_file, $language_name) = each($languages)) { {
$language_options .= makeoption($language_name, $language_file, $default_lang, true); $language_options.= makeoption($language_name, $language_file, $default_lang, true);
} }
eval("echo \"" . getTemplate('index/change_language') . "\";"); eval("echo \"" . getTemplate("index/change_language") . "\";");
}
} elseif ($page == 'change_theme') {
if (isset($_POST['send']) && $_POST['send'] == 'send') {
$theme = validate($_POST['theme'], 'theme');
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'");
redirectTo($filename, Array('s' => $s));
} else {
$default_theme = $settings['panel']['default_theme'];
if ($userinfo['theme'] != '') {
$default_theme = $userinfo['theme'];
}
$theme_options = '';
$themes_avail = getThemes();
foreach ($themes_avail as $t) {
$theme_options .= makeoption($t, $t, $default_theme, true);
}
eval("echo \"" . getTemplate('index/change_theme') . "\";");
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,22 +22,30 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
$need_db_sql_data = true; $need_db_sql_data = true;
$need_root_db_sql_data = true; $need_root_db_sql_data = true;
require('./lib/init.php'); require ("./lib/init.php");
if (isset($_POST['id'])) { if(isset($_POST['id']))
{
$id = intval($_POST['id']); $id = intval($_POST['id']);
} elseif(isset($_GET['id'])) { }
elseif(isset($_GET['id']))
{
$id = intval($_GET['id']); $id = intval($_GET['id']);
} }
if ($page == 'overview') { if($page == 'overview')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
$lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']); $lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']);
eval("echo \"" . getTemplate('mysql/mysql') . "\";"); eval("echo \"" . getTemplate("mysql/mysql") . "\";");
} elseif($page == 'mysqls') { }
if ($action == '') { elseif($page == 'mysqls')
{
if($action == '')
{
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
$fields = array( $fields = array(
'databasename' => $lng['mysql']['databasename'], 'databasename' => $lng['mysql']['databasename'],
@@ -54,117 +62,125 @@ if ($page == 'overview') {
$count = 0; $count = 0;
$mysqls = ''; $mysqls = '';
// Begin root-session while($row = $db->fetch_array($result))
$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], ''); {
while ($row = $db->fetch_array($result)) { if($paging->checkDisplay($i))
if ($paging->checkDisplay($i)) { {
$row = htmlentities_array($row); $row = htmlentities_array($row);
$mbdata = $db_root->query_first("SELECT SUM( data_length + index_length) / 1024 / 1024 'MB' FROM information_schema.TABLES WHERE table_schema = '" . $db_root->escape($row['databasename']) . "' GROUP BY table_schema ;"); eval("\$mysqls.=\"" . getTemplate("mysql/mysqls_database") . "\";");
$row['size'] = number_format($mbdata['MB'], 3, '.', '');
eval("\$mysqls.=\"" . getTemplate('mysql/mysqls_database') . "\";");
$count++; $count++;
} }
$i++; $i++;
} }
$db_root->close();
// End root-session
$mysqls_count = $db->num_rows($result); $mysqls_count = $db->num_rows($result);
eval("echo \"" . getTemplate('mysql/mysqls') . "\";"); eval("echo \"" . getTemplate("mysql/mysqls") . "\";");
} elseif($action == 'delete' && $id != 0) { }
elseif($action == 'delete'
&& $id != 0)
{
$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
if (isset($result['databasename']) if(isset($result['databasename'])
&& $result['databasename'] != '' && $result['databasename'] != '')
) { {
if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) { if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
{
$result['dbserver'] = 0; $result['dbserver'] = 0;
} }
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// Begin root-session // Begin root-session
$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
$log->logAction(USR_ACTION, LOG_INFO, "deleted database '" . $result['databasename'] . "'");
if (mysql_get_server_info() < '5.0.2') {
// Revoke privileges (only required for MySQL 4.1.2 - 5.0.1)
$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($result['databasename']) .'\'',false,true);
}
$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($result['databasename']) . "'"); $db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
while ($host = $db_root->fetch_array($host_res)) { unset($db_root->password);
// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+) foreach(array_map('trim', array_unique(explode(',', $settings['system']['mysql_access_host']))) as $mysql_access_host)
$db_root->query('DROP USER \'' . $db_root->escape($result['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true); {
$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($result['databasename'])) . '` . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($result['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
} }
$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`'); $db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`');
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session // End root-session
$db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
$resetaccnumber = ($userinfo['mysqls_used'] == '1') ? " , `mysql_lastaccountnumber`='0' " : ''; if($userinfo['mysqls_used'] == '1')
{
$resetaccnumber = " , `mysql_lastaccountnumber`='0' ";
}
else
{
$resetaccnumber = '';
}
$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
else
{
$dbnamedesc = $result['databasename']; $dbnamedesc = $result['databasename'];
if (isset($result['description']) && $result['description'] != '') { if(isset($result['description']) && $result['description'] != '') {
$dbnamedesc .= ' ('.$result['description'].')'; $dbnamedesc.= ' ('.$result['description'].')';
} }
ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc); ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc);
} }
} }
} elseif ($action == 'add') { }
if ($userinfo['mysqls_used'] < $userinfo['mysqls'] elseif($action == 'add')
|| $userinfo['mysqls'] == '-1' {
) { if($userinfo['mysqls_used'] < $userinfo['mysqls']
if (isset($_POST['send']) || $userinfo['mysqls'] == '-1')
&& $_POST['send'] == 'send' {
) { if(isset($_POST['send'])
&& $_POST['send'] == 'send')
{
$password = validate($_POST['mysql_password'], 'password'); $password = validate($_POST['mysql_password'], 'password');
$password = validatePassword($password); $password = validatePassword($password);
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0; $sendinfomail = intval($_POST['sendinfomail']);
if ($sendinfomail != 1) { if($sendinfomail != 1)
{
$sendinfomail = 0; $sendinfomail = 0;
} }
if ($password == '') { if($password == '')
{
standard_error(array('stringisempty', 'mypassword')); standard_error(array('stringisempty', 'mypassword'));
} else { }
$dbserver = 0; else
if (count($sql_root) > 1) { {
$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
if(count($sql_root) > 1)
{
$dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0); $dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0);
if (!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver])) {
if(!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver]))
{
$dbserver = 0; $dbserver = 0;
} }
} }
else
// validate description before actual adding the database, #1052 {
$databasedescription = validate(trim($_POST['description']), 'description'); $dbserver = 0;
// Begin root-session
$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
if (strtoupper($settings['customer']['mysqlprefix']) == 'RANDOM') {
$result = $db_root->query('SELECT `User` FROM mysql.user');
while ($row = $db_root->fetch_array($result)) {
$allsqlusers[] = $row[User];
}
$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
while (in_array($username , $allsqlusers)) {
$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
}
} else {
$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
} }
// Begin root-session
$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
unset($db_root->password);
$db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`'); $db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`');
$log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'"); $log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'");
foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) { foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\''); $db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\'');
$db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')'); $db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
$log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'");
@@ -172,21 +188,24 @@ if ($page == 'overview') {
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session
// Statement modified for Database description -- PH 2004-11-29 // End root-session
// Statement modifyed for Database description -- PH 2004-11-29
$databasedescription = validate($_POST['description'], 'description');
$result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")'); $result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")');
$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
if ($sendinfomail == 1) { if($sendinfomail == 1)
{
$pma = $lng['admin']['notgiven']; $pma = $lng['admin']['notgiven'];
if ($settings['panel']['phpmyadmin_url'] != '') { if($settings['panel']['phpmyadmin_url'] != '')
{
$pma = $settings['panel']['phpmyadmin_url']; $pma = $settings['panel']['phpmyadmin_url'];
} }
$replace_arr = array( $replace_arr = array(
'SALUTATION' => getCorrectUserSalutation($userinfo), 'CUST_NAME' => getCorrectUserSalutation($userinfo),
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
'DB_NAME' => $username, 'DB_NAME' => $username,
'DB_PASS' => $password, 'DB_PASS' => $password,
'DB_DESC' => $databasedescription, 'DB_DESC' => $databasedescription,
@@ -225,68 +244,73 @@ if ($page == 'overview') {
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} }
} else { }
else
{
$mysql_servers = ''; $mysql_servers = '';
foreach ($sql_root as $mysql_server => $mysql_server_details) { foreach($sql_root as $mysql_server => $mysql_server_details)
{
$mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server); $mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server);
} }
//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0'); $sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
$mysql_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_add.php'; eval("echo \"" . getTemplate("mysql/mysqls_add") . "\";");
$mysql_add_form = htmlform::genHTMLForm($mysql_add_data);
$title = $mysql_add_data['mysql_add']['title'];
$image = $mysql_add_data['mysql_add']['image'];
eval("echo \"" . getTemplate('mysql/mysqls_add') . "\";");
} }
} }
} elseif ($action == 'edit' && $id != 0) { }
elseif($action == 'edit'
&& $id != 0)
{
$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"'); $result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"');
if (isset($result['databasename']) if(isset($result['databasename'])
&& $result['databasename'] != '' && $result['databasename'] != '')
) { {
if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) { if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
{
$result['dbserver'] = 0; $result['dbserver'] = 0;
} }
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
// Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29 // Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29
$password = validate($_POST['mysql_password'], 'password'); $password = validate($_POST['mysql_password'], 'password');
if ($password != '') {
if($password != '')
{
// validate password // validate password
$password = validatePassword($password); $password = validatePassword($password);
// Begin root-session // Begin root-session
$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], ''); $db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) { unset($db_root->password);
foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
{
$db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')'); $db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
} }
$db_root->query('FLUSH PRIVILEGES'); $db_root->query('FLUSH PRIVILEGES');
$db_root->close(); $db_root->close();
// End root-session // End root-session
} }
// Update the Database description -- PH 2004-11-29 // Update the Database description -- PH 2004-11-29
$log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'");
$databasedescription = validate($_POST['description'], 'description'); $databasedescription = validate($_POST['description'], 'description');
$result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"'); $result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
redirectTo($filename, Array('page' => $page, 's' => $s)); redirectTo($filename, Array('page' => $page, 's' => $s));
} else { }
$mysql_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_edit.php'; else
$mysql_edit_form = htmlform::genHTMLForm($mysql_edit_data); {
eval("echo \"" . getTemplate("mysql/mysqls_edit") . "\";");
$title = $mysql_edit_data['mysql_edit']['title'];
$image = $mysql_edit_data['mysql_edit']['image'];
eval("echo \"" . getTemplate('mysql/mysqls_edit') . "\";");
} }
} }
} }
} }
?>

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -28,17 +28,6 @@ require ("./lib/init.php");
if(isset($_POST['id'])) if(isset($_POST['id']))
{ {
$id = intval($_POST['id']); $id = intval($_POST['id']);
/*
* Check if the current user is allowed to see the current ticket.
*/
$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `customerid` = '".$userinfo['customerid']."'";
$result = $db->query_first($sql);
if ($result == null) {
// no rights to see the requested ticket
standard_error(array('ticketnotaccessible'));
}
} }
elseif(isset($_GET['id'])) elseif(isset($_GET['id']))
{ {
@@ -48,7 +37,7 @@ elseif(isset($_GET['id']))
if($page == 'overview') if($page == 'overview')
{ {
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets"); $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets");
eval("echo \"" . getTemplate("tickets/ticket") . "\";"); eval("echo \"" . getTemplate("ticket/ticket") . "\";");
} }
elseif($page == 'tickets') elseif($page == 'tickets')
{ {
@@ -66,7 +55,7 @@ elseif($page == 'tickets')
$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
$paging->sortfield = 'lastchange'; $paging->sortfield = 'lastchange';
$paging->sortorder = 'desc'; $paging->sortorder = 'desc';
$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" AND `adminid`="' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
$paging->setEntries($db->num_rows($result)); $paging->setEntries($db->num_rows($result));
$sortcode = $paging->getHtmlSortCode($lng); $sortcode = $paging->getHtmlSortCode($lng);
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -115,7 +104,7 @@ elseif($page == 'tickets')
$row['subject'] = substr($row['subject'], 0, 17) . '...'; $row['subject'] = substr($row['subject'], 0, 17) . '...';
} }
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";"); eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
$count++; $count++;
} }
@@ -168,7 +157,7 @@ elseif($page == 'tickets')
} }
$ticketsopen = (int)$opentickets['count']; $ticketsopen = (int)$opentickets['count'];
eval("echo \"" . getTemplate("tickets/tickets") . "\";"); eval("echo \"" . getTemplate("ticket/tickets") . "\";");
} }
elseif($action == 'new') elseif($action == 'new')
{ {
@@ -221,12 +210,12 @@ elseif($page == 'tickets')
else else
{ {
$categories = ''; $categories = '';
$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC'); $result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
if(isset($result['name']) if(isset($result['name'])
&& $result['name'] != '') && $result['name'] != '')
{ {
$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC'); $result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
while($row = $db->fetch_array($result2)) while($row = $db->fetch_array($result2))
{ {
@@ -238,9 +227,9 @@ elseif($page == 'tickets')
$categories = makeoption($lng['ticket']['no_cat'], '0'); $categories = makeoption($lng['ticket']['no_cat'], '0');
} }
$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']); $priorities = makeoption($lng['ticket']['unf_high'], '1', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_normal'], '2', $settings['ticket']['default_priority']);
$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']); $priorities.= makeoption($lng['ticket']['unf_low'], '3', $settings['ticket']['default_priority']);
$ticketsopen = 0; $ticketsopen = 0;
$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '` $opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
WHERE `customerid` = "' . $userinfo['customerid'] . '" WHERE `customerid` = "' . $userinfo['customerid'] . '"
@@ -258,14 +247,7 @@ elseif($page == 'tickets')
} }
$ticketsopen = (int)$opentickets['count']; $ticketsopen = (int)$opentickets['count'];
eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
$ticket_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_add.php';
$ticket_add_form = htmlform::genHTMLForm($ticket_add_data);
$title = $ticket_add_data['ticket_add']['title'];
$image = $ticket_add_data['ticket_add']['image'];
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
} }
} }
else else
@@ -340,18 +322,12 @@ elseif($page == 'tickets')
} }
else else
{ {
$cid = $mainticket->Get('customer'); $by = $lng['ticket']['customer'];
$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
FROM `' . TABLE_PANEL_CUSTOMERS . '`
WHERE `customerid` = "' . (int)$cid . '"'
);
$by = getCorrectFullUserDetails($usr);
//$by = $lng['ticket']['customer'];
} }
$subject = $mainticket->Get('subject'); $subject = $mainticket->Get('subject');
$message = $mainticket->Get('message'); $message = $mainticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` $result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
WHERE `id`="' . (int)$mainticket->Get('category') . '"'); WHERE `id`="' . (int)$mainticket->Get('category') . '"');
$row = $db->fetch_array($result); $row = $db->fetch_array($result);
@@ -368,13 +344,12 @@ elseif($page == 'tickets')
} }
else else
{ {
$by = getCorrectFullUserDetails($usr); $by = $lng['ticket']['customer'];
//$by = $lng['ticket']['customer'];
} }
$subject = $subticket->Get('subject'); $subject = $subticket->Get('subject');
$message = $subticket->Get('message'); $message = $subticket->Get('message');
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";"); eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
} }
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true); $priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -385,13 +360,7 @@ elseif($page == 'tickets')
// don't forget the main-ticket! // don't forget the main-ticket!
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_reply.php'; eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
$title = $ticket_reply_data['ticket_reply']['title'];
$image = $ticket_reply_data['ticket_reply']['image'];
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
} }
} }
elseif($action == 'close' elseif($action == 'close'

View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'customer'); define('AREA', 'customer');
@@ -22,20 +22,21 @@ define('AREA', 'customer');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
$intrafficpage = 1;
require('./lib/init.php'); require ("./lib/init.php");
$traffic = ''; $traffic = '';
$month = null; $month = null;
$year = null; $year = null;
if (isset($_POST['month']) if(isset($_POST['month'])
&& isset($_POST['year']) && isset($_POST['year']))
) { {
$month = intval($_POST['month']); $month = intval($_POST['month']);
$year = intval($_POST['year']); $year = intval($_POST['year']);
} elseif (isset($_GET['month']) }
&& isset($_GET['year']) elseif(isset($_GET['month'])
) { && isset($_GET['year']))
{
$month = intval($_GET['month']); $month = intval($_GET['month']);
$year = intval($_GET['year']); $year = intval($_GET['year']);
} }
@@ -43,25 +44,40 @@ if (isset($_POST['month'])
//BAM! $_GET??? //BAM! $_GET???
elseif (isset($_GET['page']) elseif (isset($_GET['page'])
&& $_GET['page'] == 'current' && $_GET['page'] == "current")
) { {
if (date('d') != '01') { if(date('d') != '01')
{
$month = date('m'); $month = date('m');
$year = date('Y'); $year = date('Y');
} else { }
if (date('m') == '01') { else
{
if(date('m') == '01')
{
$month = 12; $month = 12;
$year = date('Y') - 1; $year = date('Y') - 1;
} else { }
else
{
$month = date('m') - 1; $month = date('m') - 1;
$year = date('Y'); $year = date('Y');
} }
} }
} }
if (!is_null($month) if(!is_null($month)
&& !is_null($year)) { && !is_null($year))
{
$traf['byte'] = 0; $traf['byte'] = 0;
$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid`='" . $userinfo['customerid'] . "'
AND `month` = '" . $month . "'
AND `year` = '" . $year . "'");
$row = mysql_fetch_row($result);
rsort($row);
$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));;
$result = $db->query("SELECT $result = $db->query("SELECT
SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail', SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail',
`day`, `month`, `year` `day`, `month`, `year`
@@ -74,50 +90,106 @@ if (!is_null($month)
$traffic_complete['mail'] = 0; $traffic_complete['mail'] = 0;
$show = ''; $show = '';
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$http = $row['http']; $http = $row['http'];
$ftp = $row['ftp_up'] + $row['ftp_down']; $ftp = $row['ftp_up'] + $row['ftp_down'];
$mail = $row['mail']; $mail = $row['mail'];
$traf['byte'] = $http + $ftp + $mail; $traf['byte'] = $http + $ftp + $mail;
$traffic_complete['http'] += $http; $traffic_complete['http']+= $http;
$traffic_complete['ftp'] += $ftp; $traffic_complete['ftp']+= $ftp;
$traffic_complete['mail'] += $mail; $traffic_complete['mail']+= $mail;
$traf['day'] = $row['day'] . '.'; $traf['day'] = $row['day'];
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['ftp'] = bcdiv($ftp, 1024, $settings['panel']['decimal_places']); }
$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']); else
$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']); {
$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
} else {
$traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['http'] = round($http, $settings['panel']['decimal_places']); }
$traf['ftp'] = round($ftp, $settings['panel']['decimal_places']);
$traf['mail'] = round($mail, $settings['panel']['decimal_places']); if($traf['byte'] != 0
&& $traf['max'] != 0)
{
$proz = $traf['max'] / 100;
$traf['http'] = round($http / $proz, 0);
$traf['ftp'] = round($ftp / $proz, 0);
$traf['mail'] = round($mail / $proz, 0);
if($traf['http'] == 0)
{
$traf['http'] = 1;
}
if($traf['ftp'] == 0)
{
$traf['ftp'] = 1;
}
if($traf['mail'] == 0)
{
$traf['mail'] = 1;
}
}
else
{
$traf['http'] = 0;
$traf['ftp'] = 0;
$traf['mail'] = 0;
}
if(extension_loaded('bcmath'))
{
$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
}
else
{
$traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']); $traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']);
} }
eval("\$traffic.=\"" . getTemplate('traffic/traffic_month') . "\";"); eval("\$traffic.=\"" . getTemplate("traffic/traffic_month") . "\";");
$show = $lng['traffic']['months'][intval($row['month'])] . ' ' . $row['year']; $show = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
} }
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']);
} else { }
else
{
$traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']);
} }
eval("echo \"" . getTemplate('traffic/traffic_details') . "\";"); eval("echo \"" . getTemplate("traffic/traffic_details") . "\";");
} else { }
else
{
$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE `customerid`='" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
$nums = mysql_num_rows($result);
if($nums > 0)
{
$row = mysql_fetch_row($result);
rsort($row);
$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));
} else {
// no records yet
$traf['max'] = 0;
}
$result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail $result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail
FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "' FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "'
GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12"); GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
@@ -125,49 +197,88 @@ if (!is_null($month)
$traffic_complete['ftp'] = 0; $traffic_complete['ftp'] = 0;
$traffic_complete['mail'] = 0; $traffic_complete['mail'] = 0;
while ($row = $db->fetch_array($result)) { while($row = $db->fetch_array($result))
{
$http = $row['http']; $http = $row['http'];
$ftp_up = $row['ftp_up']; $ftp_up = $row['ftp_up'];
$ftp_down = $row['ftp_down']; $ftp_down = $row['ftp_down'];
$mail = $row['mail']; $mail = $row['mail'];
$traffic_complete['http'] += $http; $traffic_complete['http']+= $http;
$traffic_complete['ftp'] += $ftp_up + $ftp_down; $traffic_complete['ftp']+= $ftp_up + $ftp_down;
$traffic_complete['mail'] += $mail; $traffic_complete['mail']+= $mail;
$traf['month'] = $row['month']; $traf['month'] = $row['month'];
$traf['year'] = $row['year']; $traf['year'] = $row['year'];
$traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year']; $traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
$traf['byte'] = $http + $ftp_up + $ftp_down + $mail; $traf['byte'] = $http + $ftp_up + $ftp_down + $mail;
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
$traf['ftptext'] = bcdiv($ftp_up, 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($ftp_down, 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; {
$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['ftptext'] = bcdiv($ftp_up, 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . bcdiv($ftp_down, 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)"; $traf['httptext'] = bcdiv($http, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
$traf['ftp'] = bcdiv(($ftp_up + $ftp_down), 1024, $settings['panel']['decimal_places']); $traf['mailtext'] = bcdiv($mail, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']); }
$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']); else
$traf['byte'] = bcdiv($traf['byte'], 1024 * 1024, $settings['panel']['decimal_places']); {
} else { $traf['ftptext'] = round($ftp_up / 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . round($ftp_down / 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
$traf['ftptext'] = round($ftp_up / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($ftp_down / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)"; $traf['httptext'] = round($http / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)"; $traf['mailtext'] = round($mail / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
$traf['ftp'] = round(($ftp_up + $ftp_down) / 1024, $settings['panel']['decimal_places']);
$traf['http'] = round($http / 1024, $settings['panel']['decimal_places']);
$traf['mail'] = round($mail / 1024, $settings['panel']['decimal_places']);
$traf['byte'] = round($traf['byte'] / (1024 * 1024), $settings['panel']['decimal_places']);
} }
eval("\$traffic.=\"" . getTemplate('traffic/traffic_traffic') . "\";"); if($traf['max'] != 0)
{
$proz = $traf['max'] / 100;
$traf['ftp'] = round(($ftp_up + $ftp_down) / $proz, 0);
$traf['http'] = round($http / $proz, 0);
$traf['mail'] = round($mail / $proz, 0);
if($traf['http'] == 0)
{
$traf['http'] = 1;
}
if($traf['ftp'] == 0)
{
$traf['ftp'] = 1;
}
if($traf['mail'] == 0)
{
$traf['mail'] = 1;
}
}
else
{
$traf['ftp'] = 0;
$traf['http'] = 0;
$traf['mail'] = 0;
}
if(extension_loaded('bcmath'))
{
$traf['byte'] = bcadd($traf['byte'] / (1024 * 1024), 0.0000, 4);
}
else
{
$traf['byte'] = round($traf['byte'] + (1024 * 1024), 4);
}
eval("\$traffic.=\"" . getTemplate("traffic/traffic_traffic") . "\";");
} }
if (extension_loaded('bcmath')) { if(extension_loaded('bcmath'))
{
$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']); $traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']);
} else { }
$traffic_complete['http'] = round($traffic_complete['http'] / (1024 * 1024), $settings['panel']['decimal_places']); else
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / (1024 * 1024), $settings['panel']['decimal_places']); {
$traffic_complete['mail'] = round($traffic_complete['mail'] / (1024 * 1024), $settings['panel']['decimal_places']); $traffic_complete['http'] = round($traffic_complete['http'] / 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024 * 1024, $settings['panel']['decimal_places']);
$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024 * 1024, $settings['panel']['decimal_places']);
} }
eval("echo \"" . getTemplate('traffic/traffic') . "\";"); eval("echo \"" . getTemplate("traffic/traffic") . "\";");
} }
?>

BIN
images/ball.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 51 B

BIN
images/changelanguage.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.8 KiB

BIN
images/default.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.6 KiB

BIN
images/endsection.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.3 KiB

BIN
images/error.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.3 KiB

BIN
images/error.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.7 KiB

BIN
images/footer.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 21 KiB

BIN
images/header.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 16 KiB

BIN
images/header_r.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 1.2 KiB

BIN
images/info.png Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 2.9 KiB

BIN
images/login.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 2.0 KiB

BIN
images/logininternal.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.8 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 3.6 KiB

After

Width:  |  Height:  |  Size: 4.4 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.1 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 3.3 KiB

After

Width:  |  Height:  |  Size: 4.0 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 4.5 KiB

After

Width:  |  Height:  |  Size: 4.5 KiB

BIN
images/order_asc.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 62 B

BIN
images/order_desc.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 60 B

BIN
images/section.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 4.3 KiB

BIN
images/shadow.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 86 B

BIN
images/subsection.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 3.6 KiB

BIN
images/title.gif Normal file

Binary file not shown.

After

Width:  |  Height:  |  Size: 69 B

View File

Before

Width:  |  Height:  |  Size: 66 B

After

Width:  |  Height:  |  Size: 66 B

View File

Before

Width:  |  Height:  |  Size: 82 B

After

Width:  |  Height:  |  Size: 82 B

View File

Before

Width:  |  Height:  |  Size: 105 B

After

Width:  |  Height:  |  Size: 105 B

View File

Before

Width:  |  Height:  |  Size: 827 B

After

Width:  |  Height:  |  Size: 827 B

279
index.php
View File

@@ -14,7 +14,7 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Panel * @package Panel
* * @version $Id$
*/ */
define('AREA', 'login'); define('AREA', 'login');
@@ -22,74 +22,106 @@ define('AREA', 'login');
/** /**
* Include our init.php, which manages Sessions, Language etc. * Include our init.php, which manages Sessions, Language etc.
*/ */
require ('./lib/init.php');
if ($action == '') { require ("./lib/init.php");
if($action == '')
{
$action = 'login'; $action = 'login';
} }
if ($action == 'login') { if($action == 'login')
if (isset($_POST['send']) {
&& $_POST['send'] == 'send' if(isset($_POST['send'])
) { && $_POST['send'] == 'send')
{
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$password = validate($_POST['password'], 'password'); $password = validate($_POST['password'], 'password');
$row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($row['customer'] == $loginname) { if($row['customer'] == $loginname)
{
$table = "`" . TABLE_PANEL_CUSTOMERS . "`"; $table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid'; $uid = 'customerid';
$adminsession = '0'; $adminsession = '0';
$is_admin = false; $is_admin = false;
} else { }
$is_admin = true; else
if ((int)$settings['login']['domain_login'] == 1) { {
if((int)$settings['login']['domain_login'] == 1)
{
/** /**
* check if the customer tries to login with a domain, #374 * check if the customer tries to login with a domain, #374
*/ */
$domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname)); $domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname));
$row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'"); $row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'");
if (isset($row2['customerid']) && $row2['customerid'] > 0) { if(isset($row2['customerid']) && $row2['customerid'] > 0)
{
$loginname = getCustomerDetail($row2['customerid'], 'loginname'); $loginname = getCustomerDetail($row2['customerid'], 'loginname');
if ($loginname !== false) {
if($loginname !== false)
{
$row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($row3['customer'] == $loginname) {
if($row3['customer'] == $loginname)
{
$table = "`" . TABLE_PANEL_CUSTOMERS . "`"; $table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid'; $uid = 'customerid';
$adminsession = '0'; $adminsession = '0';
$is_admin = false; $is_admin = false;
} }
} }
else
{
$is_admin = true;
}
} }
else
{
$is_admin = true;
}
}
else
{
$is_admin = true;
} }
} }
if (hasUpdates($version) && $is_admin == false) { if(hasUpdates($version) && $is_admin == false)
{
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
if ($is_admin) { if($is_admin)
if (hasUpdates($version)) { {
if(hasUpdates($version))
{
$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'"); $row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'");
/* /*
* not an admin who can see updates * not an admin who can see updates
*/ */
if (!isset($row['admin'])) { if(!isset($row['admin']))
{
redirectTo('index.php'); redirectTo('index.php');
exit; exit;
} }
} else { }
else
{
$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'"); $row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
} }
if ($row['admin'] == $loginname) { if($row['admin'] == $loginname)
{
$table = "`" . TABLE_PANEL_ADMINS . "`"; $table = "`" . TABLE_PANEL_ADMINS . "`";
$uid = 'adminid'; $uid = 'adminid';
$adminsession = '1'; $adminsession = '1';
} else { }
else
{
redirectTo('index.php', Array('showmessage' => '2'), true); redirectTo('index.php', Array('showmessage' => '2'), true);
exit; exit;
} }
@@ -97,174 +129,191 @@ if ($action == 'login') {
$userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'"); $userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'");
if ($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts'] if($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']) && $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']))
) { {
redirectTo('index.php', Array('showmessage' => '3'), true); redirectTo('index.php', Array('showmessage' => '3'), true);
exit; exit;
} elseif($userinfo['password'] == md5($password)) { }
elseif($userinfo['password'] == md5($password))
{
// login correct // login correct
// reset loginfail_counter, set lastlogin_succ // reset loginfail_counter, set lastlogin_succ
$db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'"); $db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
$userinfo['userid'] = $userinfo[$uid]; $userinfo['userid'] = $userinfo[$uid];
$userinfo['adminsession'] = $adminsession; $userinfo['adminsession'] = $adminsession;
} else { }
else
{
// login incorrect // login incorrect
$db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'"); $db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
unset($userinfo); unset($userinfo);
redirectTo('index.php', Array('showmessage' => '2'), true); redirectTo('index.php', Array('showmessage' => '2'), true);
exit; exit;
} }
if (isset($userinfo['userid']) if(isset($userinfo['userid'])
&& $userinfo['userid'] != '' && $userinfo['userid'] != '')
) { {
$s = md5(uniqid(microtime(), 1)); $s = md5(uniqid(microtime(), 1));
if (isset($_POST['language'])) { if(isset($_POST['language']))
{
$language = validate($_POST['language'], 'language'); $language = validate($_POST['language'], 'language');
if ($language == 'profile') {
if($language == 'profile')
{
$language = $userinfo['def_language']; $language = $userinfo['def_language'];
} elseif(!isset($languages[$language])) { }
elseif(!isset($languages[$language]))
{
$language = $settings['panel']['standardlanguage']; $language = $settings['panel']['standardlanguage'];
} }
} else { }
else
{
$language = $settings['panel']['standardlanguage']; $language = $settings['panel']['standardlanguage'];
} }
if (isset($userinfo['theme']) && $userinfo['theme'] != '') { if($settings['session']['allow_multiple_login'] != '1')
$theme = $userinfo['theme']; {
} else {
$theme = $settings['panel']['default_theme'];
}
if ($settings['session']['allow_multiple_login'] != '1') {
$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'"); $db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'");
} }
// check for field 'theme' in session-table, refs #607 $db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
$fields = mysql_list_fields($db->getDbName(), TABLE_PANEL_SESSIONS);
$columns = mysql_num_fields($fields);
$field_array = array();
for ($i = 0; $i < $columns; $i++) {
$field_array[] = mysql_field_name($fields, $i);
}
if (!in_array('theme', $field_array)) { if($userinfo['adminsession'] == '1')
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')"); {
} else { if(hasUpdates($version))
$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "', '" . $db->escape($theme) . "')"); {
}
if ($userinfo['adminsession'] == '1') {
if (hasUpdates($version)) {
redirectTo('admin_updates.php', Array('s' => $s), true); redirectTo('admin_updates.php', Array('s' => $s), true);
} else { exit;
redirectTo('admin_index.php', Array('s' => $s), true); }
else
{
redirectTo('admin_index.php', Array('s' => $s), true);
exit;
} }
} else {
redirectTo('customer_index.php', Array('s' => $s), true);
} }
} else { else
redirectTo('index.php', Array('showmessage' => '2'), true); {
redirectTo('customer_index.php', Array('s' => $s), true);
exit;
}
} }
exit; else
} else { {
redirectTo('index.php', Array('showmessage' => '2'), true);
exit;
}
}
else
{
$language_options = ''; $language_options = '';
$language_options .= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true); $language_options.= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
while (list($language_file, $language_name) = each($languages)) { while(list($language_file, $language_name) = each($languages))
$language_options .= makeoption($language_name, $language_file, 'profile', true); {
$language_options.= makeoption($language_name, $language_file, 'profile', true);
} }
$smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0; $smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0;
$message = ''; $message = '';
$successmessage = '';
switch ($smessage) { switch($smessage)
{
case 1: case 1:
$successmessage = $lng['pwdreminder']['success']; $message = $lng['pwdreminder']['success'];
break; break;
case 2: case 2:
$message = $lng['error']['login']; $message = $lng['error']['login'];
break; break;
case 3: case 3:
$message = sprintf($lng['error']['login_blocked'],$settings['login']['deactivatetime']); $message = $lng['error']['login_blocked'];
break; break;
case 4: case 4:
$cmail = isset($_GET['customermail']) ? $_GET['customermail'] : 'unknown'; $message = $lng['error']['errorsendingmail'];
$message = str_replace('%s', $cmail, $lng['error']['errorsendingmail']);
break;
case 5:
$message = $lng['error']['user_banned'];
break; break;
} }
$update_in_progress = ''; $update_in_progress = '';
if (hasUpdates($version)) { if(hasUpdates($version))
{
$update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin']; $update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin'];
} }
eval("echo \"" . getTemplate('login') . "\";"); eval("echo \"" . getTemplate("login") . "\";");
} }
} }
if ($action == 'forgotpwd') { if($action == 'forgotpwd')
{
$adminchecked = false; $adminchecked = false;
$message = ''; $message = '';
if (isset($_POST['send']) if(isset($_POST['send'])
&& $_POST['send'] == 'send' && $_POST['send'] == 'send')
) { {
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$email = validateEmail($_POST['loginemail'], 'email'); $email = validateEmail($_POST['loginemail'], 'email');
$sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_CUSTOMERS . "` $sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_CUSTOMERS . "`
WHERE `loginname`='" . $db->escape($loginname) . "' WHERE `loginname`='" . $db->escape($loginname) . "'
AND `email`='" . $db->escape($email) . "'"; AND `email`='" . $db->escape($email) . "'";
$result = $db->query($sql); $result = $db->query($sql);
if ($db->num_rows() == 0) { if($db->num_rows() == 0)
{
$sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "` $sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "`
WHERE `loginname`='" . $db->escape($loginname) . "' WHERE `loginname`='" . $db->escape($loginname) . "'
AND `email`='" . $db->escape($email) . "'"; AND `email`='" . $db->escape($email) . "'";
$result = $db->query($sql); $result = $db->query($sql);
if ($db->num_rows() > 0) { if($db->num_rows() > 0)
{
$adminchecked = true; $adminchecked = true;
} else { }
else
{
$result = null; $result = null;
} }
} }
if ($result !== null) { if($result !== null)
{
$user = $db->fetch_array($result); $user = $db->fetch_array($result);
/* Check whether user is banned */ if(($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
if ($user['deactivated']) { || $adminchecked == false)
$message = $lng['pwdreminder']['notallowed']; {
redirectTo('index.php', Array('showmessage' => '5'), true); if($user !== false)
} {
if (($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
|| $adminchecked == false
) {
if ($user !== false) {
if ($settings['panel']['password_min_length'] <= 6) { if ($settings['panel']['password_min_length'] <= 6) {
$password = substr(md5(uniqid(microtime(), 1)), 12, 6); $password = substr(md5(uniqid(microtime(), 1)), 12, 6);
} else { } else {
// make it two times larger than password_min_length // make it two times larger than password_min_length
$rnd = ''; $rnd = '';
$minlength = $settings['panel']['password_min_length']; $minlength = $settings['panel']['password_min_length'];
while (strlen($rnd) < ($minlength * 2)) { while (strlen($rnd) < ($minlength * 2))
{
$rnd .= md5(uniqid(microtime(), 1)); $rnd .= md5(uniqid(microtime(), 1));
} }
$password = substr($rnd, (int)($minlength / 2), $minlength); $password = substr($rnd, (int)($minlength / 2), $minlength);
} }
$passwordTable = $adminchecked ? TABLE_PANEL_ADMINS : TABLE_PANEL_CUSTOMERS; if($adminchecked)
$db->query("UPDATE `" . $passwordTable . "` SET `password`='" . md5($password) . "' {
WHERE `loginname`='" . $user['loginname'] . "' $db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `password`='" . md5($password) . "'
AND `email`='" . $user['email'] . "'"); WHERE `loginname`='" . $user['loginname'] . "'
AND `email`='" . $user['email'] . "'");
}
else
{
$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($password) . "'
WHERE `loginname`='" . $user['loginname'] . "'
AND `email`='" . $user['email'] . "'");
}
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings); $rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!"); $rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
@@ -301,36 +350,44 @@ if ($action == 'forgotpwd') {
if ($_mailerror) { if ($_mailerror) {
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings); $rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg); $rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
redirectTo('index.php', Array('showmessage' => '4', 'customermail' => $user['email']), true); redirectTo('index.php', Array('showmessage' => '4'), true);
exit; exit;
} }
$mail->ClearAddresses(); $mail->ClearAddresses();
redirectTo('index.php', Array('showmessage' => '1'), true); redirectTo('index.php', Array('showmessage' => '1'), true);
exit; exit;
} else { }
else
{
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings); $rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!"); $rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
$message = $lng['login']['combination_not_found']; $message = $lng['login']['usernotfound'];
} }
unset($user); unset($user);
} }
} else {
$message = $lng['login']['usernotfound'];
} }
} }
if ($adminchecked) {
if ($settings['panel']['allow_preset_admin'] != '1') { if($adminchecked)
{
if($settings['panel']['allow_preset_admin'] != '1')
{
$message = $lng['pwdreminder']['notallowed']; $message = $lng['pwdreminder']['notallowed'];
unset ($adminchecked); unset ($adminchecked);
} }
} else { }
if ($settings['panel']['allow_preset'] != '1') { else
{
if($settings['panel']['allow_preset'] != '1')
{
$message = $lng['pwdreminder']['notallowed']; $message = $lng['pwdreminder']['notallowed'];
} }
} }
eval("echo \"" . getTemplate('fpwd') . "\";"); eval("echo \"" . getTemplate("fpwd") . "\";");
} }
?>

File diff suppressed because it is too large Load Diff

View File

@@ -2,6 +2,7 @@
/** /**
* This file is part of the Froxlor project. * This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors). * Copyright (c) 2010 the Froxlor Team (see authors).
* *
* For the full copyright and license information, please view the COPYING * For the full copyright and license information, please view the COPYING
@@ -9,14 +10,952 @@
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
* *
* @copyright (c) the authors * @copyright (c) the authors
* @author Michael Kaufmann <mkaufmann@nutime.de> * @author Florian Lippert <flo@syscp.org> (2003-2009)
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install * @package Install
* * @version $Id$
*/ */
require 'lib/class.FroxlorInstall.php'; /**
* Most elements are taken from the phpBB (www.phpbb.com)
* installer, (c) 1999 - 2004 phpBB Group.
*/
$frxinstall = new FroxlorInstall(); // ensure that default timezone is set
$frxinstall->run(); if(function_exists("date_default_timezone_set") && function_exists("date_default_timezone_get"))
{
@date_default_timezone_set(@date_default_timezone_get());
}
if(file_exists('../lib/userdata.inc.php'))
{
/**
* Includes the Usersettings eg. MySQL-Username/Passwort etc. to test if Froxlor is already installed
*/
require ('../lib/userdata.inc.php');
if(isset($sql)
&& is_array($sql))
{
die('Sorry, Froxlor is already configured...');
}
}
/**
* Include the functions
*/
require ('../lib/functions.php');
/**
* Include the MySQL-Table-Definitions
*/
require ('../lib/tables.inc.php');
/**
* Language Managament
*/
$languages = Array(
'german' => 'Deutsch',
'english' => 'English',
'french' => 'Francais'
);
$standardlanguage = 'english';
if(isset($_GET['language'])
&& isset($languages[$_GET['language']]))
{
$language = $_GET['language'];
}
elseif(isset($_POST['language'])
&& isset($languages[$_POST['language']]))
{
$language = $_POST['language'];
}
else
{
$language = $standardlanguage;
}
if(file_exists('./lng/' . $language . '.lng.php'))
{
/**
* Includes file /lng/$language.lng.php if it exists
*/
require ('./lng/' . $language . '.lng.php');
}
/**
* BEGIN FUNCTIONS -----------------------------------------------
*/
function page_header()
{
?>
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
<html xmlns="http://www.w3.org/1999/xhtml">
<head>
<meta content="text/html; charset=ISO-8859-1" http-equiv="content-type" />
<link rel="stylesheet" href="../templates/main.css" type="text/css" />
<title>Froxlor</title>
</head>
<body style="margin: 0; padding: 0;" onload="document.loginform.loginname.focus()">
<!--
We request you retain the full copyright notice below including the link to www.froxlor.org.
This not only gives respect to the large amount of time given freely by the developers
but also helps build interest, traffic and use of Froxlor. If you refuse
to include even this then support on our forums may be affected.
The Froxlor Team : 2009-2010
// -->
<!--
Templates based on work by Luca Piona (info@havanastudio.ch) and Luca Longinotti (chtekk@gentoo.org)
// -->
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td width="800"><img src="../images/header.gif" width="800" height="90" alt="" /></td>
<td class="header">&nbsp;</td>
</tr>
</table>
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td valign="top" bgcolor="#FFFFFF">
<br />
<br />
<?php
}
function page_footer()
{
?>
</td>
</tr>
</table>
<table cellspacing="0" cellpadding="0" border="0" width="100%">
<tr>
<td width="100%" class="footer">
<br />Froxlor &copy; 2009-2010 by <a href="http://www.froxlor.org/" target="_blank">the Froxlor Team</a>
<br /><br/>
</td>
</tr>
</table>
</body>
</html>
<?php
}
function status_message($case, $text)
{
if($case == 'begin')
{
echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\">$text";
}
else
{
echo " <span style=\"color:$case;\">$text</span></td>\n\t\t</tr>\n";
}
}
function requirement_checks()
{
global $lng;
page_header();
?>
<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
<tr>
<td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
</tr>
<?php
$_die = false;
// check for correct php version
status_message('begin', $lng['install']['phpversion']);
if(version_compare("5.2.0", PHP_VERSION, ">="))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
// Check if magic_quotes_runtime is active
status_message('begin', $lng['install']['phpmagic_quotes_runtime']);
if(get_magic_quotes_runtime())
{
// Deactivate
set_magic_quotes_runtime(false);
status_message('orange', $lng['install']['active'] . '<br />' . $lng['install']['phpmagic_quotes_runtime_description']);
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpmysql']);
if(!extension_loaded('mysql'))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpxml']);
if(!extension_loaded('xml'))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpfilter']);
if(!extension_loaded('filter'))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpposix']);
if(!extension_loaded('posix'))
{
status_message('red', $lng['install']['notinstalled']);
$_die = true;
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['phpbcmath']);
if(!extension_loaded('bcmath'))
{
status_message('orange', $lng['install']['notinstalled'] . '<br />' . $lng['install']['bcmathdescription']);
}
else
{
status_message('green', 'OK');
}
status_message('begin', $lng['install']['openbasedir']);
$php_ob = @ini_get("open_basedir");
if(!empty($php_ob)
&& $php_ob != '')
{
status_message('orange', $lng['install']['openbasedirenabled']);
}
else
{
status_message('green', 'OK');
}
if($_die)
{
?>
<tr>
<td class="main_field_display" align="center">
<?php echo $lng['install']['diedbecauseofrequirements']; ?><br />
<a href="install.php"><?php echo $lng['install']['click_here_to_refresh']; ?></a>
</td>
</tr>
<?php
} else {
?>
<tr>
<td class="main_field_display" align="center">
<?php echo $lng['install']['froxlor_succ_checks']; ?><br />
<a href="install.php?check=1"><?php echo $lng['install']['click_here_to_continue']; ?></a>
</td>
</tr>
<?php
}
?>
</table>
<br />
<br />
<?php
page_footer();
}
/**
* END FUNCTIONS ---------------------------------------------------
*/
/**
* BEGIN VARIABLES ---------------------------------------------------
*/
//guess Servername
if(!empty($_POST['servername']))
{
$servername = $_POST['servername'];
}
else
{
if(!empty($_SERVER['SERVER_NAME']))
{
if(preg_match('/^[0-9]{1,3}.[0-9]{1,3}.[0-9]{1,3}.[0-9]{1,3}$/', $_SERVER['SERVER_NAME']) == false)
{
$servername = $_SERVER['SERVER_NAME'];
}
else
{
$servername = '';
}
}
else
{
$servername = '';
}
}
//guess serverip
if(!empty($_POST['serverip']))
{
$serverip = $_POST['serverip'];
}
else
{
if(!empty($_SERVER['SERVER_ADDR']))
{
$serverip = $_SERVER['SERVER_ADDR'];
}
else
{
$serverip = '';
}
}
if(!empty($_POST['mysql_host']))
{
$mysql_host = $_POST['mysql_host'];
}
else
{
$mysql_host = '127.0.0.1';
}
if(!empty($_POST['mysql_database']))
{
$mysql_database = $_POST['mysql_database'];
}
else
{
$mysql_database = 'froxlor';
}
if(!empty($_POST['mysql_unpriv_user']))
{
$mysql_unpriv_user = $_POST['mysql_unpriv_user'];
}
else
{
$mysql_unpriv_user = 'froxlor';
}
if(!empty($_POST['mysql_unpriv_pass']))
{
$mysql_unpriv_pass = $_POST['mysql_unpriv_pass'];
}
else
{
$mysql_unpriv_pass = '';
}
if(!empty($_POST['mysql_root_user']))
{
$mysql_root_user = $_POST['mysql_root_user'];
}
else
{
$mysql_root_user = 'root';
}
if(!empty($_POST['mysql_root_pass']))
{
$mysql_root_pass = $_POST['mysql_root_pass'];
}
else
{
$mysql_root_pass = '';
}
if(!empty($_POST['admin_user']))
{
$admin_user = $_POST['admin_user'];
}
else
{
$admin_user = 'admin';
}
if(!empty($_POST['admin_pass1']))
{
$admin_pass1 = $_POST['admin_pass1'];
}
else
{
$admin_pass1 = '';
}
if(!empty($_POST['admin_pass2']))
{
$admin_pass2 = $_POST['admin_pass2'];
}
else
{
$admin_pass2 = '';
}
if($mysql_host == 'localhost'
|| $mysql_host == '127.0.0.1')
{
$mysql_access_host = $mysql_host;
}
else
{
$mysql_access_host = $serverip;
}
// gues http software
if(!empty($_POST['webserver']))
{
$webserver = $_POST['webserver'];
}
else
{
if(strtoupper(@php_sapi_name()) == "APACHE2HANDLER"
|| stristr($_SERVER['SERVER_SOFTWARE'], "apache/2"))
{
$webserver = 'apache2';
}
elseif(substr(strtoupper(@php_sapi_name()), 0, 8) == "LIGHTTPD"
|| stristr($_SERVER['SERVER_SOFTWARE'], "lighttpd"))
{
$webserver = 'lighttpd';
}
elseif(substr(strtoupper(@php_sapi_name()), 0, 8) == "NGINX"
|| stristr($_SERVER['SERVER_SOFTWARE'], "nginx"))
{
$webserver = 'nginx';
}
else
{
// we don't need to bail out, since unknown does not affect any critical installation routines
$webserver = 'unknown';
}
}
if(!empty($_POST['httpuser']))
{
$httpuser = $_POST['httpuser'];
}
else
{
$httpuser = '';
}
if(!empty($_POST['httpgroup']))
{
$httpgroup = $_POST['httpgroup'];
}
else
{
$httpgroup = '';
}
/**
* END VARIABLES ---------------------------------------------------
*/
/**
* BEGIN INSTALL ---------------------------------------------------
*/
if(isset($_POST['installstep'])
&& $_POST['installstep'] == '1'
&& $admin_pass1 == $admin_pass2
&& $admin_pass1 != ''
&& $admin_pass2 != ''
&& $mysql_unpriv_pass != ''
&& $mysql_root_pass != ''
&& $servername != ''
&& $serverip != ''
&& $httpuser != ''
&& $httpgroup != ''
&& $mysql_unpriv_user != $mysql_root_user)
{
page_header();
?>
<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
<tr>
<td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
</tr>
<?php
//first test if we can access the database server with the given root user and password
status_message('begin', $lng['install']['testing_mysql']);
$db_root = new db($mysql_host, $mysql_root_user, $mysql_root_pass, '');
//ok, if we are here, the database class is build up (otherwise it would have already die'd this script)
status_message('green', 'OK');
//first we make a backup of the old DB if it exists
status_message('begin', $lng['install']['backup_old_db']);
$tables_exist = false;
$sql = "SHOW TABLES FROM $mysql_database";
$result = mysql_query($sql);
// check the first row
if($result !== false)
{
$row = mysql_num_rows($result);
if($row > 0)
{
$tables_exist = true;
}
}
if($tables_exist)
{
$filename = "/tmp/froxlor_backup_" . date('YmdHi') . ".sql";
if(is_file("/usr/bin/mysqldump"))
{
$do_backup = true;
$mysql_dump = '/usr/bin/mysqldump';
}
elseif(is_file("/usr/local/bin/mysqldump"))
{
$do_backup = true;
$mysql_dump = '/usr/local/bin/mysqldump';
}
else
{
$do_backup = false;
status_message('red', $lng['install']['backing_up_binary_missing']);
}
if($do_backup) {
$command = $mysql_dump . " " . $mysql_database . " -u " . $mysql_root_user . " --password='" . $mysql_root_pass . "' --result-file=" . $filename;
$output = exec($command);
if(stristr($output, "error"))
{
status_message('red', $lng['install']['backing_up_failed']);
}
else
{
status_message('green', 'OK');
}
}
}
//so first we have to delete the database and the user given for the unpriv-user if they exit
status_message('begin', $lng['install']['erasing_old_db']);
$db_root->query("DELETE FROM `mysql`.`user` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DELETE FROM `mysql`.`db` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DELETE FROM `mysql`.`tables_priv` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DELETE FROM `mysql`.`columns_priv` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
$db_root->query("DROP DATABASE IF EXISTS `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "` ;");
$db_root->query("FLUSH PRIVILEGES;");
status_message('green', 'OK');
//then we have to create a new user and database for the froxlor unprivileged mysql access
status_message('begin', $lng['install']['create_mysqluser_and_db']);
$db_root->query("CREATE DATABASE `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "`");
$mysql_access_host_array = array_map('trim', explode(',', $mysql_access_host));
if(in_array('127.0.0.1', $mysql_access_host_array)
&& !in_array('localhost', $mysql_access_host_array))
{
$mysql_access_host_array[] = 'localhost';
}
if(!in_array('127.0.0.1', $mysql_access_host_array)
&& in_array('localhost', $mysql_access_host_array))
{
$mysql_access_host_array[] = '127.0.0.1';
}
$mysql_access_host_array[] = $serverip;
foreach($mysql_access_host_array as $mysql_access_host)
{
$db_root->query("GRANT ALL PRIVILEGES ON `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "`.* TO '" . $db_root->escape($mysql_unpriv_user) . "'@'" . $db_root->escape($mysql_access_host) . "' IDENTIFIED BY 'password'");
$db_root->query("SET PASSWORD FOR '" . $db_root->escape($mysql_unpriv_user) . "'@'" . $db_root->escape($mysql_access_host) . "' = PASSWORD('" . $db_root->escape($mysql_unpriv_pass) . "')");
}
$db_root->query("FLUSH PRIVILEGES;");
$mysql_access_host = implode(',', $mysql_access_host_array);
status_message('green', 'OK');
//now a new database and the new froxlor-unprivileged-mysql-account have been created and we can fill it now with the data.
status_message('begin', $lng['install']['testing_new_db']);
$db = new db($mysql_host, $mysql_unpriv_user, $mysql_unpriv_pass, $mysql_database);
status_message('green', 'OK');
status_message('begin', $lng['install']['importing_data']);
$db_schema = './froxlor.sql';
$sql_query = @file_get_contents($db_schema, 'r');
$sql_query = remove_remarks($sql_query);
$sql_query = split_sql_file($sql_query, ';');
for ($i = 0;$i < sizeof($sql_query);$i++)
{
if(trim($sql_query[$i]) != '')
{
$result = $db->query($sql_query[$i]);
}
}
status_message('green', 'OK');
status_message('begin', 'System Servername...');
if(validate_ip($_SERVER['SERVER_NAME'], true) !== false)
{
status_message('red', $lng['install']['servername_should_be_fqdn']);
}
else
{
status_message('green', 'OK');
}
//now let's change the settings in our settings-table
status_message('begin', $lng['install']['changing_data']);
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = 'admin@" . $db->escape($servername) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'adminmail'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($serverip) . "' WHERE `settinggroup` = 'system' AND `varname` = 'ipaddress'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($servername) . "' WHERE `settinggroup` = 'system' AND `varname` = 'hostname'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($version) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'version'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($languages[$language]) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'standardlanguage'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($mysql_access_host) . "' WHERE `settinggroup` = 'system' AND `varname` = 'mysql_access_host'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpuser) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpuser'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpgroup) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'");
if($webserver == "apache2")
{
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/apache2 reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
}
elseif($webserver == "lighttpd")
{
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/conf-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-diroptions/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/lighttpd reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/lighttpd.pem' WHERE `settinggroup` = 'system' AND `varname` = 'ssl_cert_file'");
$ssettings = '';
}
elseif($webserver == "nginx")
{
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/nginx reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
$ssettings = '';
}
// insert the lastcronrun to be the installation date
$query = 'UPDATE `%s` SET `value` = UNIX_TIMESTAMP() WHERE `settinggroup` = \'system\' AND `varname` = \'lastcronrun\'';
$query = sprintf($query, TABLE_PANEL_SETTINGS);
$db->query($query);
// set specific times for some crons (traffic only at night, etc.)
$ts = mktime(0, 0, 0, date('m', time()), date('d', time()), date('Y', time()));
$db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_traffic.php';");
$ts = mktime(1, 0, 0, date('m', time()), date('d', time()), date('Y', time()));
$db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_used_tickets_reset.php';");
$db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_ticketarchive.php';");
// and lets insert the default ip and port
$query = "INSERT INTO `".TABLE_PANEL_IPSANDPORTS."`
SET `ip`= '".$db->escape($serverip)."',
`port` = '80',
`namevirtualhost_statement` = '1',
`vhostcontainer` = '1',
`vhostcontainer_servername_statement` = '1'";
$db->query($query);
$defaultip = $db->insert_id();
// insert the defaultip
$query = 'UPDATE `%s` SET `value` = \'%s\' WHERE `settinggroup` = \'system\' AND `varname` = \'defaultip\'';
$query = sprintf($query, TABLE_PANEL_SETTINGS, $db->escape($defaultip));
$db->query($query);
status_message('green', 'OK');
//last but not least create the main admin
status_message('begin', $lng['install']['adding_admin_user']);
$db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET
`loginname` = '" . $db->escape($admin_user) . "',
`password` = '" . md5($admin_pass1) . "',
`name` = 'Siteadmin',
`email` = 'admin@" . $db->escape($servername) . "',
`def_language` = '". $db->escape($languages[$language]) . "',
`customers` = -1,
`customers_used` = 0,
`customers_see_all` = 1,
`caneditphpsettings` = 1,
`domains` = -1,
`domains_used` = 0,
`domains_see_all` = 1,
`change_serversettings` = 1,
`diskspace` = -1024,
`diskspace_used` = 0,
`mysqls` = -1,
`mysqls_used` = 0,
`emails` = -1,
`emails_used` = 0,
`email_accounts` = -1,
`email_accounts_used` = 0,
`email_forwarders` = -1,
`email_forwarders_used` = 0,
`email_quota` = -1,
`email_quota_used` = 0,
`ftps` = -1,
`ftps_used` = 0,
`tickets` = -1,
`tickets_used` = 0,
`subdomains` = -1,
`subdomains_used` = 0,
`traffic` = -1048576,
`traffic_used` = 0,
`deactivated` = 0,
`aps_packages` = -1,
`aps_packages_used` = 0,
`email_autoresponder` = -1,
`email_autoresponder_used` = 0");
status_message('green', 'OK');
//now we create the userdata.inc.php with the mysql-accounts
status_message('begin', $lng['install']['creating_configfile']);
$userdata = "<?php\n";
$userdata.= "//automatically generated userdata.inc.php for Froxlor\n";
$userdata.= "\$sql['host']='" . addcslashes($mysql_host, "'\\") . "';\n";
$userdata.= "\$sql['user']='" . addcslashes($mysql_unpriv_user, "'\\") . "';\n";
$userdata.= "\$sql['password']='" . addcslashes($mysql_unpriv_pass, "'\\") . "';\n";
$userdata.= "\$sql['db']='" . addcslashes($mysql_database, "'\\") . "';\n";
$userdata.= "\$sql_root[0]['caption']='Default';\n";
$userdata.= "\$sql_root[0]['host']='" . addcslashes($mysql_host, "'\\") . "';\n";
$userdata.= "\$sql_root[0]['user']='" . addcslashes($mysql_root_user, "'\\") . "';\n";
$userdata.= "\$sql_root[0]['password']='" . addcslashes($mysql_root_pass, "'\\") . "';\n";
$userdata.= "?>";
//we test now if we can store the userdata.inc.php in ../lib
if($fp = @fopen('../lib/userdata.inc.php', 'w'))
{
$result = @fputs($fp, $userdata, strlen($userdata));
@fclose($fp);
status_message('green', $lng['install']['creating_configfile_succ']);
chmod('../lib/userdata.inc.php', 0440);
}
elseif($fp = @fopen('/tmp/userdata.inc.php', 'w'))
{
$result = @fputs($fp, $userdata, strlen($userdata));
@fclose($fp);
status_message('orange', $lng['install']['creating_configfile_temp']);
chmod('/tmp/userdata.inc.php', 0440);
}
else
{
status_message('red', $lng['install']['creating_configfile_failed']);
echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\"><p>" . nl2br(htmlspecialchars($userdata)) . "</p></td>\n\t\t</tr>\n";
}
?>
<tr>
<td class="main_field_display" align="center">
<?php echo $lng['install']['froxlor_succ_installed']; ?><br />
<a href="../index.php"><?php echo $lng['install']['click_here_to_login']; ?></a>
</td>
</tr>
</table>
<br />
<br />
<?php
page_footer();
}
else
{
if((isset($_GET['check'])
&& $_GET['check'] == '1')
|| (isset($_POST['installstep'])
&& $_POST['installstep'] == '1')
) {
page_header();
?>
<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="get">
<input type="hidden" name="check" value="1" />
<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['welcome']; ?></b></td>
</tr>
<tr>
<td class="main_field_name" colspan="2"><?php echo $lng['install']['welcometext']; ?></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['language']; ?>: </td>
<td class="main_field_display" nowrap="nowrap">
<select name="language" class="dropdown_noborder"><?php
$language_options = '';
while(list($language_file, $language_name) = each($languages))
{
$language_options.= "\n\t\t\t\t\t\t" . makeoption($language_name, $language_file, $language, true, true);
}
echo $language_options;
?>
</select>
</td>
</tr>
<tr>
<td class="main_field_confirm" colspan="2">
<input class="bottom" type="submit" name="chooselang" value="Go" />
</td>
</tr>
</table>
</form>
<br />
<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="post">
<input type="hidden" name="check" value="1" />
<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['database']; ?></b></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['mysql_hostname']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_host" value="<?php echo htmlspecialchars($mysql_host); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['mysql_database']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_database" value="<?php echo htmlspecialchars($mysql_database); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_user']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_unpriv_user" value="<?php echo htmlspecialchars($mysql_unpriv_user); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_unpriv_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_pass']; ?>:</td>
<td class="main_field_display"><input type="password" name="mysql_unpriv_pass" value="<?php echo htmlspecialchars($mysql_unpriv_pass); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_root_user']; ?>:</td>
<td class="main_field_display"><input type="text" name="mysql_root_user" value="<?php echo htmlspecialchars($mysql_root_user); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_root_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_root_pass']; ?>:</td>
<td class="main_field_display"><input type="password" name="mysql_root_pass" value="<?php echo htmlspecialchars($mysql_root_pass); ?>"/></td>
</tr>
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['admin_account']; ?></b></td>
</tr>
<tr>
<td class="main_field_name"><?php echo $lng['install']['admin_user']; ?>:</td>
<td class="main_field_display"><input type="text" name="admin_user" value="<?php echo htmlspecialchars($admin_user); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass1 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass']; ?>:</td>
<td class="main_field_display"><input type="password" name="admin_pass1" value="<?php echo htmlspecialchars($admin_pass1); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass2 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass_confirm']; ?>:</td>
<td class="main_field_display"><input type="password" name="admin_pass2" value="<?php echo htmlspecialchars($admin_pass2); ?>"/></td>
</tr>
<tr>
<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['serversettings']; ?></b></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $servername == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['servername']; ?>:</td>
<td class="main_field_display"><input type="text" name="servername" value="<?php echo htmlspecialchars($servername); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['serverip']; ?>:</td>
<td class="main_field_display"><input type="text" name="serverip" value="<?php echo htmlspecialchars($serverip); ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?>:</td>
<td class="main_field_display"><input type="radio" name="webserver" value="apache2" <?php echo $webserver == "apache2" ? 'checked="checked"' : "" ?>/>Apache2&nbsp;<br /><input type="radio" name="webserver" value="lighttpd" <?php echo $webserver == "lighttpd" ? 'checked="checked"' : "" ?>/>Lighttpd2&nbsp;<br /><input type="radio" name="webserver" value="nginx" <?php echo $webserver == "nginx" ? 'checked="checked"' : "" ?>/>Nginx</td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpuser']; ?>:</td>
<td class="main_field_display"><input type="text" name="httpuser" value="<?php $posixusername = posix_getpwuid(posix_getuid()); echo $posixusername['name']; ?>"/></td>
</tr>
<tr>
<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpgroup']; ?>:</td>
<td class="main_field_display"><input type="text" name="httpgroup" value="<?php $posixgroup = posix_getgrgid(posix_getgid()); echo $posixgroup['name']; ?>"/></td>
</tr>
<tr>
<td class="main_field_confirm" colspan="2"><input type="hidden" name="language" value="<?php echo htmlspecialchars($language); ?>"/><input type="hidden" name="installstep" value="1"/><input class="bottom" type="submit" name="submitbutton" value="<?php echo $lng['install']['next']; ?>"/></td>
</tr>
</table>
</form>
<br />
<br />
<?php
page_footer();
}
else
{
requirement_checks();
}
}
/**
* END INSTALL ---------------------------------------------------
*/
?>

File diff suppressed because it is too large Load Diff

View File

@@ -14,71 +14,88 @@
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
$lng['requirements']['title'] = 'Checking system requirements...'; /**
$lng['requirements']['installed'] = 'installed'; * Begin
$lng['requirements']['not_true'] = 'no'; */
$lng['requirements']['notfound'] = 'not found';
$lng['requirements']['notinstalled'] = 'not installed';
$lng['requirements']['activated'] = 'enabled';
$lng['requirements']['phpversion'] = 'PHP version >= 5.2';
$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime...';
$lng['requirements']['phpmagic_quotes_runtime_description'] = 'PHP setting "magic_quotes_runtime" must be set to "Off". We have disabled it temporary for now please fix the coresponding php.ini.';
$lng['requirements']['phpmysql'] = 'MySQL-extension...';
$lng['requirements']['phpxml'] = 'PHP XML-extension...';
$lng['requirements']['phpfilter'] = 'PHP filter-extension...';
$lng['requirements']['phpposix'] = 'PHP posix-extension...';
$lng['requirements']['phpbcmath'] = 'PHP bcmath-extension...';
$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
$lng['requirements']['openbasedir'] = 'open_basedir...';
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the coresponding php.ini';
$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';
$lng['requirements']['froxlor_succ_checks'] = 'All requirements are satisfied';
$lng['install']['title'] = 'Froxlor install - chose language'; $lng['install']['language'] = 'Installation - Language';
$lng['install']['language'] = 'Installation language'; $lng['install']['welcome'] = 'Welcome to Froxlor Installation';
$lng['install']['lngbtn_go'] = 'Change language';
$lng['install']['title'] = 'Froxlor install - setup';
$lng['install']['welcometext'] = 'Thank you for choosing Froxlor. Please fill out the following fields with the required information to start the installation.<br /><b>Attention:</b> If the database you chose for Froxlor already exists on your System, it will be erased with all containing data!'; $lng['install']['welcometext'] = 'Thank you for choosing Froxlor. Please fill out the following fields with the required information to start the installation.<br /><b>Attention:</b> If the database you chose for Froxlor already exists on your System, it will be erased with all containing data!';
$lng['install']['database'] = 'Database connection'; $lng['install']['database'] = 'Database';
$lng['install']['mysql_host'] = 'MySQL-Hostname'; $lng['install']['mysql_hostname'] = 'MySQL-Hostname';
$lng['install']['mysql_database'] = 'Database name'; $lng['install']['mysql_database'] = 'MySQL-Database';
$lng['install']['mysql_unpriv_user'] = 'Username for the unprivileged MySQL-account'; $lng['install']['mysql_unpriv_user'] = 'Username for the unprivileged MySQL-account';
$lng['install']['mysql_unpriv_pass'] = 'Password for the unprivileged MySQL-account'; $lng['install']['mysql_unpriv_pass'] = 'Password for the unprivileged MySQL-account';
$lng['install']['mysql_root_user'] = 'Username for the MySQL-root-account'; $lng['install']['mysql_root_user'] = 'Username for the MySQL-root-account';
$lng['install']['mysql_root_pass'] = 'Password for the MySQL-root-account'; $lng['install']['mysql_root_pass'] = 'Password for the MySQL-root-account';
$lng['install']['admin_account'] = 'Administrator Account'; $lng['install']['admin_account'] = 'Administrator Account';
$lng['install']['admin_user'] = 'Administrator Username'; $lng['install']['admin_user'] = 'Administrator Username';
$lng['install']['admin_pass1'] = 'Administrator Password'; $lng['install']['admin_pass'] = 'Administrator Password';
$lng['install']['admin_pass2'] = 'Administrator-Password (confirm)'; $lng['install']['admin_pass_confirm'] = 'Administrator-Password (confirm)';
$lng['install']['serversettings'] = 'Server settings'; $lng['install']['serversettings'] = 'Server settings';
$lng['install']['servername'] = 'Server name (FQDN, no ip-address)'; $lng['install']['servername'] = 'Server name (FQDN)';
$lng['install']['serverip'] = 'Server IP'; $lng['install']['serverip'] = 'Server IP';
$lng['install']['webserver'] = 'Webserver';
$lng['install']['apache2'] = 'Apache 2';
$lng['install']['lighttpd'] = 'LigHTTPd';
$lng['install']['nginx'] = 'NGINX';
$lng['install']['httpuser'] = 'HTTP username'; $lng['install']['httpuser'] = 'HTTP username';
$lng['install']['httpgroup'] = 'HTTP groupname'; $lng['install']['httpgroup'] = 'HTTP groupname';
$lng['install']['apacheversion'] = 'Apacheversion';
$lng['install']['next'] = 'Next';
$lng['install']['testing_mysql'] = 'Checking MySQL-root access...'; /**
$lng['install']['backup_old_db'] = 'Creating backup of old database...'; * Progress
$lng['install']['backup_binary_missing'] = 'Could not find mysqldump'; */
$lng['install']['backup_failed'] = 'Could not backup database';
$lng['install']['prepare_db'] = 'Preparing database...'; $lng['install']['testing_mysql'] = 'Testing if MySQL-root-username and password are correct...';
$lng['install']['create_mysqluser_and_db'] = 'Creating database and username...'; $lng['install']['erasing_old_db'] = 'Erasing old Database...';
$lng['install']['testing_new_db'] = 'Testing if database and user have been created correctly...'; $lng['install']['backup_old_db'] = 'Create backup of the old Database...';
$lng['install']['importing_data'] = 'Importing data...'; $lng['install']['backing_up'] = 'Backing up';
$lng['install']['changing_data'] = 'Adjusting settings...'; $lng['install']['backing_up_binary_missing'] = '/usr/bin/mysqldump is missing';
$lng['install']['creating_entries'] = 'Inserting new values...'; $lng['install']['create_mysqluser_and_db'] = 'Creating MySQL-database and username...';
$lng['install']['adding_admin_user'] = 'Creating admin-account...'; $lng['install']['testing_new_db'] = 'Testing if MySQL-database and username have been created correctly...';
$lng['install']['importing_data'] = 'Importing data into MySQL-database...';
$lng['install']['changing_data'] = 'Changing imported data...';
$lng['install']['adding_admin_user'] = 'Adding Administrator Account...';
$lng['install']['creating_configfile'] = 'Creating configfile...'; $lng['install']['creating_configfile'] = 'Creating configfile...';
$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php was saved in lib/.';
$lng['install']['creating_configfile_temp'] = 'File was saved in /tmp/userdata.inc.php, please move to lib/.'; $lng['install']['creating_configfile_temp'] = 'File was saved in /tmp/userdata.inc.php, please move to lib/.';
$lng['install']['creating_configfile_failed'] = 'Could not create lib/userdata.inc.php, please create it manually with the following content:'; $lng['install']['creating_configfile_failed'] = 'Cannot create lib/userdata.inc.php, please create it manually with the following data:';
$lng['install']['froxlor_succ_installed'] = 'Froxlor was installed successfully.'; $lng['install']['froxlor_succ_installed'] = 'Froxlor was installed successfully.';
$lng['install']['click_here_to_login'] = 'Click here to login.';
$lng['install']['phpmysql'] = 'Testing if PHP MySQL-extension is installed...';
$lng['install']['phpfilter'] = 'Testing if PHP filter-extension is installed...';
$lng['install']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Aborting...';
$lng['install']['notinstalled'] = 'not installed!';
$lng['install']['phpbcmath'] = 'Testing if PHP bcmath-extension is installed...';
$lng['install']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
$lng['install']['openbasedir'] = 'Testing if open_basedir is enabled...';
$lng['install']['openbasedirenabled'] = 'enabled. Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor';
$lng['click_here_to_refresh'] = 'Click here to check again'; /**
$lng['click_here_to_continue'] = 'Click here to continue'; * Renamed in 1.2.19-svn40
$lng['click_here_to_login'] = 'Click here to login.'; */
$lng['install']['webserver'] = 'Webserver';
/*
* Added in Froxlor 0.9
*/
$lng['install']['phpversion'] = 'Checking for PHP version >= 5.2';
$lng['install']['phpposix'] = 'Testing if PHP posix-extension is installed...';
/*
* Added in Froxlor 0.9.4
*/
$lng['install']['click_here_to_refresh'] = 'Re-check';
$lng['install']['click_here_to_continue'] = 'Continue installation';
$lng['install']['froxlor_succ_checks'] = 'All requirements are satisfied';
/*
* Added in Froxlor 0.9.13
*/
$lng['install']['phpmagic_quotes_runtime'] = 'Checking whether magic_quotes_runtime is off';
$lng['install']['active'] = 'no';
$lng['install']['phpmagic_quotes_runtime_description'] = 'PHP setting "magic_quotes_runtime" must be set to "Off" in order to avoid strange behavior of Froxlor. Disabling it for now (this is only temporary, please fix our php.ini).';
$lng['install']['phpxml'] = 'Testing if PHP XML-extension is installed...';
?>

View File

@@ -0,0 +1,72 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Tim Zielosko <mail@zielosko.net>
* @author Romain MARIADASSOU <roms2000@free.fr>
* @author Froxlor Team <team@froxlor.org>
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language
* @version $Id$
*/
/**
* Begin
*/
$lng['install']['language'] = 'Langue d\'installation';
$lng['install']['welcome'] = 'Bienvenue <20> l\'installation de Froxlor';
$lng['install']['welcometext'] = 'Merci beaucoup d\'avoir choisi Froxlor. Pour installer Froxlor remplissez les cases ci-dessous avec les informations demand<6E>es.<br /><b>Attention :</b> Si vous entrez le nom d\'une base de donn<6E>es existante, celle-ci sera effac<61>e !';
$lng['install']['database'] = 'Base de donn<6E>es';
$lng['install']['mysql_hostname'] = 'Nom d\'h<>te du serveur MySQL';
$lng['install']['mysql_database'] = 'Base de donn<6E>es MySQL';
$lng['install']['mysql_unpriv_user'] = 'Utilisateur pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
$lng['install']['mysql_unpriv_pass'] = 'Mot de passe pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
$lng['install']['mysql_root_user'] = 'Utilisateur pour l\'acc<63>s root <20> MySQL';
$lng['install']['mysql_root_pass'] = 'Mot de passe pour l\'acc<63>s root <20> MySQL';
$lng['install']['admin_account'] = 'Acc<63>s administratif';
$lng['install']['admin_user'] = 'Login de l\'administrateur';
$lng['install']['admin_pass'] = 'Mot de passe de l\'administrateur';
$lng['install']['admin_pass_confirm'] = 'Mot de passe de l\'administrateur (confirmation)';
$lng['install']['serversettings'] = 'Configuration du serveur';
$lng['install']['servername'] = 'Nom du serveur (FQDN)';
$lng['install']['serverip'] = 'Adresse IP du serveur';
$lng['install']['apacheversion'] = 'Version du serveur Apache';
$lng['install']['next'] = 'Continuer';
/**
* Progress
*/
$lng['install']['testing_mysql'] = 'V<>rification du login root de MySQL ...';
$lng['install']['erasing_old_db'] = 'Effacement de l\'ancienne base de donn<6E>es ...';
$lng['install']['create_mysqluser_and_db'] = 'Cr<43>ation de la base de donn<6E>es puis des utilisateurs ...';
$lng['install']['testing_new_db'] = 'V<>rification de la base de donn<6E>es et des utilisateurs ...';
$lng['install']['importing_data'] = 'Importation des informations dans la base de donn<6E>es ...';
$lng['install']['changing_data'] = 'Modification des donn<6E>es import<72>s ...';
$lng['install']['adding_admin_user'] = 'Ajout de l\'utilisateur administrateur ...';
$lng['install']['creating_configfile'] = 'Cr<43>ation du fichier de configuration ...';
$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php a <20>t<EFBFBD> sauvegard<72> dans le dossier lib/ de Froxlor.';
$lng['install']['creating_configfile_temp'] = 'Le fichier a <20>t<EFBFBD> sauvegard<72> dans /tmp/userdata.inc.php, veuillez le d<>placer / copier dans le dossier lib/ de Froxlor.';
$lng['install']['creating_configfile_failed'] = 'Erreur en cr<63>ant le fichier lib/userdata.inc.php, veuillez le cr<63>er avec le contenu ci-dessous :';
$lng['install']['froxlor_succ_installed'] = 'Froxlor a <20>t<EFBFBD> install<6C> correctement.';
$lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'invite de connexion.';
$lng['install']['httpuser'] = 'Nom du utilisateur du HTTP';
$lng['install']['httpgroup'] = 'Nom du la group du HTTP';
/**
* Renamed in 1.2.19-svn40
*/
$lng['install']['webserver'] = 'Version du serveur';
$lng['install']['phpxml'] = 'Tester si PHP XML-extension est install<6C>e...';
?>

View File

@@ -2,83 +2,100 @@
/** /**
* This file is part of the Froxlor project. * This file is part of the Froxlor project.
* Copyright (c) 2003-2009 the SysCP Team (see authors). * Copyright (c) 2003-2007 the SysCP Team (see authors).
* Copyright (c) 2010 the Froxlor Team (see authors). * Copyright (c) 2010 the Froxlor Team (see authors).
* *
* For the full copyright and license information, please view the COPYING * For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the * file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt * COPYING file online at http://files.syscp.org/misc/COPYING.txt
* *
* @copyright (c) the authors * @copyright (c) the authors
* @author Florian Lippert <flo@syscp.org> (2003-2009) * @author Florian Lippert <flo@syscp.org> (2003-2007)
* @author Froxlor team <team@froxlor.org> (2010-) * @author Froxlor Team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Language * @package Language
* * @version $Id$
*/ */
$lng['requirements']['title'] = 'Prüfe Systemvoraussetzungen...'; /**
$lng['requirements']['installed'] = 'installiert'; * Begin
$lng['requirements']['not_true'] = 'nein'; */
$lng['requirements']['notfound'] = 'nicht gefunden';
$lng['requirements']['notinstalled'] = 'nicht installiert';
$lng['requirements']['activated'] = 'ist aktiviert.';
$lng['requirements']['phpversion'] = 'PHP Version >= 5.2';
$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime';
$lng['requirements']['phpmagic_quotes_runtime_description'] = 'Die PHP Einstellung "magic_quotes_runtime" muss deaktiviert sein ("Off"). Die Einstellung wurde temporär deaktiviert, bitte ändern Sie diese in der entsprechenden php.ini.';
$lng['requirements']['phpmysql'] = 'PHP MySQL-Erweiterung...';
$lng['requirements']['phpxml'] = 'PHP XML-Erweiterung...';
$lng['requirements']['phpfilter'] = 'PHP filter-Erweiterung...';
$lng['requirements']['phpposix'] = 'PHP posix-Erweiterung...';
$lng['requirements']['phpbcmath'] = 'PHP bcmath-Erweiterung...';
$lng['requirements']['bcmathdescription'] = 'Traffic-Berechnungs bezogene Funktionen stehen nicht vollständig zur Verfügung!';
$lng['requirements']['openbasedir'] = 'open_basedir genutzt wird...';
$lng['requirements']['openbasedirenabled'] = 'Froxlor wird mit aktiviertem open_basedir nicht vollständig funktionieren. Bitte deaktivieren Sie open_basedir für Froxlor in der entsprechenden php.ini';
$lng['requirements']['diedbecauseofrequirements'] = 'Kann Froxlor ohne diese Voraussetzungen nicht installieren! Versuchen Sie die angezeigten Problem zu beheben und versuchen Sie es erneut.';
$lng['requirements']['froxlor_succ_checks'] = 'Alle Vorraussetzungen sind erfüllt';
$lng['install']['lngtitle'] = 'Froxlor Installation - Sprache auswählen'; $lng['install']['language'] = 'Installations - Sprache';
$lng['install']['language'] = 'Sprache für die Installation'; $lng['install']['welcome'] = 'Willkommen zur Froxlor Installation';
$lng['install']['lngbtn_go'] = 'Sprache ändern'; $lng['install']['welcometext'] = 'Vielen Dank dass Sie sich f&uuml;r Froxlor entschieden haben. Um Ihre Installation von Froxlor zu starten, f&uuml;llen Sie bitte alle Felder unten mit den geforderten Angaben.<br /><b>Achtung:</b> Eine eventuell bereits existierende Datenbank, die den selben Namen hat wie den, den Sie unten eingeben werden, wird mit allen enthaltenen Daten gel&ouml;scht!';
$lng['install']['title'] = 'Froxlor Installation - Einrichtung'; $lng['install']['database'] = 'Datenbank';
$lng['install']['welcometext'] = 'Vielen Dank dass Sie sich für Froxlor entschieden haben. Um die Installation von Froxlor zu starten, füllen Sie bitte alle Felder mit den geforderten Angaben aus.<br /><b>Achtung:</b> Eine eventuell existierende Datenbank, die den selben Namen hat wie den Gewählten, wird mit allen enthaltenen Daten gelöscht!'; $lng['install']['mysql_hostname'] = 'MySQL-Hostname';
$lng['install']['database'] = 'Datenbankverbindung'; $lng['install']['mysql_database'] = 'MySQL-Datenbank';
$lng['install']['mysql_host'] = 'MySQL-Hostname'; $lng['install']['mysql_unpriv_user'] = 'Benutzername f&uuml;r den unprivilegierten MySQL-Account';
$lng['install']['mysql_database'] = 'Datenbank Name'; $lng['install']['mysql_unpriv_pass'] = 'Passwort f&uuml;r den unprivilegierten MySQL-Account';
$lng['install']['mysql_unpriv_user'] = 'Benutzername für den unprivilegierten MySQL-Account'; $lng['install']['mysql_root_user'] = 'Benutzername f&uuml;r den MySQL-Root-Account';
$lng['install']['mysql_unpriv_pass'] = 'Passwort für den unprivilegierten MySQL-Account'; $lng['install']['mysql_root_pass'] = 'Passwort f&uuml;r den MySQL-Root-Account';
$lng['install']['mysql_root_user'] = 'Benutzername für den MySQL-Root-Account';
$lng['install']['mysql_root_pass'] = 'Passwort für den MySQL-Root-Account';
$lng['install']['admin_account'] = 'Admin-Zugang'; $lng['install']['admin_account'] = 'Admin-Zugang';
$lng['install']['admin_user'] = 'Administrator-Benutzername'; $lng['install']['admin_user'] = 'Administrator-Benutzername';
$lng['install']['admin_pass1'] = 'Administrator-Passwort'; $lng['install']['admin_pass'] = 'Administrator-Passwort';
$lng['install']['admin_pass2'] = 'Administrator-Passwort (Bestätigung)'; $lng['install']['admin_pass_confirm'] = 'Administrator-Passwort (Best&auml;tigung)';
$lng['install']['serversettings'] = 'Servereinstellungen'; $lng['install']['serversettings'] = 'Servereinstellungen';
$lng['install']['servername'] = 'Servername (FQDN, keine IP-Adresse)'; $lng['install']['servername'] = 'Servername (FQDN)';
$lng['install']['serverip'] = 'Server-IP'; $lng['install']['serverip'] = 'Server-IP';
$lng['install']['webserver'] = 'Webserver'; $lng['install']['apacheversion'] = 'Apacheversion';
$lng['install']['apache2'] = 'Apache 2'; $lng['install']['next'] = 'Fortfahren';
$lng['install']['lighttpd'] = 'LigHTTPd';
$lng['install']['nginx'] = 'NGINX';
$lng['install']['httpuser'] = 'HTTP Username';
$lng['install']['httpgroup'] = 'HTTP Gruppenname';
$lng['install']['testing_mysql'] = 'Teste MySQL-Root Zugang...'; /**
$lng['install']['backup_old_db'] = 'Sicherung vorheriger Datenbank...'; * Progress
$lng['install']['backup_binary_missing'] = 'Konnte mysqldump nicht finden'; */
$lng['install']['backup_failed'] = 'Sicherung fehlgeschlagen';
$lng['install']['prepare_db'] = 'Datenbank wird vorbereitet...'; $lng['install']['testing_mysql'] = 'Teste, ob die MySQL-Root-Benutzerdaten richtig sind...';
$lng['install']['erasing_old_db'] = 'Entferne alte Datenbank...';
$lng['install']['backup_old_db'] = 'Sichere bisherige Datenbank...';
$lng['install']['backing_up'] = 'Sicherung l&auml;ft';
$lng['install']['backing_up_binary_missing'] = '/usr/bin/mysqldump nicht vorhanden';
$lng['install']['create_mysqluser_and_db'] = 'Erstelle Datenbank und Benutzer...'; $lng['install']['create_mysqluser_and_db'] = 'Erstelle Datenbank und Benutzer...';
$lng['install']['testing_new_db'] = 'Teste, ob Datenbank und Benutzer korrekt angelegt wurden...'; $lng['install']['testing_new_db'] = 'Teste, ob die Datenbank und Passwort korrekt angelegt wurden...';
$lng['install']['importing_data'] = 'Importiere Daten...'; $lng['install']['importing_data'] = 'Importiere Daten in die MySQL-Datenbank...';
$lng['install']['changing_data'] = 'Einstellungen anpassen...'; $lng['install']['changing_data'] = 'Passe die importierten Daten an...';
$lng['install']['creating_entries'] = 'Trage neue Werte ein...'; $lng['install']['adding_admin_user'] = 'F&uuml;ge den Admin-Benutzer hinzu...';
$lng['install']['adding_admin_user'] = 'Erstelle Admin-Benutzer...';
$lng['install']['creating_configfile'] = 'Erstelle Konfigurationsdatei...'; $lng['install']['creating_configfile'] = 'Erstelle Konfigurationsdatei...';
$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php wurde in lib/ gespeichert.';
$lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach lib/ verschieben.'; $lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach lib/ verschieben.';
$lng['install']['creating_configfile_failed'] = 'Konnte lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:'; $lng['install']['creating_configfile_failed'] = 'Konnte lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:';
$lng['install']['froxlor_succ_installed'] = 'Froxlor wurde erfolgreich installiert.'; $lng['install']['froxlor_succ_installed'] = 'Froxlor wurde erfolgreich installiert.';
$lng['install']['click_here_to_login'] = 'Hier geht es weiter zum Login-Fenster.';
$lng['install']['phpmysql'] = 'Teste, ob die PHP MySQL-Erweiterung installiert ist...';
$lng['install']['phpfilter'] = 'Teste, ob die PHP Filter-Erweiterung installiert ist...';
$lng['install']['diedbecauseofrequirements'] = 'Kann Froxlor ohne diese Voraussetzungen nicht installieren! Breche ab...';
$lng['install']['notinstalled'] = 'nicht installiert!';
$lng['install']['phpbcmath'] = 'Teste, ob die PHP bcmath-Erweiterung installiert ist...';
$lng['install']['bcmathdescription'] = 'Traffic-Berechnungs bezogene Funktionen stehen nicht vollst&auml;ndig zur Verf&uuml;gung!';
$lng['install']['openbasedir'] = 'Teste, ob open_basedir genutzt wird...';
$lng['install']['openbasedirenabled'] = 'aktiviert. Froxlor wird mit aktiviertem open_basedir nicht vollst&auml;ndig funktionieren. Bitte deaktivieren Sie open_basedir f&uuml;r Froxlor';
$lng['install']['httpuser'] = 'HTTP Username';
$lng['install']['httpgroup'] = 'HTTP Gruppenname';
$lng['click_here_to_refresh'] = 'Hier klicken, um erneut zu prüfen'; /**
$lng['click_here_to_continue'] = 'Installation fortführen'; * Renamed in 1.2.19-svn40
$lng['click_here_to_login'] = 'Hier geht es weiter zum Login-Fenster.'; */
$lng['install']['webserver'] = 'Webserver';
/*
* Added in Froxlor 0.9
*/
$lng['install']['phpversion'] = 'Pr&uuml;fe PHP Version >= 5.2';
$lng['install']['phpposix'] = 'Teste, ob die PHP Posix-Erweiterung installiert ist...';
/*
* Added in Froxlor 0.9.4
*/
$lng['install']['click_here_to_refresh'] = 'Erneut pr&uuml;fen';
$lng['install']['click_here_to_continue'] = 'Installation fortf&uuml;hren';
$lng['install']['froxlor_succ_checks'] = 'Alle Vorraussetzungen sind erf&uuml;llt';
/*
* Added in Froxlor 0.9.13
*/
$lng['install']['phpmagic_quotes_runtime'] = 'Pr&uuml;fe ob magic_quotes_runtime ausgeschalten ist';
$lng['install']['active'] = 'nein';
$lng['install']['phpmagic_quotes_runtime_description'] = 'Die PHP Einstellung "magic_quotes_runtime" muss deaktiviert sein ("Off"), um merkw&uuml;rdige Verhalten von Froxlor zu umgehen. Sie wurde deaktiviert (nur tempor&auml;r, bitte php.ini anpassen).';
$lng['install']['phpxml'] = 'Teste, ob die PHP XML-Erweiterung installiert ist...';
?>

View File

@@ -12,7 +12,7 @@
* @author Michael Duergner <michael@duergner.com> * @author Michael Duergner <michael@duergner.com>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt * @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package System * @package System
* * @version $Id$
*/ */
if(@php_sapi_name() != 'cli' if(@php_sapi_name() != 'cli'

View File

@@ -12,7 +12,7 @@
* @author Martin Burchert <eremit@syscp.org> * @author Martin Burchert <eremit@syscp.org>
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt * @license GPLv2 http://files.syscp.org/misc/COPYING.txt
* @package System * @package System
* * @version $Id$
*/ */
// some configs // some configs

View File

@@ -1,556 +0,0 @@
@charset "UTF-8";
/* RESET */
html,body,div,ul,ol,li,dl,dt,dd,h1,h2,h3,h4,h5,h6,pre,form,p,blockquote,fieldset,input { margin:0; padding:0; }
h1,h2,h3,h4,h5,h6,pre,code,address,caption,cite,code,em,strong,th { font-size:1em; font-weight:400; font-style:normal; }
ul,ol { list-style:none; }
fieldset,img { border:none; }
caption,th { text-align:left; }
table { border-collapse:collapse; border-spacing:0; }
article,aside,details,figcaption,figure,footer,header,hgroup,menu,nav,section { display:block; }
/* TYPE */
html,body {
font:12px/18px Helvetica,Arial,Verdana,sans-serif;
background-color:#f2f2f2;
color:#333;
-webkit-font-smoothing: antialiased;
}
body {
margin:0;
padding:0;
}
.dark {
background-color: #e9edf0;
border-bottom:1px solid #d1d5d8;
}
header img {
padding:10px 0 10px 10px;
}
h1 {
display:none;
}
h2, h3 {
margin: 0 0 1em 0;
padding: 0;
font-weight: bold;
}
h2 {
font-size:17px;
}
h3 {
font-size: 15px;
}
img {
border:0;
vertical-align:middle;
}
td a {
text-decoration:none;
}
.bradius {
border-radius: 5px 5px 5px 5px;
box-shadow: rgba(0, 0, 0, 0.34902) 0px 1px 3px 0px;
}
/* FOOTER */
footer {
clear:both;
text-align:center;
color: #888;
font-size:10px !important;
margin: 10px 0;
}
footer a,footer a:active,footer a:visited {
color: #888;
}
.install {
background-color:#fff;
margin: 20px;
margin-left: auto;
margin-right: auto;
margin-bottom: 12px;
width: 800px;
}
p {
margin: 0 10px !important;
}
.installsec {
margin-top:10px;
padding:0;
text-align:left;
}
.installsec table {
width:100%;
padding:0 10px;
margin: 15px 0 15px 0;
}
.installsec h2 {
display: block;
border-bottom: 1px solid #d1d5d8;
margin: 0;
padding: 5px 15px 15px 15px;
}
.installsec form {
width:800px;
margin:0 auto;
padding:10px 0 0;
text-align:left;
}
.installsec fieldset {
border:0;
float:left;
clear:left;
width:600px;
margin:0 100px 10px;
padding:0;
}
.installsec legend {
display:none;
}
.installsec label {
float:left;
margin-right:0;
margin-top:8px;
text-align:left;
}
p.submit {
text-align:right;
padding-right:46px;
}
.installsec aside {
border-top:1px solid #d1d5d8;
clear:both;
float:none;
width:auto;
text-align: right;
padding: 10px;
}
.line {
border: 0;
width: 800px;
border-bottom:1px solid #d1d5d8;
}
.messagewrapper {
width:650px;
margin:0 auto;
padding:120px 0 0;
overflow:hidden;
}
.messagewrapperfull {
width:100%;
margin:0 auto;
padding:0;
overflow:hidden;
}
.overviewsearch {
position:absolute;
top:155px;
right:36px;
font-size:80%;
}
.overviewadd {
padding:10px;
font-weight:700;
}
/*
* error message display
*/
.errorcontainer {
background:url(../img/icons/error_big.png) 10px center no-repeat #ffedef;
border:1px solid #ffc2ca;
padding:10px 10px 10px 68px!important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.errortitle {
font-weight:700;
color:#c00!important;
}
.error {
font-weight:400!important;
color:#c00!important;
}
/*
* warning message display
*/
.warningcontainer,.ui-dialog {
background:url(../img/icons/warning_big.png) 10px center no-repeat #fffecc;
border:1px solid #f3c37e;
padding:10px 10px 10px 68px !important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.ui-dialog {
padding: 10px !important;
}
.warningtitle,.ui-dialog-titlebar {
font-weight:700;
color:#D57D00;
}
.warning,.ui-dialog-content {
color:#D57D00!important;
}
/*
* success message display
*/
.successcontainer {
background:url(../img/icons/ok_big.png) 10px center no-repeat #E2F9E3;
border:1px solid #9C9;
padding:10px 10px 10px 68px!important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.successtitle {
font-weight:700;
color:#060!important;
}
.success {
font-weight:400!important;
}
/*
* neutral/info message display
*/
.neutralcontainer {
background:url(../img/icons/info_big.png) 10px center no-repeat #d2eaf6;
border:1px solid #b7d8ed;
padding:10px 10px 10px 68px!important;
margin: 10px 0 10px 0 !important;
text-align:left!important;
overflow:hidden;
box-shadow: 0px 0px 0px black;
}
.neutraltitle {
font-weight:700;
color:#3188c1!important;
}
.neutral {
font-weight:400!important;
color:#3188c1!important;
}
/* std hyperlink */
a,a:active,a:visited {
color:#176fa1;
text-decoration:none;
}
a:hover {
text-decoration:underline;
}
.infotext {
font-size:11px;
}
/*
* main container
*/
.main {
margin-left:240px;
margin-right:10px;
margin-top:105px;
margin-bottom:0;
background-color:#fff;
padding: 30px 30px 30px 30px;
min-height:400px;
}
.noborder {
width:100%;
border-spacing:0;
border-collapse:separate;
border: 0;
}
.noborder td {
border:0;
}
table {
width:100%;
border-spacing:0;
border:1px solid #d1d5d8;
border-collapse:separate;
box-shadow:0px 0px 0px black !important;
}
table thead th, table th {
border-top: 1px solid #d1d5d8;
border-bottom: 1px solid #d1d5d8;
height: 25px !important;
padding: 5px 0px 5px 8px;
background-color: #e9edf0;
font-weight: bold;
}
table thead:first-child th, table:first-child th {
border-top: none !important;
}
table th {
border-top: 0;
}
th a:hover {
text-decoration: none;
}
th a img {
}
th a:nth-child(odd) img {
position: relative;
top: -5px;
left: 4px;
}
th a:nth-child(even) img {
position: relative;
top: 3px;
left: -7px;
}
table thead:first-child th {
border-top: 0;
}
.disabled td, .disabled td a {
color: #cfcfcf;
}
table tbody td {
border-bottom:1px dotted #ccc;
}
table tbody tr:last-child td {
border-bottom: 0;
}
.formtable {
width: 100%;
border-spacing:0;
border:0;
border-collapse:separate;
margin:0 0 0;
}
.formtable tbody td {
border:0;
border-bottom:1px dotted #ccc;
min-height: 20px;
}
.formtable label {
float:none;
display:block;
padding:0;
margin:0;
width:100%;
text-align:left;
}
td {
padding-top:5px;
padding-left:10px;
padding-right: 10px;
padding-bottom:5px;
min-height: 20px;
}
table tfoot td {
height:25px;
border-top: 1px solid #d1d5d8;
background-color: #f2f8fa;
}
.tfootleft {
text-align:left;
}
.maintitle {
padding-top:20px;
}
/* input elements */
input {
background: #fff url(../img/text_align_left.png) no-repeat 5px 4px;
padding:2px 4px 2px 24px;
height:22px;
border: 1px solid #d9d9d9;
margin-bottom: 5px;
border-radius: 3px;
}
textarea {
background:#fff url(../img/text_align_left.png) no-repeat 5px 4px;
padding:4px 4px 2px 24px;
border:1px solid #d9d9d9;
margin-bottom: 5px;
border-radius: 3px;
}
input[type="password"] {
background:#fff url(../img/password.png) no-repeat 5px 4px;
}
/*
* BUTTONS
*/
input[type="button"],input[type="submit"],input[type="reset"] {
margin: 0 5px;
padding: 5px 14px;
outline: 0;
border: 0;
background-color: #eee;
min-width: 80px;
height: 26px;
background-image: none;
border-width: 0px;
}
.loginsec input[type="button"], .loginsec input[type="submit"], .loginsec input[type="reset"] {
margin: 0 1px;
}
input[type="button"]:hover,input[type="submit"]:hover,input[type="reset"]:hover {
color: #333;
background-color: #dcdcdc;
}
input[type="button"]:active,input[type="submit"]:active,input[type="reset"]:active {
-webkit-box-shadow: inset 0 1px 8px rgba(0, 0, 0, 0.25);
-moz-box-shadow: inset 0 1px 8px rgba(0, 0, 0, 0.25);
box-shadow: inset 0 1px 8px rgba(0, 0, 0, 0.25);
color: white !important;
}
input[type="submit"],input[class="yesbutton"] {
color: white;
background-color: #35aa47;
}
input[type="submit"]:hover,input[class="yesbutton"]:hover {
color: white;
background-color: #1d943b;
}
input[class="submit"]:active,input[class="yesbutton"]:active {
background-color: #35aa47;
}
input[class="nobutton"],input[type="reset"] {
color: white;
background-color: #d84a38;
}
input[class="nobutton"]:hover,input[type="reset"]:hover {
color: white;
background-color: #c53727;
}
input[class="nobutton"]:active,input[type="reset"]:active {
background-color: #dd4b39;
}
input[type="checkbox"] {
background:#dae7ee;
padding: 0;
margin: 0 5px 0 0;
vertical-align: middle;
height: 26px;
}
input[type="radio"] {
margin: 0 10px 0 10px;
height:22px;
}
select {
background:#fff;
padding:4px;
border:1px solid #d9d9d9;
margin-bottom: 5px;
min-width: 100px;
}
select.dropdown {
padding: 2px 4px 2px 24px;
height: 26px;
border: 1px solid #d9d9d9;
margin-bottom: 5px;
border-radius: 3px;
background: url(../../../../templates/Sparkle/assets/img/icons/down.png) no-repeat 9px;
-webkit-appearance: none;
-moz-appearance: none;
appearance: none;
}
.maintable {
width:90%;
}
.update_progess {
padding:2em;
text-align:left;
}
.preconfig {
text-align:left;
margin-top:20px;
margin-bottom:5px;
margin-right:15px;
margin-left:15px;
}
.preconfigitem {
padding:.15em;
border-bottom:1px solid #ccc;
}
.preconfdesc {
display:block;
margin-bottom:.5em;
font-size:120%;
}
.installprogress {
width: 100%;
background-color:#e4e4e4;
height:5px;
border-bottom:1px solid #d1d5d8;
}
.installprogress .bar {
background-color: #35aa47;
height:5px;
}

Binary file not shown.

Before

Width:  |  Height:  |  Size: 1.4 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 2.5 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 3.4 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 198 B

View File

@@ -1,10 +0,0 @@
<p style="margin: 20px 20px 0 !important">{$this->_lng['install']['title']}</p>
<form action="{$formaction}" method="get">
<fieldset>
{$formdata}
<p class="submit">
<input type="hidden" name="check" value="1" />
<input type="submit" name="chooselang" value="{$this->_lng['install']['btn_go']}" />
</p>
</fieldset>
</form>

View File

@@ -1,13 +0,0 @@
<p style="margin: 20px 20px 0 !important">{$this->_lng['install']['welcometext']}</p>
<form action="{$formaction}" method="post">
<hr class="line">
<fieldset>
{$formdata}
</fieldset>
<aside>
<input type="hidden" name="check" value="1" />
<input type="hidden" name="language" value="{$language}" />
<input type="hidden" name="installstep" value="1" />
<input class="bottom" type="submit" name="submitbutton" value="{$this->_lng['click_here_to_continue']}" />
</aside>
</form>

View File

@@ -1,4 +0,0 @@
<p>
<label for="{$fieldname}" style="width:65%;{$style}">{$fieldlabel}:</label>&nbsp;
<input type="{$type}" name="{$fieldname}" id="{$fieldname}" value="{$fieldvalue}" {$required} />
</p>

View File

@@ -1,4 +0,0 @@
<p>
<label for="{$fieldname}" style="width:65%;{$style}">{$this->_lng['install']['webserver']} {$fieldlabel}:</label>
<input type="radio" name="webserver" id="{$fieldname}" value="{$fieldname}" {$checked} /><span>{$fieldlabel}<span>
</p>

View File

@@ -1,2 +0,0 @@
<br />
<h3>{$section}</h3>

View File

@@ -1,7 +0,0 @@
</div>
<footer>
<span> Froxlor &copy; 2009-{$current_year} by <a href="http://www.froxlor.org/" rel="external">the Froxlor Team</a>
</span>
</footer>
</body>
</html>

View File

@@ -1,18 +0,0 @@
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta http-equiv="Default-Style" content="text/css" />
<!--[if lt IE 9]><script src="../js/html5shiv.js"></script><![endif]-->
<link href="templates/assets/css/install.css" rel="stylesheet" type="text/css" />
<!--[if IE]><link rel="stylesheet" href="../templates/{$theme}/css/main_ie.css" type="text/css" /><![endif]-->
<link href="templates/assets/img/favicon.ico" rel="icon" type="image/x-icon" />
<title>Froxlor Server Management Panel - Installation</title>
<style type="text/css">
body {
font-family: Verdana, Geneva, sans-serif;
}
</style>
</head>
<body>
<div class="installsec">

Some files were not shown because too many files have changed in this diff Show More