(2003-2009) * @author Froxlor team (2010-) * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @package Panel * */ define('AREA', 'customer'); /** * Include our init.php, which manages Sessions, Language etc. */ require ("./lib/init.php"); if(isset($_POST['id'])) { $id = intval($_POST['id']); } elseif(isset($_GET['id'])) { $id = intval($_GET['id']); } if($page == 'overview') { $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains"); eval("echo \"" . getTemplate("domains/domains") . "\";"); } elseif($page == 'domains') { if($action == '') { $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains"); $fields = array( 'd.domain' => $lng['domains']['domainname'], 'd.documentroot' => $lng['panel']['path'], 'd.aliasdomain' => $lng['domains']['aliasdomain'] ); $paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']); $result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()); $paging->setEntries($db->num_rows($result)); $sortcode = $paging->getHtmlSortCode($lng); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $searchcode = $paging->getHtmlSearchCode($lng); $pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s); $domains = ''; $parentdomains_count = 0; $domains_count = 0; $domain_array = array(); while($row = $db->fetch_array($result)) { $row['domain'] = $idna_convert->decode($row['domain']); $row['aliasdomain'] = $idna_convert->decode($row['aliasdomain']); $row['domainalias'] = $idna_convert->decode($row['domainalias']); if($row['parentdomainid'] == '0' && $row['caneditdomain'] == '1') { $parentdomains_count++; } $domains_count++; /* $domainparts = explode('.', $row['domain']); $domainparts = array_reverse($domainparts); $sortkey = ''; foreach($domainparts as $key => $part) { $sortkey.= $part . '.'; } $domain_array[$sortkey] = $row; */ $domain_array[$row['domain']] = $row; } ksort($domain_array); $domain_id_array = array(); foreach($domain_array as $sortkey => $row) { $domain_id_array[$row['id']] = $sortkey; } $domain_sort_array = array(); foreach($domain_array as $sortkey => $row) { if($row['parentdomainid'] == 0) { $domain_sort_array[$sortkey][$sortkey] = $row; } else { $domain_sort_array[$domain_id_array[$row['parentdomainid']]][$sortkey] = $row; } } $domain_array = array(); if($paging->sortfield == 'd.domain' && $paging->sortorder == 'asc') { ksort($domain_sort_array); } elseif($paging->sortfield == 'd.domain' && $paging->sortorder == 'desc') { krsort($domain_sort_array); } $i = 0; foreach($domain_sort_array as $sortkey => $domain_array) { if($paging->checkDisplay($i)) { $row = htmlentities_array($domain_array[$sortkey]); if($settings['system']['awstats_enabled'] == '1') { $statsapp = 'awstats'; } else { $statsapp = 'webalizer'; } eval("\$domains.=\"" . getTemplate("domains/domains_delimiter") . "\";"); if($paging->sortfield == 'd.domain' && $paging->sortorder == 'asc') { ksort($domain_array); } elseif($paging->sortfield == 'd.domain' && $paging->sortorder == 'desc') { krsort($domain_array); } foreach($domain_array as $row) { if(strpos($row['documentroot'], $userinfo['documentroot']) === 0) { $row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot']))); } // get ssl-ips if activated // FIXME for multi-ip later $show_ssledit = false; if ($settings['system']['use_ssl'] == '1' && $row['ssl_ipandport'] != 0 && $row['caneditdomain'] == '1' ) { $show_ssledit = true; } $row = htmlentities_array($row); eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";"); } } $i+= count($domain_array); } eval("echo \"" . getTemplate("domains/domainlist") . "\";"); } elseif($action == 'delete' && $id != 0) { $result = $db->query_first("SELECT `id`, `customerid`, `domain`, `documentroot`, `isemaildomain`, `parentdomainid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $alias_check = $db->query_first('SELECT COUNT(`id`) AS `count` FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$id . '\''); if(isset($result['parentdomainid']) && $result['parentdomainid'] != '0' && $alias_check['count'] == 0) { if(isset($_POST['send']) && $_POST['send'] == 'send') { if($result['isemaildomain'] == '1') { $emails = $db->query_first('SELECT COUNT(`id`) AS `count` FROM `' . TABLE_MAIL_VIRTUAL . '` WHERE `customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `domainid`=\'' . (int)$id . '\''); if($emails['count'] != '0') { standard_error('domains_cantdeletedomainwithemail'); } } /* * check for APS packages used with this domain, #110 */ if(domainHasApsInstances($id)) { standard_error('domains_cantdeletedomainwithapsinstances'); } $log->logAction(USR_ACTION, LOG_INFO, "deleted subdomain '" . $idna_convert->decode($result['domain']) . "'"); $result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); inserttask('1'); // Using nameserver, insert a task which rebuilds the server config inserttask('4'); redirectTo($filename, Array('page' => $page, 's' => $s)); } else { ask_yesno('domains_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['domain'])); } } else { standard_error('domains_cantdeletemaindomain'); } } elseif($action == 'add') { if($userinfo['subdomains_used'] < $userinfo['subdomains'] || $userinfo['subdomains'] == '-1') { if(isset($_POST['send']) && $_POST['send'] == 'send') { $subdomain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['subdomain'], 'subdomain', '', 'subdomainiswrong'))); $domain = $idna_convert->encode($_POST['domain']); $domain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($domain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `caneditdomain`='1' "); $completedomain = $subdomain . '.' . $domain; $completedomain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($completedomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `email_only`='0' AND `caneditdomain` = '1'"); $aliasdomain = intval($_POST['alias']); $aliasdomain_check = array( 'id' => 0 ); $_doredirect = false; if($aliasdomain != 0) { // also check ip/port combination to be the same, #176 $aliasdomain_check = $db->query_first('SELECT `id` FROM `' . TABLE_PANEL_DOMAINS . '` `d`,`' . TABLE_PANEL_CUSTOMERS . '` `c` WHERE `d`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`aliasdomain` IS NULL AND `d`.`id`<>`c`.`standardsubdomain` AND `c`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`id`=\'' . (int)$aliasdomain . '\' AND `d`.`ipandport` = \''.(int)$domain_check['ipandport'].'\''); } if(isset($_POST['url']) && $_POST['url'] != '' && validateUrl($idna_convert->encode($_POST['url']))) { $path = $_POST['url']; $_doredirect = true; } else { $path = validate($_POST['path'], 'path'); } if(!preg_match('/^https?\:\/\//', $path) || !validateUrl($idna_convert->encode($path))) { // If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, // set default path to subdomain or domain name if((($path == '') || ($path == '/')) && $settings['system']['documentroot_use_default_value'] == 1) { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain); } else { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); } if (strstr($path, ":") !== FALSE) { standard_error('pathmaynotcontaincolon'); } } else { $_doredirect = true; } if(isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') { $openbasedir_path = '1'; } else { $openbasedir_path = '0'; } if(isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') { $ssl_redirect = '1'; } else { $ssl_redirect = '0'; } if($path == '') { standard_error('patherror'); } elseif($subdomain == '') { standard_error(array('stringisempty', 'domainname')); } elseif($subdomain == 'www' && $domain_check['wwwserveralias'] == '1') { standard_error('wwwnotallowed'); } elseif($domain == '') { standard_error('domaincantbeempty'); } elseif(strtolower($completedomain_check['domain']) == strtolower($completedomain)) { standard_error('domainexistalready', $completedomain); } elseif(strtolower($domain_check['domain']) != strtolower($domain)) { standard_error('maindomainnonexist', $domain); } elseif($aliasdomain_check['id'] != $aliasdomain) { standard_error('domainisaliasorothercustomer'); } else { // get the phpsettingid from parentdomain, #107 $phpsid_result = $db->query_first("SELECT `phpsettingid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `id` = '".(int)$domain_check['id']."'"); if(!isset($phpsid_result['phpsettingid']) || (int)$phpsid_result['phpsettingid'] <= 0 ) { // assign default config $phpsid_result['phpsettingid'] = 1; } $result = $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$userinfo['customerid'] . "', `domain` = '" . $db->escape($completedomain) . "', `documentroot` = '" . $db->escape($path) . "', `ipandport` = '" . $db->escape($domain_check['ipandport']) . "', `aliasdomain` = ".(($aliasdomain != 0) ? "'" . $db->escape($aliasdomain) . "'" : "NULL") .", `parentdomainid` = '" . (int)$domain_check['id'] . "', `isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', `openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "', `openbasedir_path` = '" . $db->escape($openbasedir_path) . "', `speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "', `specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "', `ssl_redirect` = '" . $ssl_redirect . "', `phpsettingid` = '" . $phpsid_result['phpsettingid'] . "'"); if($_doredirect) { $did = $db->insert_id(); $redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : $settings['customredirect']['default']; addRedirectToDomain($did, $redirect); } $result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'"); $log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'"); inserttask('1'); // Using nameserver, insert a task which rebuilds the server config inserttask('4'); redirectTo($filename, Array('page' => $page, 's' => $s)); } } else { $result = $db->query("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `caneditdomain`='1' ORDER BY `domain` ASC"); $domains = ''; while($row = $db->fetch_array($result)) { $domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']); } $aliasdomains = makeoption($lng['domains']['noaliasdomain'], 0, NULL, true); $result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` <> `c`.`standardsubdomain` AND `d`.`customerid`=`c`.`customerid` AND `d`.`email_only`='0' AND `d`.`customerid`=" . (int)$userinfo['customerid'] . " ORDER BY `d`.`domain` ASC"); while($row_domain = $db->fetch_array($result_domains)) { $aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']); } $redirectcode = ''; if($settings['customredirect']['enabled'] == '1') { $codes = getRedirectCodesArray(); foreach($codes as $rc) { $redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $settings['customredirect']['default']); } } // check if we at least have one ssl-ip/port, #1179 $ssl_ipsandports = ''; $resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'"); if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) { $ssl_ipsandports = 'notempty'; } $openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); $subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php'; $subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data); $title = $subdomain_add_data['domain_add']['title']; $image = $subdomain_add_data['domain_add']['image']; eval("echo \"" . getTemplate("domains/domains_add") . "\";"); } } } elseif($action == 'edit' && $id != 0) { $result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'"); $alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\''); $alias_check = $alias_check['count']; $_doredirect = false; if(isset($result['customerid']) && $result['customerid'] == $userinfo['customerid']) { if(isset($_POST['send']) && $_POST['send'] == 'send') { if(isset($_POST['url']) && $_POST['url'] != '' && validateUrl($idna_convert->encode($_POST['url']))) { $path = $_POST['url']; $_doredirect = true; } else { $path = validate($_POST['path'], 'path'); } if(!preg_match('/^https?\:\/\//', $path) || !validateUrl($idna_convert->encode($path))) { // If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, // set default path to subdomain or domain name if((($path == '') || ($path == '/')) && $settings['system']['documentroot_use_default_value'] == 1) { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']); } else { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); } if (strstr($path, ":") !== FALSE) { standard_error('pathmaynotcontaincolon'); } } else { $_doredirect = true; } $aliasdomain = intval($_POST['alias']); if(isset($_POST['iswildcarddomain']) && $_POST['iswildcarddomain'] == '1' && $result['parentdomainid'] == '0' ){ $iswildcarddomain = '1'; } else { $iswildcarddomain = '0'; } if($result['parentdomainid'] != '0' && ($result['subcanemaildomain'] == '1' || $result['subcanemaildomain'] == '2') && isset($_POST['isemaildomain'])) { $isemaildomain = intval($_POST['isemaildomain']); } else { $isemaildomain = $result['isemaildomain']; } $aliasdomain_check = array( 'id' => 0 ); if($aliasdomain != 0) { $aliasdomain_check = $db->query_first('SELECT `id` FROM `' . TABLE_PANEL_DOMAINS . '` `d`,`' . TABLE_PANEL_CUSTOMERS . '` `c` WHERE `d`.`customerid`=\'' . (int)$result['customerid'] . '\' AND `d`.`aliasdomain` IS NULL AND `d`.`id`<>`c`.`standardsubdomain` AND `c`.`customerid`=\'' . (int)$result['customerid'] . '\' AND `d`.`id`=\'' . (int)$aliasdomain . '\''); } if($aliasdomain_check['id'] != $aliasdomain) { standard_error('domainisaliasorothercustomer'); } if(isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') { $openbasedir_path = '1'; } else { $openbasedir_path = '0'; } if(isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') { $ssl_redirect = '1'; } else { $ssl_redirect = '0'; } if($path == '') { standard_error('patherror'); } else { if(($result['isemaildomain'] == '1') && ($isemaildomain == '0')) { $db->query("DELETE FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `domainid`='" . (int)$id . "'"); $db->query("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `domainid`='" . (int)$id . "'"); $log->logAction(USR_ACTION, LOG_NOTICE, "automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'"); } if($_doredirect) { $redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : false; updateRedirectOfDomain($id, $redirect); } if($path != $result['documentroot'] || $isemaildomain != $result['isemaildomain'] || $iswildcarddomain != $result['iswildcarddomain'] || $aliasdomain != $result['aliasdomain'] || $openbasedir_path != $result['openbasedir_path'] || $ssl_redirect != $result['ssl_redirect']) { $log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'"); $result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"); inserttask('1'); // Using nameserver, insert a task which rebuilds the server config inserttask('4'); } redirectTo($filename, Array('page' => $page, 's' => $s)); } } else { $result['domain'] = $idna_convert->decode($result['domain']); $domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true); // also check ip/port combination to be the same, #176 $result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id`<>'" . (int)$result['id'] . "' AND `c`.`standardsubdomain`<>`d`.`id` AND `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `c`.`customerid`=`d`.`customerid` AND `d`.`ipandport` = '".(int)$result['ipandport']."' ORDER BY `d`.`domain` ASC"); while($row_domain = $db->fetch_array($result_domains)) { $domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id'], $result['aliasdomain']); } if(preg_match('/^https?\:\/\//', $result['documentroot']) && validateUrl($idna_convert->encode($result['documentroot'])) ) { if($settings['panel']['pathedit'] == 'Dropdown') { $urlvalue = $result['documentroot']; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']); } else { $urlvalue = ''; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot'], true); } } else { $urlvalue = ''; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']); } $redirectcode = ''; if($settings['customredirect']['enabled'] == '1') { $def_code = getDomainRedirectId($id); $codes = getRedirectCodesArray(); foreach($codes as $rc) { $redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $def_code); } } // check if we at least have one ssl-ip/port, #1179 $ssl_ipsandports = ''; $resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'"); if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) { $ssl_ipsandports = 'notempty'; } $openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true); $result_ipandport = $db->query_first("SELECT `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` WHERE `id`='".(int)$result['ipandport']."'"); if(filter_var($result_ipandport['ip'], FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)) { $result_ipandport['ip'] = '[' . $result_ipandport['ip'] . ']'; } $domainip = $result_ipandport['ip']; $result = htmlentities_array($result); $subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php'; $subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data); $title = $subdomain_edit_data['domain_edit']['title']; $image = $subdomain_edit_data['domain_edit']['image']; eval("echo \"" . getTemplate("domains/domains_edit") . "\";"); } } else { standard_error('domains_canteditdomain'); } } } elseif ($page == 'domainssleditor') { if ($action == '' || $action == 'view' ) { if (isset($_POST['send']) && $_POST['send'] == 'send' ) { $ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : ''; $ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : ''; $ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : ''; $ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : ''; $do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false; if ($ssl_cert_file != '' && $ssl_key_file == '') { standard_error('sslcertificateismissingprivatekey'); } $do_verify = true; // no cert-file given -> forget everything if ($ssl_cert_file == '') { $ssl_key_file = ''; $ssl_ca_file = ''; $ssl_cert_chainfile = ''; $do_verify = false; } // verify certificate content if ($do_verify) { // array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] ) // openssl_x509_parse() returns information about the supplied x509cert, including fields such as // subject name, issuer name, purposes, valid from and valid to dates etc. $cert_content = openssl_x509_parse($ssl_cert_file); if (is_array($cert_content) && isset($cert_content['subject']) && isset($cert_content['subject']['CN']) ) { // TODO self-signed certs might differ and don't need/want this /* $domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'"); if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) { standard_error('sslcertificatewrongdomain'); } */ // bool openssl_x509_check_private_key ( mixed $cert , mixed $key ) // Checks whether the given key is the private key that corresponds to cert. if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) { standard_error('sslcertificateinvalidcertkeypair'); } // check optional stuff if ($ssl_ca_file != '') { $ca_content = openssl_x509_parse($ssl_ca_file); if (!is_array($ca_content)) { // invalid standard_error('sslcertificateinvalidca'); } } if ($ssl_cert_chainfile != '') { $chain_content = openssl_x509_parse($ssl_cert_chainfile); if (!is_array($chain_content)) { // invalid standard_error('sslcertificateinvalidchain'); } } } else { standard_error('sslcertificateinvalidcert'); } } // Add/Update database entry $qrystart = "UPDATE "; $qrywhere = "WHERE "; if ($do_insert) { $qrystart = "INSERT INTO "; $qrywhere = ", "; } $db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET `ssl_cert_file` = '".$db->escape($ssl_cert_file)."', `ssl_key_file` = '".$db->escape($ssl_key_file)."', `ssl_ca_file` = '".$db->escape($ssl_ca_file)."', `ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."' ".$qrywhere." `domainid`='".(int)$id."';" ); // back to domain overview redirectTo($filename, array('page' => 'domains', 's' => $s)); } $result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`='".(int)$id."';" ); $do_insert = false; // if no entry can be found, behave like we have empty values if (!is_array($result) || !isset($result['ssl_cert_file'])) { $result = array( 'ssl_cert_file' => '', 'ssl_key_file' => '', 'ssl_ca_file' => '', 'ssl_cert_chainfile' => '' ); $do_insert = true; } $result = htmlentities_array($result); $ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php'; $ssleditor_form = htmlform::genHTMLForm($ssleditor_data); $title = $ssleditor_data['domain_ssleditor']['title']; $image = $ssleditor_data['domain_ssleditor']['image']; eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";"); } }