Compare commits

...

21 Commits

Author SHA1 Message Date
Michael Kaufmann (d00p)
2f5cca71fb set version to 0.9.33.1 for bugfix release
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-16 08:50:49 +01:00
Michael Kaufmann (d00p)
85e0690a1b clear group-cache of nscd as this solves issues with webserver/php-fpm most of the time
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-16 08:24:48 +01:00
Roman Schmerold (BNoiZe)
34415c50f8 Fixing a bug with linebreaks, fixes #1498
Signed-off-by: Roman Schmerold (BNoiZe) <bnoize@froxlor.org>
2015-02-15 19:08:22 +01:00
Michael Kaufmann (d00p)
47f0c52c18 fix typo of vmail-user in rhel/centos config-template for dovecot
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-15 16:28:08 +01:00
Michael Kaufmann (d00p)
9853220549 use correct PEAR directory setting in fpm-interface, fixes #1500
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-15 16:18:17 +01:00
Michael Kaufmann (d00p)
71cdab5d9e show only hash algorithms that are available on the system
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-15 07:55:21 +01:00
Michael Kaufmann (d00p)
b049d07374 respect possible empty-value when validating string::validate_ip
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-12 13:06:19 +01:00
Michael Kaufmann (d00p)
1c979d5a21 fix move-customer-to-admin
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-10 16:17:32 +01:00
Michael Kaufmann (d00p)
a038a5a92f allow private-network ip-addresses for database-connection, fixes #1489
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-08 17:38:26 +01:00
Michael Kaufmann (d00p)
f36dbc1938 show whether a customer is deavtivated after successful login rather then nothing at all
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-08 17:38:17 +01:00
Michael Kaufmann (d00p)
f711b03b4f don't use -1 for standard-subdomains as the parentdomainid field is declared as unsigned int and therefore converted to 0 anyways
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-08 15:29:52 +01:00
Michael Kaufmann (d00p)
49b82201c7 fix undefined variable in cases 'custom-notes-show' is not set when adding/editing an admin/a customer
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-08 12:44:11 +01:00
Michael Kaufmann (d00p)
15a6e9b78b set version to 0.9.33 for upcoming stable release
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-07 09:55:52 +01:00
Michael Kaufmann
15a84f69c1 Merge pull request #228 from HolySephi/master
fixed some rhel/centos 7 config issues, thx to Sephi
2015-02-06 11:04:54 +01:00
Michael Kaufmann (d00p)
30b27b6b73 update italian.lng.php, thx to Heaven73
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-06 10:43:57 +01:00
Michael Kaufmann (d00p)
2b5c0764e3 allow to disable fcgid also with lighttpd because we allow it to be enabled with lighttpd
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-06 08:44:11 +01:00
Michael Kaufmann
cae16b4579 Merge pull request #227 from Froxlor/master
pid of cronjob is the part after the last dash (we did not have more then one before), fixes #1483
2015-02-02 16:24:37 +01:00
Michael Kaufmann (d00p)
6df6fc2361 pid of cronjob is the part after the last dash (we did not have more then one before), fixes #1483
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-02 16:13:07 +01:00
Roman Schmerold (BNoiZe)
48eaab89ba Add missing space in sed command
Signed-off-by: Roman Schmerold (BNoiZe) <bnoize@froxlor.org>
2015-02-02 13:57:23 +01:00
Roman Schmerold (BNoiZe)
a0b0fa48bb Fix that name is not returned for admins
Signed-off-by: Roman Schmerold (BNoiZe) <bnoize@froxlor.org>
2015-02-02 11:01:26 +01:00
Michael Kaufmann (d00p)
6534dbf47b doc-fixes; fix hardcoded installation-path in centos-cron-configtemplate
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
2015-02-01 20:09:24 +01:00
34 changed files with 681 additions and 90 deletions

View File

@@ -45,7 +45,7 @@ return array(
'type' => 'option', 'type' => 'option',
'default' => 0, 'default' => 0,
'option_mode' => 'one', 'option_mode' => 'one',
'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'), 'option_options_method' => 'getAvailablePasswordHashes',
'save_method' => 'storeSettingField', 'save_method' => 'storeSettingField',
), ),
'system_allow_error_report_admin' => array( 'system_allow_error_report_admin' => array(

View File

@@ -202,7 +202,10 @@ if ($page == 'admins'
$email = $idna_convert->encode(validate($_POST['email'], 'email')); $email = $idna_convert->encode(validate($_POST['email'], 'email'));
$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/'); $custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
$custom_notes_show = 0;
if (isset($_POST['custom_notes_show'])) {
$custom_notes_show = intval_ressource($_POST['custom_notes_show']); $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
}
$loginname = validate($_POST['loginname'], 'loginname'); $loginname = validate($_POST['loginname'], 'loginname');
$password = validate($_POST['admin_password'], 'password'); $password = validate($_POST['admin_password'], 'password');
@@ -498,7 +501,10 @@ if ($page == 'admins'
$email = $idna_convert->encode(validate($_POST['email'], 'email')); $email = $idna_convert->encode(validate($_POST['email'], 'email'));
$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/'); $custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
$custom_notes_show = $result['custom_notes_show'];
if (isset($_POST['custom_notes_show'])) {
$custom_notes_show = intval_ressource($_POST['custom_notes_show']); $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
}
if ($result['adminid'] == $userinfo['userid']) { if ($result['adminid'] == $userinfo['userid']) {

View File

@@ -420,7 +420,10 @@ if ($page == 'customers'
$gender = intval_ressource($_POST['gender']); $gender = intval_ressource($_POST['gender']);
$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/'); $custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
$custom_notes_show = 0;
if (isset($_POST['custom_notes_show'])) {
$custom_notes_show = intval_ressource($_POST['custom_notes_show']); $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
}
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
if (isset($_POST['diskspace_ul'])) { if (isset($_POST['diskspace_ul'])) {
@@ -889,7 +892,7 @@ if ($page == 'customers'
`domain` = :domain, `domain` = :domain,
`customerid` = :customerid, `customerid` = :customerid,
`adminid` = :adminid, `adminid` = :adminid,
`parentdomainid` = '-1', `parentdomainid` = '0',
`documentroot` = :docroot, `documentroot` = :docroot,
`zonefile` = '', `zonefile` = '',
`isemaildomain` = '0', `isemaildomain` = '0',
@@ -1037,7 +1040,7 @@ if ($page == 'customers'
*/ */
$available_admins_stmt = Database::prepare(" $available_admins_stmt = Database::prepare("
SELECT * FROM `" . TABLE_PANEL_ADMINS . "` SELECT * FROM `" . TABLE_PANEL_ADMINS . "`
WHERE (`customers` = '-1' OR `customers` < `customers_used`)" WHERE (`customers` = '-1' OR `customers` > `customers_used`)"
); );
Database::pexecute($available_admins_stmt); Database::pexecute($available_admins_stmt);
$admin_select = makeoption("-----", 0, true, true, true); $admin_select = makeoption("-----", 0, true, true, true);
@@ -1073,7 +1076,10 @@ if ($page == 'customers'
$move_to_admin = isset($_POST['move_to_admin']) ? intval_ressource($_POST['move_to_admin']) : 0; $move_to_admin = isset($_POST['move_to_admin']) ? intval_ressource($_POST['move_to_admin']) : 0;
$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/'); $custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
$custom_notes_show = $result['custom_notes_show'];
if (isset($_POST['custom_notes_show'])) {
$custom_notes_show = intval_ressource($_POST['custom_notes_show']); $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
}
$diskspace = intval_ressource($_POST['diskspace']); $diskspace = intval_ressource($_POST['diskspace']);
if (isset($_POST['diskspace_ul'])) { if (isset($_POST['diskspace_ul'])) {
@@ -1248,7 +1254,7 @@ if ($page == 'customers'
`domain` = :domain, `domain` = :domain,
`customerid` = :customerid, `customerid` = :customerid,
`adminid` = :adminid, `adminid` = :adminid,
`parentdomainid` = '-1', `parentdomainid` = '0',
`documentroot` = :docroot, `documentroot` = :docroot,
`zonefile` = '', `zonefile` = '',
`isemaildomain` = '0', `isemaildomain` = '0',

View File

@@ -119,6 +119,13 @@ if ($action == 'login') {
redirectTo('index.php', array('showmessage' => '3')); redirectTo('index.php', array('showmessage' => '3'));
exit; exit;
} elseif (validatePasswordLogin($userinfo, $password, $table, $uid)) { } elseif (validatePasswordLogin($userinfo, $password, $table, $uid)) {
// only show "you're banned" if the login was successfull
// because we don't want to publish that the user does exist
if ($userinfo['deactivated']) {
unset($userinfo);
redirectTo('index.php', array('showmessage' => '5'));
exit;
} else {
// login correct // login correct
// reset loginfail_counter, set lastlogin_succ // reset loginfail_counter, set lastlogin_succ
$stmt = Database::prepare("UPDATE $table $stmt = Database::prepare("UPDATE $table
@@ -128,6 +135,7 @@ if ($action == 'login') {
Database::pexecute($stmt, array("lastlogin_succ" => time(), "uid" => $userinfo[$uid])); Database::pexecute($stmt, array("lastlogin_succ" => time(), "uid" => $userinfo[$uid]));
$userinfo['userid'] = $userinfo[$uid]; $userinfo['userid'] = $userinfo[$uid];
$userinfo['adminsession'] = $adminsession; $userinfo['adminsession'] = $adminsession;
}
} else { } else {
// login incorrect // login incorrect
$stmt = Database::prepare("UPDATE $table $stmt = Database::prepare("UPDATE $table
@@ -269,6 +277,9 @@ if ($action == 'login') {
case 7: case 7:
$message = $lng['pwdreminder']['wrongcode']; $message = $lng['pwdreminder']['wrongcode'];
break; break;
case 8:
$message = $lng['pwdreminder']['notallowed'];
break;
} }
$update_in_progress = ''; $update_in_progress = '';
@@ -326,8 +337,8 @@ if ($action == 'forgotpwd') {
/* Check whether user is banned */ /* Check whether user is banned */
if ($user['deactivated']) { if ($user['deactivated']) {
$message = $lng['pwdreminder']['notallowed']; redirectTo('index.php', array('showmessage' => '8'));
redirectTo('index.php', array('showmessage' => '5')); exit;
} }
if (($adminchecked && Settings::Get('panel.allow_preset_admin') == '1') || $adminchecked == false) { if (($adminchecked && Settings::Get('panel.allow_preset_admin') == '1') || $adminchecked == false) {

View File

@@ -538,7 +538,7 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
('panel', 'password_numeric', '0'), ('panel', 'password_numeric', '0'),
('panel', 'password_special_char_required', '0'), ('panel', 'password_special_char_required', '0'),
('panel', 'password_special_char', '!?<>§$%+#=@'), ('panel', 'password_special_char', '!?<>§$%+#=@'),
('panel', 'version', '0.9.33-rc3'); ('panel', 'version', '0.9.33.1');
DROP TABLE IF EXISTS `panel_tasks`; DROP TABLE IF EXISTS `panel_tasks`;

View File

@@ -2884,3 +2884,19 @@ if (isFroxlorVersion('0.9.33-rc2')) {
updateToVersion('0.9.33-rc3'); updateToVersion('0.9.33-rc3');
} }
if (isFroxlorVersion('0.9.33-rc3')) {
showUpdateStep("Updating from 0.9.33-rc3 to 0.9.33 final");
lastStepStatus(0);
updateToVersion('0.9.33');
}
if (isFroxlorVersion('0.9.33')) {
showUpdateStep("Updating from 0.9.33 to 0.9.33.1");
lastStepStatus(0);
updateToVersion('0.9.33.1');
}

View File

@@ -255,8 +255,6 @@ class DomainBulkAction {
* adds a single domain to the database using the given array * adds a single domain to the database using the given array
* *
* @param array $domain_data * @param array $domain_data
* @param object $ins_stmt prepared PDO-statement to insert into panel_domains
* @param object $ipp_ins_stmt prepared PDO-statement to insert into panel_domaintoip
* *
* @return int last-inserted id or false on error * @return int last-inserted id or false on error
*/ */

View File

@@ -264,7 +264,7 @@ class Database {
'charset' => 'utf8' 'charset' => 'utf8'
); );
if (!validateLocalHostname($host) && !validate_ip2($host, true, 'invalidip', true)) { if (!validateLocalHostname($host) && !validate_ip2($host, true, 'invalidip', true, true)) {
$dbconf["dsn"]['unix_socket'] = makeCorrectFile($host); $dbconf["dsn"]['unix_socket'] = makeCorrectFile($host);
} else { } else {
$dbconf["dsn"]['host'] = $host; $dbconf["dsn"]['host'] = $host;

View File

@@ -250,7 +250,7 @@ class phpinterface_fpm {
$php_ini_variables = array( $php_ini_variables = array(
'SAFE_MODE' => 'Off', // keep this for compatibility, just in case 'SAFE_MODE' => 'Off', // keep this for compatibility, just in case
'PEAR_DIR' => Settings::Get('system.mod_fcgid_peardir'), 'PEAR_DIR' => Settings::Get('phpfpm.peardir'),
'TMP_DIR' => $this->getTempDir(), 'TMP_DIR' => $this->getTempDir(),
'CUSTOMER_EMAIL' => $this->_domain['email'], 'CUSTOMER_EMAIL' => $this->_domain['email'],
'ADMIN_EMAIL' => $admin['email'], 'ADMIN_EMAIL' => $admin['email'],

View File

@@ -403,7 +403,8 @@ return array(
'chmod 600 /usr/local/etc/libnss-mysql.cfg /usr/local/etc/libnss-mysql-root.cfg' 'chmod 600 /usr/local/etc/libnss-mysql.cfg /usr/local/etc/libnss-mysql-root.cfg'
), ),
'restart' => array( 'restart' => array(
'sh /etc/rc.d/nscd restart' 'sh /etc/rc.d/nscd restart',
'nscd --invalidate=group'
) )
), ),
'logrotate' => array( 'logrotate' => array(

View File

@@ -410,7 +410,8 @@ milter_default_action = accept" >> /etc/postfix/main.cf',
'rc-update add nscd default' 'rc-update add nscd default'
), ),
'restart' => array( 'restart' => array(
'/etc/init.d/nscd restart' '/etc/init.d/nscd restart',
'nscd --invalidate=group'
) )
), ),
'logrotate' => array( 'logrotate' => array(

View File

@@ -393,7 +393,8 @@ return array(
'etc_nsswitch.conf' => '/etc/nsswitch.conf', 'etc_nsswitch.conf' => '/etc/nsswitch.conf',
), ),
'restart' => array( 'restart' => array(
'/etc/init.d/nscd restart' '/etc/init.d/nscd restart',
'nscd --invalidate=group'
) )
), ),
'logrotate' => array( 'logrotate' => array(

View File

@@ -395,7 +395,8 @@ return array(
'etc_nsswitch.conf' => '/etc/nsswitch.conf', 'etc_nsswitch.conf' => '/etc/nsswitch.conf',
), ),
'restart' => array( 'restart' => array(
'/etc/init.d/nscd restart' '/etc/init.d/nscd restart',
'nscd --invalidate=group'
) )
), ),
'logrotate' => array( 'logrotate' => array(

View File

@@ -48,7 +48,7 @@ return array(
(Settings::Get('system.deactivateddocroot') != '') ? 'mkdir -p ' . Settings::Get('system.deactivateddocroot') : '' (Settings::Get('system.deactivateddocroot') != '') ? 'mkdir -p ' . Settings::Get('system.deactivateddocroot') : ''
), ),
'restart' => array( 'restart' => array(
'/usr/bin/systemctl reload-or-restart httpd.service' 'systemctl reload-or-restart httpd.service'
) )
), ),
), ),
@@ -72,7 +72,7 @@ return array(
'touch /etc/postfix/mysql-virtual_mailbox_maps.cf', 'touch /etc/postfix/mysql-virtual_mailbox_maps.cf',
'touch /etc/postfix/mysql-virtual_sender_permissions.cf', 'touch /etc/postfix/mysql-virtual_sender_permissions.cf',
'chown root:root /etc/postfix/mysql-*.cf', 'chown root:root /etc/postfix/mysql-*.cf',
'chmod 0644 /etc/postfix/mysql-*.cf', 'chmod 0600 /etc/postfix/mysql-*.cf',
), ),
'files' => array( 'files' => array(
'etc_postfix_main.cf' => '/etc/postfix/main.cf', 'etc_postfix_main.cf' => '/etc/postfix/main.cf',
@@ -99,11 +99,12 @@ return array(
'systemctl enable dovecot.service', 'systemctl enable dovecot.service',
), ),
'commands' => array( 'commands' => array(
'yum install dovecot dovecot-mysql dovecot-pigeonhole', 'touch /etc/dovecot/dovecot-sql.conf.ext',
'chmod 0600 /etc/dovecot/dovecot-sql.conf.ext',
), ),
'files' => array( 'files' => array(
'etc_dovecot_dovecot.conf' => '/etc/dovecot/dovecot.conf', 'etc_dovecot_dovecot.conf' => '/etc/dovecot/dovecot.conf',
'etc_dovecot_dovecot-sql.conf.ext' => '/etc/dovecot/dovecot.conf.ext', 'etc_dovecot_dovecot-sql.conf.ext' => '/etc/dovecot/dovecot-sql.conf.ext',
'etc_dovecot_conf.d_10-auth.conf' => '/etc/dovecot/conf.d/10-auth.conf', 'etc_dovecot_conf.d_10-auth.conf' => '/etc/dovecot/conf.d/10-auth.conf',
'etc_dovecot_conf.d_10-logging.conf' => '/etc/dovecot/conf.d/10-logging.conf', 'etc_dovecot_conf.d_10-logging.conf' => '/etc/dovecot/conf.d/10-logging.conf',
'etc_dovecot_conf.d_10-mail.conf' => '/etc/dovecot/conf.d/10-mail.conf', 'etc_dovecot_conf.d_10-mail.conf' => '/etc/dovecot/conf.d/10-mail.conf',
@@ -156,7 +157,7 @@ return array(
'awstats' => array( 'awstats' => array(
'label' => 'Awstats', 'label' => 'Awstats',
'commands' => array( 'commands' => array(
'sed -i.bak \'s/^DirData/# DirData/\''.makeCorrectFile(Settings::Get('system.awstats_conf').'/awstats.model.conf'), 'sed -i.bak \'s/^DirData/# DirData/\' '.makeCorrectFile(Settings::Get('system.awstats_conf').'/awstats.model.conf'),
'# Please make sure you deactivate awstats own cronjob as Froxlor handles that itself' '# Please make sure you deactivate awstats own cronjob as Froxlor handles that itself'
) )
) )

View File

@@ -392,7 +392,8 @@ return array(
'etc_nsswitch.conf' => '/etc/nsswitch.conf', 'etc_nsswitch.conf' => '/etc/nsswitch.conf',
), ),
'restart' => array( 'restart' => array(
'/etc/init.d/nscd restart' '/etc/init.d/nscd restart',
'nscd --invalidate=group'
) )
), ),
'logrotate' => array( 'logrotate' => array(

View File

@@ -390,7 +390,8 @@ return array(
'etc_nsswitch.conf' => '/etc/nsswitch.conf', 'etc_nsswitch.conf' => '/etc/nsswitch.conf',
), ),
'restart' => array( 'restart' => array(
'service nscd restart' 'service nscd restart',
'nscd --invalidate=group'
) )
), ),
'logrotate' => array( 'logrotate' => array(

View File

@@ -397,7 +397,8 @@ return array(
'etc_nsswitch.conf' => '/etc/nsswitch.conf', 'etc_nsswitch.conf' => '/etc/nsswitch.conf',
), ),
'restart' => array( 'restart' => array(
'/etc/init.d/nscd restart' '/etc/init.d/nscd restart',
'nscd --invalidate=group'
) )
), ),
'logrotate' => array( 'logrotate' => array(

View File

@@ -118,7 +118,7 @@ while ($fName = readdir($lockDirHandle)) {
} }
// Check if cron is running or has died. // Check if cron is running or has died.
$check_pid = substr(strstr($fName, "-"), 1); $check_pid = substr(strrchr($fName, "-"), 1);
system("kill -CHLD " . (int)$check_pid . " 1> /dev/null 2> /dev/null", $check_pid_return); system("kill -CHLD " . (int)$check_pid . " 1> /dev/null 2> /dev/null", $check_pid_return);
if ($check_pid_return == 1) { if ($check_pid_return == 1) {

View File

@@ -107,9 +107,15 @@ function validateFormFieldString($fieldname, $fielddata, $newfieldvalue)
} }
} }
elseif (isset($fielddata['string_type']) && $fielddata['string_type'] == 'validate_ip') { elseif (isset($fielddata['string_type']) && $fielddata['string_type'] == 'validate_ip') {
$newfieldvalue = validate_ip2($newfieldvalue); // check for empty value (it might be allowed)
if (trim($newfieldvalue) == '') {
$newfieldvalue = '';
$returnvalue = 'stringmustntbeempty';
} else {
$newfieldvalue = validate_ip2($newfieldvalue, true);
$returnvalue = ($newfieldvalue !== false ? true : 'invalidip'); $returnvalue = ($newfieldvalue !== false ? true : 'invalidip');
} }
}
elseif (preg_match('/^[^\r\n\t\f\0]*$/D', $newfieldvalue)) { elseif (preg_match('/^[^\r\n\t\f\0]*$/D', $newfieldvalue)) {
$returnvalue = true; $returnvalue = true;
} }

View File

@@ -10,6 +10,9 @@
* @return true on sucess, error-message on failure * @return true on sucess, error-message on failure
*/ */
function moveCustomerToAdmin($id = 0, $adminid = 0) { function moveCustomerToAdmin($id = 0, $adminid = 0) {
global $log;
if ($id <= 0 || $adminid <= 0) { if ($id <= 0 || $adminid <= 0) {
return "no valid id's given"; return "no valid id's given";
} }
@@ -23,12 +26,14 @@ function moveCustomerToAdmin($id = 0, $adminid = 0) {
'cid' => $id 'cid' => $id
) ); ) );
$log->logAction(ADM_ACTION, LOG_INFO, "moved user #" . $id . " from admin/reseller #".$cAdmin['adminid']." to admin/reseller #".$adminid);
// Update customer entry // Update customer entry
$updCustomer_stmt = Database::prepare ( " $updCustomer_stmt = Database::prepare ( "
UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `adminid` = :adminid WHERE `customerid` = :cid UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `adminid` = :adminid WHERE `customerid` = :cid
" ); " );
Database::pexecute ( $updCustomer_stmt, array ( Database::pexecute ( $updCustomer_stmt, array (
'adminid' => $cAdmin ['adminid'], 'adminid' => $adminid,
'cid' => $id 'cid' => $id
) ); ) );
@@ -37,7 +42,7 @@ function moveCustomerToAdmin($id = 0, $adminid = 0) {
UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `adminid` = :adminid WHERE `customerid` = :cid UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `adminid` = :adminid WHERE `customerid` = :cid
" ); " );
Database::pexecute ( $updDomains_stmt, array ( Database::pexecute ( $updDomains_stmt, array (
'adminid' => $cAdmin ['adminid'], 'adminid' => $adminid,
'cid' => $id 'cid' => $id
) ); ) );
@@ -46,7 +51,7 @@ function moveCustomerToAdmin($id = 0, $adminid = 0) {
UPDATE `" . TABLE_PANEL_TICKETS . "` SET `adminid` = :adminid WHERE `customerid` = :cid UPDATE `" . TABLE_PANEL_TICKETS . "` SET `adminid` = :adminid WHERE `customerid` = :cid
" ); " );
Database::pexecute ( $updTickets_stmt, array ( Database::pexecute ( $updTickets_stmt, array (
'adminid' => $cAdmin ['adminid'], 'adminid' => $adminid,
'cid' => $id 'cid' => $id
) ); ) );

View File

@@ -26,28 +26,24 @@
* @author Florian Lippert <flo@syscp.org> * @author Florian Lippert <flo@syscp.org>
*/ */
function getCorrectFullUserDetails($userinfo) function getCorrectFullUserDetails($userinfo) {
{
$returnval = ''; $returnval = '';
if(isset($userinfo['firstname']) && isset($userinfo['name']) && isset($userinfo['company'])) if (isset($userinfo['firstname']) && isset($userinfo['name']) && isset($userinfo['company'])) {
{ if ($userinfo['company'] == '') {
if($userinfo['company'] == '')
{
$returnval = $userinfo['name'] . ', ' . $userinfo['firstname']; $returnval = $userinfo['name'] . ', ' . $userinfo['firstname'];
} }
else else {
{ if ($userinfo['name'] != ''
if($userinfo['name'] != '' && $userinfo['firstname'] != '') {
&& $userinfo['firstname'] != '')
{
$returnval = $userinfo['name'] . ', ' . $userinfo['firstname'] . ' | ' . $userinfo['company']; $returnval = $userinfo['name'] . ', ' . $userinfo['firstname'] . ' | ' . $userinfo['company'];
} }
else else {
{
$returnval = $userinfo['company']; $returnval = $userinfo['company'];
} }
} }
} elseif (isset($userinfo['name'])) {
$returnval = $userinfo['name'];
} }
return $returnval; return $returnval;

View File

@@ -0,0 +1,46 @@
<?php
/**
* This file is part of the Froxlor project.
* Copyright (c) 2015 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2014-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Functions
*
* @since 0.9.33.1
*/
/**
* return an array of available hashes for the crypt() function
*
* @return array
*/
function getAvailablePasswordHashes()
{
global $lng;
// get available pwd-hases
$available_pwdhashes = array(
0 => $lng['serversettings']['systemdefault']
);
if (defined('CRYPT_MD5') && CRYPT_MD5 == 1) {
$available_pwdhashes[1] = 'MD5';
}
if (defined('CRYPT_BLOWFISH') && CRYPT_BLOWFISH == 1) {
$available_pwdhashes[2] = 'BLOWFISH';
}
if (defined('CRYPT_SHA256') && CRYPT_SHA256 == 1) {
$available_pwdhashes[3] = 'SHA-256';
}
if (defined('CRYPT_SHA512') && CRYPT_SHA512 == 1) {
$available_pwdhashes[4] = 'SHA-512';
}
return $available_pwdhashes;
}

View File

@@ -23,7 +23,7 @@ function checkMysqlAccessHost($fieldname, $fielddata, $newfieldvalue, $allnewfie
foreach ($mysql_access_host_array as $host_entry) { foreach ($mysql_access_host_array as $host_entry) {
if (validate_ip2($host_entry, true, 'invalidip', true) == false if (validate_ip2($host_entry, true, 'invalidip', true, true) == false
&& validateDomain($host_entry) == false && validateDomain($host_entry) == false
&& validateLocalHostname($host_entry) == false && validateLocalHostname($host_entry) == false
&& $host_entry != '%' && $host_entry != '%'

View File

@@ -21,8 +21,8 @@ function checkPhpInterfaceSetting($fieldname, $fielddata, $newfieldvalue, $allne
$returnvalue = array(FORMFIELDS_PLAUSIBILITY_CHECK_OK); $returnvalue = array(FORMFIELDS_PLAUSIBILITY_CHECK_OK);
if ((int)Settings::Get('system.mod_fcgid') == 1) { if ((int)Settings::Get('system.mod_fcgid') == 1) {
// now check if we enable a webserver != apache // fcgid only works for apache and lighttpd
if (strtolower($newfieldvalue) != 'apache2') { if (strtolower($newfieldvalue) != 'apache2' && strtolower($newfieldvalue) != 'lighttpd') {
$returnvalue = array(FORMFIELDS_PLAUSIBILITY_CHECK_ERROR, 'fcgidstillenableddeadlock'); $returnvalue = array(FORMFIELDS_PLAUSIBILITY_CHECK_ERROR, 'fcgidstillenableddeadlock');
} }
} }

View File

@@ -44,13 +44,21 @@ function validate_ip($ip, $return_bool = false, $lng = 'invalidip') {
/** /**
* Checks whether it is a valid ip * Checks whether it is a valid ip
* *
* @return mixed ip address on success, false on failure * @param string $ip ip-address to check
* @param bool $return_bool whether to return bool or call standard_error()
* @param string $lng index for error-message (if $return_bool is false)
* @param bool $allow_localhost whether to allow 127.0.0.1
* @param bool $allow_priv whether to allow private network addresses
*
* @return string|bool ip address on success, false on failure
*/ */
function validate_ip2($ip, $return_bool = false, $lng = 'invalidip', $allow_localhost = false) { function validate_ip2($ip, $return_bool = false, $lng = 'invalidip', $allow_localhost = false, $allow_priv = false) {
$filter_lan = $allow_priv ? FILTER_FLAG_NO_RES_RANGE : (FILTER_FLAG_NO_RES_RANGE | FILTER_FLAG_NO_PRIV_RANGE);
if ((filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6) if ((filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)
|| filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV4)) || filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV4))
&& filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_NO_RES_RANGE | FILTER_FLAG_NO_PRIV_RANGE) && filter_var($ip, FILTER_VALIDATE_IP, $filter_lan)
) { ) {
return $ip; return $ip;
} }

View File

@@ -51,6 +51,6 @@ define('TABLE_PANEL_DOMAIN_SSL_SETTINGS', 'domain_ssl_settings');
define('TABLE_DOMAINTOIP', 'panel_domaintoip'); define('TABLE_DOMAINTOIP', 'panel_domaintoip');
// VERSION INFO // VERSION INFO
$version = '0.9.33-rc3'; $version = '0.9.33.1';
$dbversion = '2'; $dbversion = '2';
$branding = ''; $branding = '';

View File

@@ -1741,7 +1741,7 @@ $lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'FastCGI IPC dire
$lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'The directory where the php-fpm sockets will be stored by the webserver.<br />This directory has to be readable for the webserver'; $lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'The directory where the php-fpm sockets will be stored by the webserver.<br />This directory has to be readable for the webserver';
$lng['panel']['news'] = 'News'; $lng['panel']['news'] = 'News';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using the SSL redirect is only possible when the domain has at least one ssl-enabled IP/port combination assigned.'; $lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using the SSL redirect is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
$lng['error']['fcgidstillenableddeadlock'] = 'FCGID is currently active.<br />Please deactivate it before switching to another webserver than Apache2'; $lng['error']['fcgidstillenableddeadlock'] = 'FCGID is currently active.<br />Please deactivate it before switching to another webserver than Apache2 or lighttpd';
$lng['error']['send_report_title'] = 'Send error report'; $lng['error']['send_report_title'] = 'Send error report';
$lng['error']['send_report_desc'] = 'Thank you for reporting this error and helping us to froxlor improve froxlor.<br />This is the email which will be sent to the froxlor developer team:'; $lng['error']['send_report_desc'] = 'Thank you for reporting this error and helping us to froxlor improve froxlor.<br />This is the email which will be sent to the froxlor developer team:';
$lng['error']['send_report'] = 'Send report'; $lng['error']['send_report'] = 'Send report';

View File

@@ -1468,7 +1468,7 @@ $lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'FastCGI IPC Verz
$lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'In dieses Verzeichnis werden die php-fpm Sockets vom Webserver abgelegt.<br />Das Verzeichnis muss für den Webserver lesbar sein.'; $lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'In dieses Verzeichnis werden die php-fpm Sockets vom Webserver abgelegt.<br />Das Verzeichnis muss für den Webserver lesbar sein.';
$lng['panel']['news'] = 'Neuigkeiten'; $lng['panel']['news'] = 'Neuigkeiten';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Eine SSL-Weiterleitung ist nur möglich, wenn der Domain mindestens eine IP/Port Kombination zugewiesen wurde, bei der SSL aktiviert ist.'; $lng['error']['sslredirectonlypossiblewithsslipport'] = 'Eine SSL-Weiterleitung ist nur möglich, wenn der Domain mindestens eine IP/Port Kombination zugewiesen wurde, bei der SSL aktiviert ist.';
$lng['error']['fcgidstillenableddeadlock'] = 'FCGID ist derzeit aktiviert.<br />Bitte deaktiviere es, um einen anderen Webserver als Apache2 auswählen zu können.'; $lng['error']['fcgidstillenableddeadlock'] = 'FCGID ist derzeit aktiviert.<br />Bitte deaktiviere es, um einen anderen Webserver als Apache2 oder lighttpd auswählen zu können.';
$lng['error']['send_report_title'] = 'Fehler melden'; $lng['error']['send_report_title'] = 'Fehler melden';
$lng['error']['send_report_desc'] = 'Danke, dass Sie uns diesen Fehler melden und damit helfen Froxlor zu verbessern.<br />Folgender Bericht wird per Mail an das Froxlor Entwickler Team gesendet.'; $lng['error']['send_report_desc'] = 'Danke, dass Sie uns diesen Fehler melden und damit helfen Froxlor zu verbessern.<br />Folgender Bericht wird per Mail an das Froxlor Entwickler Team gesendet.';
$lng['error']['send_report'] = 'Fehlerbericht senden'; $lng['error']['send_report'] = 'Fehlerbericht senden';

View File

@@ -21,8 +21,7 @@
/** /**
* Global * Global
*/ */
$lng['translator'] = 'Luca Longinotti, Luca Piona, Emilien, Christian Munari';
$lng['translator'] = 'Luca Longinotti, Luca Piona, Emilien';
$lng['panel']['edit'] = 'Modifica'; $lng['panel']['edit'] = 'Modifica';
$lng['panel']['delete'] = 'Cancella'; $lng['panel']['delete'] = 'Cancella';
$lng['panel']['create'] = 'Crea'; $lng['panel']['create'] = 'Crea';
@@ -34,7 +33,6 @@ $lng['panel']['emptyfordefault'] = 'lasciare vuoto per l\'impostazione di defaul
$lng['panel']['path'] = 'Percorso'; $lng['panel']['path'] = 'Percorso';
$lng['panel']['toggle'] = 'Cambia'; $lng['panel']['toggle'] = 'Cambia';
$lng['panel']['next'] = 'Prossimo'; $lng['panel']['next'] = 'Prossimo';
// $lng['panel']['dirsmissing'] = 'Impossibile trovare o leggere la directory!';
$lng['panel']['dirsmissing'] = 'La cartella fornita non è stata trovata.'; $lng['panel']['dirsmissing'] = 'La cartella fornita non è stata trovata.';
/** /**
@@ -667,7 +665,7 @@ $lng['serversettings']['ticket']['noreply_name'] = 'Email del mittente del ticke
// ADDED IN 1.2.19-svn1 // ADDED IN 1.2.19-svn1
$lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Cartella della configurazione'; $lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Cartella della configurazione';
$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Dove vuoi che venga salvata la configurazione di fcgid? Se non ti sei compilato suexec da solo, di solito questo percorso è /var/www/'; $lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Dove vuoi che venga salvata la configurazione di fcgid? Se non ti sei compilato suexec da solo, di solito questo percorso è /var/www';
$lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Cartella Temp'; $lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Cartella Temp';
// ADDED IN 1.2.19-svn3 // ADDED IN 1.2.19-svn3
@@ -887,7 +885,7 @@ $lng['admin']['show_version_footer']['description'] = 'Mostra la versione di Fro
$lng['admin']['froxlor_graphic']['title'] = 'Intestazione grafica per Froxlor'; $lng['admin']['froxlor_graphic']['title'] = 'Intestazione grafica per Froxlor';
$lng['admin']['froxlor_graphic']['description'] = 'Quale grafica vuoi mostrare nell\'intestazione?'; $lng['admin']['froxlor_graphic']['description'] = 'Quale grafica vuoi mostrare nell\'intestazione?';
//improved froxlor // improved froxlor
$lng['menue']['phpsettings']['maintitle'] = 'Configurazioni PHP'; $lng['menue']['phpsettings']['maintitle'] = 'Configurazioni PHP';
$lng['admin']['phpsettings']['title'] = 'Configurazione PHP'; $lng['admin']['phpsettings']['title'] = 'Configurazione PHP';
@@ -927,7 +925,7 @@ $lng['serversettings']['mod_fcgid']['tmpdir']['description'] = 'Dove va salvata
$lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Cartella globale di PEAR'; $lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Cartella globale di PEAR';
$lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Quali sono le cartelle globali di PEAR che dovrebbero essere sostituite in ogni configurazione php.ini? Più cartelle devono essere separate da : (due punti).'; $lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Quali sono le cartelle globali di PEAR che dovrebbero essere sostituite in ogni configurazione php.ini? Più cartelle devono essere separate da : (due punti).';
//improved Froxlor 2 // improved Froxlor 2
$lng['admin']['templates']['index_html'] = 'file index per le nuove cartelle create dai clienti'; $lng['admin']['templates']['index_html'] = 'file index per le nuove cartelle create dai clienti';
$lng['admin']['templates']['SERVERNAME'] = 'Sostituito con il nomeserver.'; $lng['admin']['templates']['SERVERNAME'] = 'Sostituito con il nomeserver.';
@@ -1245,6 +1243,7 @@ $lng['question']['customer_reallyunlock'] = 'Sei sicuro di voler sbloccare il cl
// ADDED IN FROXLOR 0.9.15-svn1 // ADDED IN FROXLOR 0.9.15-svn1
$lng['serversettings']['perl_server']['title'] = 'Localizzazione del server Perl'; $lng['serversettings']['perl_server']['title'] = 'Localizzazione del server Perl';
$lng['serversettings']['perl_server']['description'] = 'Di default è impostato per utilizzare la guida disponibile sul sito: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>'; $lng['serversettings']['perl_server']['description'] = 'Di default è impostato per utilizzare la guida disponibile sul sito: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
$lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend'; $lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
$lng['serversettings']['nginx_php_backend']['description'] = 'questo è dove in ascolto il processo PHP per le richieste da nginx, può essere un socket unix combinazione IP:Porta'; $lng['serversettings']['nginx_php_backend']['description'] = 'questo è dove in ascolto il processo PHP per le richieste da nginx, può essere un socket unix combinazione IP:Porta';
$lng['serversettings']['phpreload_command']['title'] = 'Comando riavvio PHP'; $lng['serversettings']['phpreload_command']['title'] = 'Comando riavvio PHP';
@@ -1332,3 +1331,482 @@ $lng['traffic']['months']['total'] = 'Totale';
$lng['traffic']['details'] = 'Dettagli'; $lng['traffic']['details'] = 'Dettagli';
$lng['menue']['traffic']['table'] = 'Traffico'; $lng['menue']['traffic']['table'] = 'Traffico';
$lng['error']['loginnameiswrong2'] = 'Il nome utente contiente troppi caratteri. Sono permessi soltanto %s caratteri.';
$lng['error']['ticketnotaccessible'] = 'Non puoi accedere a questo ticket.';
$lng['question']['admin_customer_alsoremovemail'] = 'Eliminare completamente i dati della posta elettronica dal filesystem??';
$lng['question']['admin_customer_alsoremoveftphomedir'] = 'Rimuovere anche la cartella homedir dell\'utente FTP?';
$lng['admin']['templates']['SALUTATION'] = 'Sostituito con un saluto corretto (nome o azienda)';
$$lng['admin']['templates']['COMPANY'] = 'Sostituisce con il nome dell \'azienda del cliente';
$lng['serversettings']['bindenable']['title'] = 'Abilita Nameserver';
$lng['serversettings']['bindenable']['description'] = 'Qui il Nameserver può essere abilitato e disabilitato globalmente.';
$lng['admin']['serversoftware'] = 'Software per Server';
$lng['panel']['pathDescriptionEx'] = '<br /><br />Se vuoi redirezionare ad un altro dominio, questo valore deve iniziare con http:// or https://.';
$lng['panel']['pathDescriptionSubdomain'] = $lng['panel']['pathDescription'] . $lng['panel']['pathDescriptionEx'] . "<br /><br />Se la URL termina con / è considerata una cartella, altrimenti verrà trattata come un file.";
$lng['admin']['configfiles']['wizard'] = 'Wizard (assistente)';
$lng['admin']['configfiles']['http'] = 'Server WEB (HTTP)';
$lng['admin']['configfiles']['dns'] = 'Nameserver (DNS)';
$lng['admin']['configfiles']['mail'] = 'Server di posta elettronica (IMAP/POP3)';
$lng['admin']['configfiles']['smtp'] = 'Server di posta elettronica (SMTP)';
$lng['admin']['configfiles']['ftp'] = 'Server FTP';
$lng['serversettings']['mysql_access_host']['title'] = 'Hosts Accesso MySQL';
$lng['serversettings']['webalizer_quiet']['title'] = 'Webalizer output';
$lng['serversettings']['ssl']['use_ssl']['title'] = 'Abilita utilizzo SSL';
$lng['serversettings']['ssl']['use_ssl']['description'] = 'Spunta questo se vuoi usare SSL per il tuo server web';
$lng['serversettings']['ssl']['ssl_cert_file']['title'] = 'Percorso al certificato SSL';
$lng['serversettings']['ssl']['ssl_cert_file']['description'] = 'Specifica il percorso includendo il nome del file .crt o .pem (certificato principale)';
$lng['serversettings']['default_vhostconf_domain']['description'] = 'Il contenuto di questo campo verrà incluso direttamente nella configurazione del contenitore del dominio vHost. ATTENZIONE: Non verrano verificati eventuali errori del codice contenuto. Se conterrà degli errori, vi è il rischio che il server WEB non si avvii più!';
$lng['dns']['standardip'] = 'IP predefinito del server';
$lng['dns']['cname_record'] = 'Record CNAME';
$lng['dns']['standardmx'] = 'Record MX predefinito del server';
$lng['dns']['mxconfig'] = 'Record MX personalizzati';
$lng['dns']['priority10'] = 'Priorità 10';
$lng['dns']['priority20'] = 'Priorità 20';
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Percorso al file di chiave SSL';
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specifica il percorso includendo il nome del file per la chiave privata (abitualmente.key)';
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Percorso al certificato della CA (autoritá certificatrice) SSL (opzionale)';
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Autenticazione client, da settare soltanto se desiderato.';
$lng['cronjob']['cronjobintervalv'] = 'valore di intervallo Runtime';
$lng['admin']['store_defaultindex'] = 'Archivio del file indice predefinito al percorso radice clienti';
$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Percorso al file catena dei certificati SSL';
$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Principalmente Bundle CA, o similare, presubilmente vuoi impostare questo se hai acquistato un certificato SSL.';
$lng['serversettings']['phpfpm']['title'] = 'Abilita php-fpm';
$lng['serversettings']['phpfpm']['description'] = '<b>Questa impostazione richiede una configurazione speciale del server web. Vedi il manuale FPM per <a target="blank" href="http://redmine.froxlor.org/projects/froxlor/wiki/HandbookApache2_phpfpm">Apache2</a> o <a target="blank" href="http://redmine.froxlor.org/projects/froxlor/wiki/HandbookNginx_phpfpm">nginx</a></b>';
$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configurazione cartella Alias per php-fpm';
$lng['gender']['title'] = 'Titolo';
$lng['gender']['male'] = 'Sig.';
$lng['gender']['female'] = 'Sig.ra';
$lng['gender']['undef'] = '';
$lng['country']['AF'] = "Afganistan";
$lng['country']['AX'] = "Isole Aland";
$lng['country']['AL'] = "Albania";
$lng['country']['DZ'] = "Algeria";
$lng['country']['AS'] = "American Samoa";
$lng['country']['AD'] = "Andorra";
$lng['country']['AO'] = "Angola";
$lng['country']['AI'] = "Anguilla";
$lng['country']['AQ'] = "Antarctica";
$lng['country']['AG'] = "Antigua and Barbuda";
$lng['country']['AR'] = "Argentina";
$lng['country']['AM'] = "Armenia";
$lng['country']['AW'] = "Aruba";
$lng['country']['AU'] = "Australia";
$lng['country']['AT'] = "Austria";
$lng['country']['AZ'] = "Azerbaijan";
$lng['country']['BS'] = "Bahamas";
$lng['country']['BH'] = "Bahrain";
$lng['country']['BD'] = "Bangladesh";
$lng['country']['BB'] = "Barbados";
$lng['country']['BY'] = "Belarus";
$lng['country']['BE'] = "Belgium";
$lng['country']['BZ'] = "Belize";
$lng['country']['BJ'] = "Benin";
$lng['country']['BM'] = "Bermuda";
$lng['country']['BT'] = "Bhutan";
$lng['country']['BO'] = "Bolivia, Stato Plurinazionale della";
$lng['country']['BQ'] = "Bonaire, Saint Eustatius e Saba";
$lng['country']['BA'] = "Bosnia e Herzegovina";
$lng['country']['BW'] = "Botswana";
$lng['country']['BV'] = "Bouvet Island";
$lng['country']['BR'] = "Brasile";
$lng['country']['IO'] = "Territorio Britannico del oceano indiano";
$lng['country']['BN'] = "Brunei Darussalam";
$lng['country']['BG'] = "Bulgaria";
$lng['country']['BF'] = "Burkina Faso";
$lng['country']['BI'] = "Burundi";
$lng['country']['KH'] = "Cambogia";
$lng['country']['CM'] = "Camerun";
$lng['country']['CA'] = "Canada";
$lng['country']['CV'] = "Capo Verde";
$lng['country']['KY'] = "Isole Cayman";
$lng['country']['CF'] = "Repubblica dell'Africa Centrale";
$lng['country']['TD'] = "Chad";
$lng['country']['CL'] = "Chile";
$lng['country']['CN'] = "Cina";
$lng['country']['CX'] = "Isola di Natale";
$lng['country']['CC'] = "Isole Cocos (Keeling)";
$lng['country']['CO'] = "Colombia";
$lng['country']['KM'] = "Comoros";
$lng['country']['CG'] = "Congo";
$lng['country']['CD'] = "Congo, Repubblica democratica del";
$lng['country']['CK'] = "Isole Cook";
$lng['country']['CR'] = "Costa Rica";
$lng['country']['CI'] = "Costa D'avorio";
$lng['country']['HR'] = "Croazia";
$lng['country']['CU'] = "Cuba";
$lng['country']['CW'] = "Curacao";
$lng['country']['CY'] = "Cipro";
$lng['country']['CZ'] = "Repubblica Ceca";
$lng['country']['DK'] = "Danimarca";
$lng['country']['DJ'] = "Djibouti";
$lng['country']['DM'] = "Dominica";
$lng['country']['DO'] = "Repubblica Dominicana";
$lng['country']['EC'] = "Ecuador";
$lng['country']['EG'] = "Egitto";
$lng['country']['SV'] = "El Salvador";
$lng['country']['GQ'] = "Guinea Equatoriale";
$lng['country']['ER'] = "Eritrea";
$lng['country']['EE'] = "Estonia";
$lng['country']['ET'] = "Etiopia";
$lng['country']['FK'] = "Isole Falkland (Malvinas)";
$lng['country']['FO'] = "Isole Faroe";
$lng['country']['FJ'] = "Fiji";
$lng['country']['FI'] = "Finlandia";
$lng['country']['FR'] = "Francia";
$lng['country']['GF'] = "Guiana Francese";
$lng['country']['PF'] = "Polinesia Francese";
$lng['country']['TF'] = "Territori Francesi del Sud";
$lng['country']['GA'] = "Gabon";
$lng['country']['GM'] = "Gambia";
$lng['country']['GE'] = "Georgia";
$lng['country']['DE'] = "Germania";
$lng['country']['GH'] = "Ghana";
$lng['country']['GI'] = "Gibilterra";
$lng['country']['GR'] = "Grecia";
$lng['country']['GL'] = "Groenlandia";
$lng['country']['GD'] = "Grenada";
$lng['country']['GP'] = "Guadeloupe";
$lng['country']['GU'] = "Guam";
$lng['country']['GT'] = "Guatemala";
$lng['country']['GG'] = "Guernsey";
$lng['country']['GN'] = "Guinea";
$lng['country']['GW'] = "Guinea-Bissau";
$lng['country']['GY'] = "Guyana";
$lng['country']['HT'] = "Haiti";
$lng['country']['HM'] = "Isola Heard e Isola McDonald";
$lng['country']['VA'] = "Stato del Vaticano";
$lng['country']['HN'] = "Honduras";
$lng['country']['HK'] = "Hong Kong";
$lng['country']['HU'] = "Ungheria";
$lng['country']['IS'] = "Islanda";
$lng['country']['IN'] = "India";
$lng['country']['ID'] = "Indonesia";
$lng['country']['IR'] = "Iran, Repubblica Islamica del";
$lng['country']['IQ'] = "Iraq";
$lng['country']['IE'] = "Irlanda";
$lng['country']['IM'] = "Isola Man";
$lng['country']['IL'] = "Israele";
$lng['country']['IT'] = "ITALIA";
$lng['country']['JM'] = "Giamaica";
$lng['country']['JP'] = "Giappone";
$lng['country']['JE'] = "Jersey";
$lng['country']['JO'] = "Giordania";
$lng['country']['KZ'] = "Kazakistan";
$lng['country']['KE'] = "Kenya";
$lng['country']['KI'] = "Kiribati";
$lng['country']['KP'] = "Corea, Repubblica popolare della";
$lng['country']['KR'] = "Corea, Repubblica della";
$lng['country']['KW'] = "Kuwait";
$lng['country']['KG'] = "Kyrgyzstan";
$lng['country']['LA'] = "Lao, Repubblica popolare del";
$lng['country']['LV'] = "Lettonia";
$lng['country']['LB'] = "Libano";
$lng['country']['LS'] = "Lesotho";
$lng['country']['LR'] = "Liberia";
$lng['country']['LY'] = "Libia";
$lng['country']['LI'] = "Liechtenstein";
$lng['country']['LT'] = "Lituania";
$lng['country']['LU'] = "Lussemburgo";
$lng['country']['MO'] = "Macao";
$lng['country']['MK'] = "Macedonia";
$lng['country']['MG'] = "Madagascar";
$lng['country']['MW'] = "Malawi";
$lng['country']['MY'] = "Malesia";
$lng['country']['MV'] = "Maldive";
$lng['country']['ML'] = "Mali";
$lng['country']['MT'] = "Malta";
$lng['country']['MH'] = "Isole Marshall";
$lng['country']['MQ'] = "Martinique";
$lng['country']['MR'] = "Mauritania";
$lng['country']['MU'] = "Mauritius";
$lng['country']['YT'] = "Mayotte";
$lng['country']['MX'] = "Messico";
$lng['country']['FM'] = "Micronesia, Stati Federali del";
$lng['country']['MD'] = "Moldavia";
$lng['country']['MC'] = "Monaco";
$lng['country']['MN'] = "Mongolia";
$lng['country']['ME'] = "Montenegro";
$lng['country']['MS'] = "Montserrat";
$lng['country']['MA'] = "Marocco";
$lng['country']['MZ'] = "Mozambico";
$lng['country']['MM'] = "Myanmar";
$lng['country']['NA'] = "Namibia";
$lng['country']['NR'] = "Nauru";
$lng['country']['NP'] = "Nepal";
$lng['country']['NL'] = "Olanda";
$lng['country']['NC'] = "Nuova Caledonia";
$lng['country']['NZ'] = "Nuova Zelanda";
$lng['country']['NI'] = "Nicaragua";
$lng['country']['NE'] = "Niger";
$lng['country']['NG'] = "Nigeria";
$lng['country']['NU'] = "Niue";
$lng['country']['NF'] = "Isole Norfolk";
$lng['country']['MP'] = "Isole Mariana Settentrionali";
$lng['country']['NO'] = "Norvegia";
$lng['country']['OM'] = "Oman";
$lng['country']['PK'] = "Pakistan";
$lng['country']['PW'] = "Palau";
$lng['country']['PS'] = "Territorio Occupato della Palestina";
$lng['country']['PA'] = "Panama";
$lng['country']['PG'] = "Papua Nuova Guinea";
$lng['country']['PY'] = "Paraguay";
$lng['country']['PE'] = "Peru";
$lng['country']['PH'] = "Filippine";
$lng['country']['PN'] = "Pitcairn";
$lng['country']['PL'] = "Polonia";
$lng['country']['PT'] = "Portogallo";
$lng['country']['PR'] = "Porto Rico";
$lng['country']['QA'] = "Qatar";
$lng['country']['RE'] = "Reunion";
$lng['country']['RO'] = "Romania";
$lng['country']['RU'] = "Russia";
$lng['country']['RW'] = "Ruanda";
$lng['country']['BL'] = "Saint Barthelemy";
$lng['country']['SH'] = "Saint Helena, Ascension and Tristan Da Cunha";
$lng['country']['KN'] = "Saint Kitts and Nevis";
$lng['country']['LC'] = "Saint Lucia";
$lng['country']['MF'] = "Saint Martin (French Part)";
$lng['country']['PM'] = "Saint Pierre and Miquelon";
$lng['country']['VC'] = "Saint Vincent and the Grenadines";
$lng['country']['WS'] = "Samoa";
$lng['country']['SM'] = "San Marino";
$lng['country']['ST'] = "Sao Tome and Principe";
$lng['country']['SA'] = "Arabia Saudita";
$lng['country']['SN'] = "Senegal";
$lng['country']['RS'] = "Serbia";
$lng['country']['SC'] = "Seychelles";
$lng['country']['SL'] = "Sierra Leone";
$lng['country']['SG'] = "Singapore";
$lng['country']['SX'] = "Sint Maarten (Dutch Part)";
$lng['country']['SK'] = "Slovacchia";
$lng['country']['SI'] = "Slovenia";
$lng['country']['SB'] = "Isole Solomon";
$lng['country']['SO'] = "Somalia";
$lng['country']['ZA'] = "Africa del Sud";
$lng['country']['GS'] = "South Georgia and the South Sandwich Islands";
$lng['country']['ES'] = "Spagna";
$lng['country']['LK'] = "Sri Lanka";
$lng['country']['SD'] = "Sudan";
$lng['country']['SR'] = "Suriname";
$lng['country']['SJ'] = "Svalbard and Jan Mayen";
$lng['country']['SZ'] = "Swaziland";
$lng['country']['SE'] = "Svezia";
$lng['country']['CH'] = "Svizzera";
$lng['country']['SY'] = "Siria";
$lng['country']['TW'] = "Taiwan, Provincia della Cina";
$lng['country']['TJ'] = "Tajikistan";
$lng['country']['TZ'] = "Tanzania";
$lng['country']['TH'] = "Tailandia";
$lng['country']['TL'] = "Timor-Leste";
$lng['country']['TG'] = "Togo";
$lng['country']['TK'] = "Tokelau";
$lng['country']['TO'] = "Tonga";
$lng['country']['TT'] = "Trinidad and Tobago";
$lng['country']['TN'] = "Tunisia";
$lng['country']['TR'] = "Turchia";
$lng['country']['TM'] = "Turkmenistan";
$lng['country']['TC'] = "Turks and Caicos Islands";
$lng['country']['TV'] = "Tuvalu";
$lng['country']['UG'] = "Uganda";
$lng['country']['UA'] = "Ucraina";
$lng['country']['AE'] = "Emirati Arabi Uniti";
$lng['country']['GB'] = "Gran Bretagna";
$lng['country']['US'] = "Stati Uniti d'America";
$lng['country']['UM'] = "Stati Uniti, Isole Minori";
$lng['country']['UY'] = "Uruguay";
$lng['country']['UZ'] = "Uzbekistan";
$lng['country']['VU'] = "Vanuatu";
$lng['country']['VE'] = "Venezuela";
$lng['country']['VN'] = "Vietnam";
$lng['country']['VG'] = "Isole Vergini Brittaniche";
$lng['country']['VI'] = "Isole Vergini, U.S.";
$lng['country']['WF'] = "Wallis and Futuna";
$lng['country']['EH'] = "Sahara Occidentale";
$lng['country']['YE'] = "Yemen";
$lng['country']['ZM'] = "Zambia";
$lng['country']['ZW'] = "Zimbabue";
$lng['diskquota'] = 'Quota';
$lng['serversettings']['diskquota_enabled'] = 'Quota attivita?';
$lng['serversettings']['diskquota_repquota_path']['description'] = 'Percorso a repquota';
$lng['serversettings']['diskquota_quotatool_path']['description'] = 'Percorso al quotatool';
$lng['serversettings']['diskquota_customer_partition']['description'] = 'Partizione, sulla quale sono salvati i dati dei clienti';
$lng['tasks']['diskspace_set_quota'] = 'Setta quota al filesystem';
$lng['error']['session_timeout'] = 'Valore troppo basso';
$lng['error']['session_timeout_desc'] = 'Non dovresti settare il timeout della sessione ad un valore minore di 1 minuto.';
$lng['admin']['assignedmax'] = 'Assegnato / Max';
$lng['admin']['usedmax'] = 'Usato / Max';
$lng['admin']['used'] = 'Usato';
$lng['mysql']['size'] = 'Dimensione';
$lng['error']['invalidhostname'] = 'Il nome del Host non può essere vuoto o contenere spazi';
$lng['traffic']['http'] = 'HTTP (MiB)';
$lng['traffic']['ftp'] = 'FTP (MiB)';
$lng['traffic']['mail'] = 'Mail (MiB)';
$lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Timeout Inattività';
$lng['serversettings']['mod_fcgid']['idle_timeout']['description'] = 'Impostazione Timeout per il Mod FastCGI.';
$lng['serversettings']['phpfpm_settings']['idle_timeout']['title'] = 'Timeout Inattività';
$lng['serversettings']['phpfpm_settings']['idle_timeout']['description'] = 'Impostazione Timeout per PHP5 FPM FastCGI.';
$lng['panel']['cancel'] = 'Annulla';
$lng['admin']['delete_statistics'] = 'Elimina Statistiche';
$lng['admin']['speciallogwarning'] = 'AVVISO: Cambiando questa impostazione perderai tutte le vecchie statistiche per questo dominio. Se sei sicuro che vuoi cambiare questo digita "%s" nel campo sottostante e clicca il bottone "elimina".<br /><br />';
$lng['serversettings']['vmail_maildirname']['title'] = 'nome Maildir';
$lng['serversettings']['vmail_maildirname']['description'] = 'cartella Maildir nell account utente. Normalmente \'Maildir\', in alcune implementazioni \'.maildir\', e direttamente nella cartella utente se lasciato vuoto.';
$lng['tasks']['remove_emailacc_files'] = 'Elimina i dati di posta elettronica del cliente.';
$lng['error']['operationnotpermitted'] = 'Operazione non permessa!';
$lng['error']['featureisdisabled'] = 'Funzionalità %s è disabilitata. Perfavore contatta il tuo fornitore di servizi.';
$lng['serversettings']['catchall_enabled']['title'] = 'Usa Catchall';
$lng['serversettings']['catchall_enabled']['description'] = 'Vuoi offrire ai tuoi clienti la funzionalità di catchall?';
$lng['serversettings']['apache_24']['title'] = 'Usa impostazioni per Apache 2.4';
$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENZIONE:</strong> spunta soltanto se hai installato la versione 2.4 o superiore di Apache<br />altrimenti il tuo server Web non si avvierà';
$lng['admin']['tickets_see_all'] = 'Può vedere tutte le categorie di ticket?';
$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Percorso al file fastcgi_params';
$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specifica il percorso al file fastcgi_params di nginx includendo il nome del file';
$lng['serversettings']['documentroot_use_default_value']['title'] = 'Usa il nome del dominio come valore predefinito per il percorso DocumentRoot (radice dei documenti)';
$lng['serversettings']['documentroot_use_default_value']['description'] = 'Se abilitato ed il percorso radice DocumentRoot è vuoto, il valore predefinito sarà il nome del (sotto)dominio.<br /><br />Esempio: <br />/var/customers/nome_cliente/example.com/<br />/var/customers/nome_cliente/sottodominio.example.com/';
$lng['error']['usercurrentlydeactivated'] = 'L\'utente %s è attualmente disabilitato';
$lng['admin']['speciallogfile']['title'] = 'File file log seperato';
$lng['admin']['speciallogfile']['description'] = 'Spunta qui per un log di accesso separato per questo dominio';
$lng['error']['setlessthanalreadyused'] = 'Non puoi impostare dei limiti minori per \'%s\', di quanto questo utente abbia già utilizzato<br />';
$lng['error']['stringmustntbeempty'] = 'Il valore per il campo %s non può essere vuoto';
$lng['admin']['domain_editable']['title'] = 'Permetti la modifica del dominio';
$lng['admin']['domain_editable']['desc'] = 'Se settato a si, il cliente è abilitato a modificare varie impostazioni del dominio.<br />Se settato su no, il cliente non può modificare nulla.';
$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['title'] = 'Nascondi i sottodominii predefiniti nel riepilogo di configurazione PHP';
$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['description'] = 'Se attivato i sottodomini predefiniti dei clienti non saranno visualizzati nel riepilogo della configurazione php<br /><br />Nota: Questo è solo visibile se avete abilitato FCGID o PHP-FPM';
$lng['serversettings']['passwordcryptfunc']['title'] = 'Scegli quale metodo crittografico deve essere usato per le password';
$lng['serversettings']['systemdefault'] = 'Predefinito di sistema';
$lng['serversettings']['panel_allow_theme_change_admin'] = 'Permetti agli amministratori di cambiare il tema';
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Permetti ai clienti di cambiare il tema';
$lng['serversettings']['axfrservers']['title'] = 'Server AXFR';
$lng['serversettings']['axfrservers']['description'] = 'Un elenco separato da virgole di indirizzi IP autorizzati a trasferire zone dns (AXFR).';
$lng['panel']['ssleditor'] = 'Impostazioni SSL per questo dominio';
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Incolla il contenuto completo del tuo certificato nella casella di testo';
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Contenuto del certificato ssl';
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Contenuto del file di chiave (privata) ssl';
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Contenuto del file ssl CA di autorità di certificazione (opzionale)';
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Autenticazione client, imposta questo settaggio soltanto se sai di cosa si tratta.';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Contenuto del file di catena di certificato (opzionale)';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Abitualmente Bundle CA o similare, probabilmente vuoi impostare questo settaggio se hai acquistato un certificato SSL.';
$lng['error']['sslcertificateismissingprivatekey'] = 'Devi specificare una chiave privata per il tuo certificato';
$lng['error']['sslcertificatewrongdomain'] = 'Il certificato fornito non appartiene a questo dominio';
$lng['error']['sslcertificateinvalidcert'] = 'Il contenuto del certificato fornito non sembra essere un certificato valido';
$lng['error']['sslcertificateinvalidcertkeypair'] = 'La chiave privata fornita non sembra appartenere al certificato fornito';
$lng['error']['sslcertificateinvalidca'] = 'Il certificato CA fornito non sembra essere un certificato valido';
$lng['error']['sslcertificateinvalidchain'] = 'I dati della catena di certificato non sembrano essere un certificato valido';
$lng['serversettings']['customerssl_directory']['title'] = 'Cartella dei certificati ssl clienti del Webserver';
$lng['serversettings']['customerssl_directory']['description'] = 'Dove devono esssere creati i certificati ssl cliente?<br /><br /><div class="red">NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.</div>';
$lng['admin']['phpfpm.ininote'] = 'Non tutti i valori che potresti volere settare possono essere usati nella configurazione del pool php-fpm.';
$lng['crondesc']['cron_mailboxsize'] = 'Calcolo dimensioni caselle di posta';
$lng['domains']['ipandport_multi']['title'] = 'Indirizzi IP';
$lng['domains']['ipandport_multi']['description'] = 'Specifica uno o più indirizzi IP per il dominio.<br /><br /><div class="red">NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come <strong>alias-domain</strong> di un altro dominio.</div>';
$lng['domains']['ipandport_ssl_multi']['title'] = 'Indirizzi IP SSL';
$lng['domains']['ssl_redirect']['title'] = 'Reindirizzamento SSL';
$lng['domains']['ssl_redirect']['description'] = 'Questa opzione crea un reindirizzamento per vhosts non-sll in modo che tutte le richieste vengono reindirizzate ai SSL-vhost.<br /><br />praticamente una richiesta a <strong>http</strong>://dominio.tld/ ti reindirizzera a <strong>https</strong>://dominio.tld/';
$lng['admin']['phpinfo'] = 'PHPinfo()';
$lng['admin']['selectserveralias'] = 'valore ServerAlias per il dominio';
$lng['admin']['selectserveralias_desc'] = 'Scegli se froxlor deve creare un settaggio wildcard (*.dominio.tld), o un alias WWW (www.dominio.tld) o nessun alias';
$lng['domains']['serveraliasoption_wildcard'] = 'Wildcard (*.dominio.tld)';
$lng['domains']['serveraliasoption_www'] = 'WWW (www.dominio.tld)';
$lng['domains']['serveraliasoption_none'] = 'Nessun alias';
$lng['error']['givendirnotallowed'] = 'La cartella fornita nel campo %s non è permessa.';
$lng['serversettings']['ssl']['ssl_cipher_list']['title'] = 'Configura le cifrature SSL permesse';
$lng['serversettings']['ssl']['ssl_cipher_list']['description'] = 'Questa è una lista di cifrature che vuoi (o non vuoi) usare nelle communicazioni SSL. Per una lista delle cifrature e come includerle od escluderle, vedi le sezioni "CIPHER LIST FORMAT" e "CIPHER STRINGS" sulla <a href="http://openssl.org/docs/apps/ciphers.html">man-page per le cifrature</a>.<br /><br /><b>Il valore predefinito è:</b><pre>ECDHE-RSA-AES128-SHA256:AES128-GCM-SHA256:RC4:HIGH:!MD5:!aNULL:!EDH</pre>';
$lng['panel']['dashboard'] = 'Cruscotto';
$lng['panel']['assigned'] = 'Assegnato';
$lng['panel']['available'] = 'Disponibile';
$lng['customer']['services'] = 'Servizi';
$lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'Cartella FastCGI IPC';
$lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'La cartella nella quale verrano salvati i socket php-fpm dal server web.<br />Questa cartella deve essere leggibile dal server Web';
$lng['panel']['news'] = 'Notizie';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'L\'utilizzo del reindirizzamento SSL è possibile soltanto quando il dominio ha almeno una combinazione IP/porta assegnata ed abilitata SSL.';
$lng['error']['fcgidstillenableddeadlock'] = 'FCGID è attualmente attivo.<br />Perfavore disattivalo prima di cambiare ad un server web diverso da Apache2';
$lng['error']['send_report_title'] = 'Invia rapporto errori';
$lng['error']['send_report_desc'] = 'Grazie per aver communicato questo errore, aiutandoci a migliorare froxlor.<br />Questa è la mail che verrà inviata agli svillupatori di froxlor:';
$lng['error']['send_report'] = 'Invia rapporto';
$lng['error']['send_report_error'] = 'Errore nell invio del rapporto: <br />%s';
$lng['error']['notallowedtouseaccounts'] = 'Il tuo account non permette l\'utilizzo di IMAP/POP3. Non puoi aggiungere account di posta elettronica.';
$lng['pwdreminder']['changed'] = 'La tua password è stata aggiornata con successo. Puoi accedere con le tue nuove credenziali.';
$lng['pwdreminder']['wrongcode'] = 'Ci dispiace, il tuo codice di attivazione non esiste o è già scaduto.';
$lng['admin']['templates']['LINK'] = 'Sostituito con il link di azzeramento password cliente.';
$lng['pwdreminder']['choosenew'] = 'Setta la nuova password';
$lng['serversettings']['allow_error_report_admin']['title'] = 'Permetti agli amministratori/rivenditori di inviare errori di database a Froxlor';
$lng['serversettings']['allow_error_report_admin']['description'] = 'Attenzione: Non inviarci MAI dati personali (dei clienti)!';
$lng['serversettings']['allow_error_report_customer']['title'] = 'Permetti ai clienti di inviare errori di database a Froxlor';
$lng['serversettings']['allow_error_report_customer']['description'] = 'Attenzione: Non inviarci MAI dati personali (dei clienti)!';
$lng['admin']['phpsettings']['enable_slowlog'] = 'Abilita slowlog (per dominio)';
$lng['admin']['phpsettings']['request_terminate_timeout'] = 'Richiedi terminate-timeout';
$lng['admin']['phpsettings']['request_slowlog_timeout'] = 'Richiedi slowlog-timeout';
$lng['admin']['templates']['SERVER_HOSTNAME'] = 'Sostituisce il nome host del sistema (URL a froxlor)';
$lng['admin']['templates']['SERVER_IP'] = 'Sostituisce l\'indrizzo IP predefinito del server';
$lng['admin']['templates']['SERVER_PORT'] = 'Sostituisce la porta predefinita del server';
$lng['admin']['templates']['DOMAINNAME'] = 'Sostituisce il sottodominio predefinito dei clienti (può essere vuoto se non viene generato)';
$lng['admin']['show_news_feed'] = 'Mostra il feed notizie sul cruscotto dell \'amministratore';
$lng['logger']['reseller'] = "Rivenditore";
$lng['logger']['admin'] = "Amministratore";
$lng['logger']['cron'] = "Cronjob";
$lng['logger']['login'] = "Login";
$lng['logger']['intern'] = "Interno";
$lng['logger']['unknown'] = "Sconosciuto";
$lng['serversettings']['mailtraffic_enabled']['title'] = "Analizza traffico posta";
$lng['serversettings']['mailtraffic_enabled']['description'] = "Abilita l\'analisi dei log del server di posta per calcolare il traffico";
$lng['serversettings']['mdaserver']['title'] = "tipo MDA";
$lng['serversettings']['mdaserver']['description'] = "Tipo del Server di consegna di posta";
$lng['serversettings']['mdalog']['title'] = "log MDA";
$lng['serversettings']['mdalog']['description'] = "File log del Server di consegna di posta";
$lng['serversettings']['mtaserver']['title'] = "tipo MTA";
$lng['serversettings']['mtaserver']['description'] = "Tipo agente di trasferimento di posta";
$lng['serversettings']['mtalog']['title'] = "log MTA";
$lng['serversettings']['mtalog']['description'] = "File log dell\'agente di trasferimento di posta";
$lng['panel']['ftpdesc'] = 'Descrizione FTP';
$lng['admin']['cronsettings'] = 'Impostazioni Cronjob';
$lng['serversettings']['system_cronconfig']['title'] = 'File di configurazione Cron';
$lng['serversettings']['system_cronconfig']['description'] = 'Percorso al file di configurazione del servizio cron. Questo file verrà aggiornato regolarmente ed automaticamente da froxlor.<br />
Nota: Perfavore <b>sii sicuro</b> di usare lo stesso nome di file come per il cronjob principale di froxlor (predefinito: /etc/cron.d/froxlor)!<br><br>Se usi <b>FreeBSD</b>, qui specifica: <i>/etc/crontab</i>!';
$lng['tasks']['remove_ftpacc_files'] = 'Elimina i dati account-ftp del cliente.';
$lng['tasks']['regenerating_crond'] = 'Ricostruisci il file cron.d';
$lng['serversettings']['system_crondreload']['title'] = 'Commando per riavviare il servizio Cron';
$lng['serversettings']['system_crondreload']['description'] = 'Specifica il commando da eseguire per riavviare il servizio cron del tuo sistema';
$lng['admin']['integritycheck'] = 'Validazione Database';
$lng['admin']['integrityid'] = '#';
$lng['admin']['integrityname'] = 'Nome';
$lng['admin']['integrityresult'] = 'Risultato';
$lng['admin']['integrityfix'] = 'Risolvi problemi automaticamente';
$lng['question']['admin_integritycheck_reallyfix'] = 'Vuoi veramente provare a risolvere i problemi di integrità del database automaticamente?';
$lng['serversettings']['system_croncmdline']['title'] = 'Commando di esecuzione Cron (binario php)';
$lng['serversettings']['system_croncmdline']['description'] = 'Commando per eseguire i nostri cronjob. Modificalo soltanto se sai cosa stai facendo (predefinito: "/usr/bin/nice -n 5 /usr/bin/php5 -q")!';
$lng['error']['cannotdeletehostnamephpconfig'] = 'Questa configurazione PHP è utilizzata dal vhost Froxlor e non può essere eliminata.';
$lng['error']['cannotdeletedefaultphpconfig'] = 'Questa configurazione PHP è impostata come predefinita e non può essere eliminata.';
$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Permetti aggiornamenti automatici del database';
$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENZIONE:</b></div> Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.<br><br><div class="red">l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione</div>';
$lng['error']['passwordshouldnotbeusername'] = 'La password deve essere diversa dal nome utente.';
$lng['admin']['customer_show_news_feed'] = "Mostra feed di notizie personalizzati sul cruscotto dei clienti";
$lng['admin']['customer_news_feed_url'] = "Feed RSS- per il feed di notizie personalizzato";
$lng['serversettings']['dns_createhostnameentry'] = "Crea la zone/config di bind per il nome host del sistema";
$lng['serversettings']['panel_password_alpha_lower']['title'] = 'Caratteri minuscoli';
$lng['serversettings']['panel_password_alpha_lower']['description'] = 'La Password deve contenere almeno una lettera minuscola (a-z).';
$lng['serversettings']['panel_password_alpha_upper']['title'] = 'Caratteri maiuscoli';
$lng['serversettings']['panel_password_alpha_upper']['description'] = 'La Password deve contenere almeno una lettere maiuscola (A-Z).';
$lng['serversettings']['panel_password_numeric']['title'] = 'Numeri';
$lng['serversettings']['panel_password_numeric']['description'] = 'La Password deve contenere almeno un numero (0-9).';
$lng['serversettings']['panel_password_special_char_required']['title'] = 'Caratteri speciali';
$lng['serversettings']['panel_password_special_char_required']['description'] = 'La Password deve contenere almeno uno dei caratteri speciali definiti nel campo sottostante.';
$lng['serversettings']['panel_password_special_char']['title'] = 'Lista dei caratteri speciali';
$lng['serversettings']['panel_password_special_char']['description'] = 'Uno di questi caratteri è richiesto se è attivata l\'opzione soprastante.';
$lng['phpfpm']['use_mod_proxy']['title'] = 'Usa mod_proxy / mod_proxy_fcgi';
$lng['phpfpm']['use_mod_proxy']['description'] = 'Attiva l\'utilizzo di php-fpm attraverso mod_proxy_fcgi. Richiede almeno apache-2.4.9';
$lng['error']['no_phpinfo'] = 'Ci dispiace, impossibile leggere phpinfo()';
$lng['admin']['movetoadmin'] = 'Trasferisci cliente';
$lng['admin']['movecustomertoadmin'] = 'Trasferisci cliente all\'amministratore/rivenditore selezionato<br /><small>Lascia questo vuoto per nessuna modifica.<br />Se l\'amministratore desiderato non appare nella lista, il suo massimale di clienti e stato ragggiunto.</small>';
$lng['error']['moveofcustomerfailed'] = 'Trasferimento del cliente all\'amministratore/rivenditore selezionato fallito. Considera che tutte le altre modfiche al cliente sono state applicate con successo a questa fase.<br><br>Messaggio d\'errore: %s';
$lng['domains']['domain_import'] = 'Importa Dominii';
$lng['domains']['import_separator'] = 'Separatore';
$lng['domains']['import_offset'] = 'Offset';
$lng['domains']['import_file'] = 'File CSV';
$lng['success']['domain_import_successfully'] = 'Importato %s dominii con successo.';
$lng['error']['domain_import_error'] = 'Il seguente errore è occorsonell \'importazione di dominii: %s';
$lng['admin']['note'] = 'Nota';
$lng['domains']['import_description'] = 'Per ottenere informazioni dettagliate sulla struttura del file di importazione e su come importare con successo, visita <a href="http://redmine.froxlor.org/projects/froxlor/wiki/DomainBulkActionDoc" target="_blank">http://redmine.froxlor.org/projects/froxlor/wiki/DomainBulkActionDoc</a>';
$lng['usersettings']['custom_notes']['title'] = 'Note personali';
$lng['usersettings']['custom_notes']['description'] = 'Sentiti libero di inserire qualsi nota vuoi o necessiti qui. Apparirano nel riepilogo dell\'amministratore/cliente perl \'utente corrispondente.';
$lng['usersettings']['custom_notes']['show'] = 'Mostra le tue note nel cruscotto dell\'utente';
$lng['serversettings']['system_send_cron_errors']['title'] = 'Inviaa gli errori cron all \'amministratore di froxlor via e-mail';
$lng['serversettings']['system_send_cron_errors']['description'] = 'Scegli se ricevere una email sugli errori di cronjob. Ricorda che questo potrebbe causare l\'invio di una mail ogni 5 minuti in dipendenza all \'errore e alle tue impostazioni di cronjob.';

View File

@@ -449,7 +449,7 @@ class nginx {
// Clean user defined settings // Clean user defined settings
$vhost_usr = str_replace("\r", "\n", $vhost_usr); // Remove windows linebreaks $vhost_usr = str_replace("\r", "\n", $vhost_usr); // Remove windows linebreaks
$vhost_usr = str_replace(array("{", "}"), array("{\n", "\n}"), $vhost_usr); // Break blocks into lines $vhost_usr = str_replace(array("{ ", " }"), array("{\n", "\n}"), $vhost_usr); // Break blocks into lines
$vhost_usr = explode("\n", preg_replace('/[ \t]+/', ' ', trim(preg_replace('/\t+/', '', $vhost_usr)))); // Break into array items $vhost_usr = explode("\n", preg_replace('/[ \t]+/', ' ', trim(preg_replace('/\t+/', '', $vhost_usr)))); // Break into array items
$vhost_usr = array_filter($vhost_usr, create_function('$a','return preg_match("#\S#", $a);')); // Remove empty lines $vhost_usr = array_filter($vhost_usr, create_function('$a','return preg_match("#\S#", $a);')); // Remove empty lines

View File

@@ -1,3 +1,9 @@
# Postfix programs paths settings
command_directory = /usr/sbin
daemon_directory = /usr/libexec/postfix
program_directory = /usr/libexec/postfix
sendmail_path = /usr/sbin/sendmail
## General Postfix configuration ## General Postfix configuration
# should be the default domain from your provider eg. "server100.provider.tld" # should be the default domain from your provider eg. "server100.provider.tld"
mydomain = <SERVERNAME> mydomain = <SERVERNAME>
@@ -30,12 +36,12 @@ smtpd_recipient_restrictions = permit_mynetworks,
smtpd_sender_restrictions = permit_mynetworks, smtpd_sender_restrictions = permit_mynetworks,
reject_sender_login_mismatch, reject_sender_login_mismatch,
permit_sasl_authenticated, permit_sasl_authenticated,
reject_unknown_helo_hostname, reject_unknown_hostname,
reject_unknown_recipient_domain, reject_unknown_recipient_domain,
reject_unknown_sender_domain reject_unknown_sender_domain
smtpd_client_restrictions = permit_mynetworks, smtpd_client_restrictions = permit_mynetworks,
permit_sasl_authenticated, permit_sasl_authenticated,
reject_unknown_client_hostname reject_unknown_hostname
smtpd_relay_restrictions = permit_mynetworks, smtpd_relay_restrictions = permit_mynetworks,
permit_sasl_authenticated, permit_sasl_authenticated,
defer_unauth_destination defer_unauth_destination
@@ -59,6 +65,7 @@ virtual_gid_maps = mysql:/etc/postfix/mysql-virtual_gid_maps.cf
# Local delivery settings # Local delivery settings
local_transport = local local_transport = local
alias_database = hash:/etc/mail/aliases
alias_maps = $alias_database alias_maps = $alias_database
# Default Mailbox size, is set to 0 which means unlimited! # Default Mailbox size, is set to 0 which means unlimited!

View File

@@ -5,5 +5,6 @@ PATH=/sbin:/bin:/usr/sbin:/usr/bin
# #
# Regular cron jobs for the froxlor package # Regular cron jobs for the froxlor package
# #
*/1 * * * * root /usr/bin/php -q /opt/froxlor/scripts/froxlor_master_cronjob.php # Please check that all following paths are correct
#
*/1 * * * * root /usr/bin/php -q <BASE_PATH>scripts/froxlor_master_cronjob.php

View File

@@ -1,4 +1,3 @@
# added for Froxlor # added for Froxlor
spamassassin unix - n n - - pipe flags=R user=spamd argv=/usr/bin/spamc -e /usr/sbin/sendmail -oi -f ${sender} ${recipient} dovecot unix - n n - - pipe flags=DRhu user=vmail:vmail argv=/usr/libexec/dovecot/deliver -f ${sender} -d ${recipient}
dovecot unix - n n - - pipe flags=DRhu user=vmail:mail argv=/usr/libexec/dovecot/deliver -f ${sender} -d ${recipient}

View File

@@ -82,7 +82,7 @@ DefaultServer on
# The DebugLevel directive configures the debugging level the server will use when logging. # The DebugLevel directive configures the debugging level the server will use when logging.
# The level parameter must be between 0 and 9. # The level parameter must be between 0 and 9.
# This configuration directive will take precedence over any command-line debugging options used. # This configuration directive will take precedence over any command-line debugging options used.
DebugLevel 9 #DebugLevel 9
# Cause every FTP user except adm to be chrooted into their home directory # Cause every FTP user except adm to be chrooted into their home directory
DefaultRoot ~ !adm DefaultRoot ~ !adm
@@ -347,7 +347,7 @@ ControlsLog /var/log/proftpd/controls.log
# Umask 022 is a good standard umask to prevent new dirs and files # Umask 022 is a good standard umask to prevent new dirs and files
# from being group and world writable # from being group and world writable
Umask 022 Umask 077
# Allow users to overwrite files and change permissions # Allow users to overwrite files and change permissions
AllowOverwrite yes AllowOverwrite yes