(2003-2009) * @author Froxlor team (2010-) * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @package Panel * */ define('AREA', 'customer'); require './lib/init.php'; // redirect if this customer page is hidden via settings if (Settings::IsInList('panel.customer_hide_options','domains')) { redirectTo('customer_index.php'); } if (isset($_POST['id'])) { $id = intval($_POST['id']); } elseif (isset($_GET['id'])) { $id = intval($_GET['id']); } if ($page == 'overview') { $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains"); eval("echo \"" . getTemplate("domains/domains") . "\";"); } elseif ($page == 'domains') { if ($action == '') { $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains"); $fields = array( 'd.domain' => $lng['domains']['domainname'] ); $paging = new paging($userinfo, TABLE_PANEL_DOMAINS, $fields); $domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isbinddomain`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`letsencrypt`, `d`.`termination_date`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`= :customerid AND `d`.`email_only`='0' AND `d`.`id` <> :standardsubdomain " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit() ); Database::pexecute($domains_stmt, array("customerid" => $userinfo['customerid'], "standardsubdomain" => $userinfo['standardsubdomain'])); $paging->setEntries(Database::num_rows()); $sortcode = $paging->getHtmlSortCode($lng); $arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s); $searchcode = $paging->getHtmlSearchCode($lng); $pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s); $domains = ''; $parentdomains_count = 0; $domains_count = 0; $domain_array = array(); while ($row = $domains_stmt->fetch(PDO::FETCH_ASSOC)) { $row['domain'] = $idna_convert->decode($row['domain']); $row['aliasdomain'] = $idna_convert->decode($row['aliasdomain']); $row['domainalias'] = $idna_convert->decode($row['domainalias']); if ($row['parentdomainid'] == '0' && $row['caneditdomain'] == '1') { $parentdomains_count++; } /** * check for set ssl-certs to show different state-icons */ // nothing (ssl_global) $row['domain_hascert'] = 0; $ssl_stmt = Database::prepare("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid` = :domainid"); Database::pexecute($ssl_stmt, array("domainid" => $row['id'])); $ssl_result = $ssl_stmt->fetch(PDO::FETCH_ASSOC); if (is_array($ssl_result) && isset($ssl_result['ssl_cert_file']) && $ssl_result['ssl_cert_file'] != '') { // own certificate (ssl_customer_green) $row['domain_hascert'] = 1; } else { // check if it's parent has one set (shared) if ($row['parentdomainid'] != 0) { $ssl_stmt = Database::prepare("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid` = :domainid"); Database::pexecute($ssl_stmt, array("domainid" => $row['parentdomainid'])); $ssl_result = $ssl_stmt->fetch(PDO::FETCH_ASSOC); if (is_array($ssl_result) && isset($ssl_result['ssl_cert_file']) && $ssl_result['ssl_cert_file'] != '') { // parent has a certificate (ssl_shared) $row['domain_hascert'] = 2; } } } $row['termination_date'] = str_replace("0000-00-00", "", $row['termination_date']); if($row['termination_date'] != "") { $cdate = strtotime($row['termination_date'] . " 23:59:59"); $today = time(); if($cdate < $today) { $row['termination_css'] = 'domain-expired'; } else { $row['termination_css'] = 'domain-canceled'; } } $domains_count++; $domain_array[$row['domain']] = $row; } ksort($domain_array); $domain_id_array = array(); foreach ($domain_array as $sortkey => $row) { $domain_id_array[$row['id']] = $sortkey; } $domain_sort_array = array(); foreach ($domain_array as $sortkey => $row) { if ($row['parentdomainid'] == 0) { $domain_sort_array[$sortkey][$sortkey] = $row; } else { // when searching and the results are subdomains only, we need to get // the parent domain to this subdomain if (!isset($domain_id_array[$row['parentdomainid']])) { $domain_id_array[$row['parentdomainid']] = "[parent-domain]"; } $domain_sort_array[$domain_id_array[$row['parentdomainid']]][$sortkey] = $row; } } $domain_array = array(); if ($paging->sortfield == 'd.domain' && $paging->sortorder == 'asc') { ksort($domain_sort_array); } elseif ($paging->sortfield == 'd.domain' && $paging->sortorder == 'desc') { krsort($domain_sort_array); } $i = 0; foreach ($domain_sort_array as $sortkey => $domain_array) { if ($paging->checkDisplay($i)) { if (isset($domain_array[$sortkey])) { $row = htmlentities_array($domain_array[$sortkey]); if (Settings::Get('system.awstats_enabled') == '1') { $statsapp = 'awstats'; } else { $statsapp = 'webalizer'; } eval("\$domains.=\"" . getTemplate("domains/domains_delimiter") . "\";"); } if ($paging->sortfield == 'd.domain' && $paging->sortorder == 'asc') { ksort($domain_array); } elseif ($paging->sortfield == 'd.domain' && $paging->sortorder == 'desc') { krsort($domain_array); } foreach ($domain_array as $row) { if (strpos($row['documentroot'], $userinfo['documentroot']) === 0) { $row['documentroot'] = makeCorrectDir(str_replace($userinfo['documentroot'], "/", $row['documentroot'])); } // get ssl-ips if activated $show_ssledit = false; if (Settings::Get('system.use_ssl') == '1' && domainHasSslIpPort($row['id']) && $row['caneditdomain'] == '1' && $row['letsencrypt'] == 0) { $show_ssledit = true; } $row = htmlentities_array($row); eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";"); } } $i+= count($domain_array); } eval("echo \"" . getTemplate("domains/domainlist") . "\";"); } elseif ($action == 'delete' && $id != 0) { $stmt = Database::prepare("SELECT `id`, `customerid`, `domain`, `documentroot`, `isemaildomain`, `parentdomainid`, `aliasdomain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid` = :customerid AND `id` = :id" ); Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id)); $result = $stmt->fetch(PDO::FETCH_ASSOC); $alias_stmt = Database::prepare("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `aliasdomain` = :aliasdomain"); Database::pexecute($alias_stmt, array("aliasdomain" => $id)); $alias_check = $alias_stmt->fetch(PDO::FETCH_ASSOC); if (isset($result['parentdomainid']) && $result['parentdomainid'] != '0' && $alias_check['count'] == 0) { if (isset($_POST['send']) && $_POST['send'] == 'send') { if ($result['isemaildomain'] == '1') { $emails_stmt = Database::prepare("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid` = :customerid AND `domainid` = :domainid" ); Database::pexecute($emails_stmt, array("customerid" => $userinfo['customerid'], "domainid" => $id)); $emails = $emails_stmt->fetch(PDO::FETCH_ASSOC); if ($emails['count'] != '0') { standard_error('domains_cantdeletedomainwithemail'); } } triggerLetsEncryptCSRForAliasDestinationDomain($result['aliasdomain'], $log); $log->logAction(USR_ACTION, LOG_INFO, "deleted subdomain '" . $idna_convert->decode($result['domain']) . "'"); $stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid` = :customerid AND `id` = :id" ); Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id)); $stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used` = `subdomains_used` - 1 WHERE `customerid` = :customerid" ); Database::pexecute($stmt, array("customerid" => $userinfo['customerid'])); // remove connections to ips and domainredirects $del_stmt = Database::prepare(" DELETE FROM `" . TABLE_DOMAINTOIP . "` WHERE `id_domain` = :domainid" ); Database::pexecute($del_stmt, array('domainid' => $id)); $del_stmt = Database::prepare(" DELETE FROM `" . TABLE_PANEL_DOMAINREDIRECTS . "` WHERE `did` = :domainid" ); Database::pexecute($del_stmt, array('domainid' => $id)); // remove certificate from domain_ssl_settings, fixes #1596 $del_stmt = Database::prepare(" DELETE FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE `domainid` = :domainid" ); Database::pexecute($del_stmt, array('domainid' => $id)); // remove possible existing DNS entries $del_stmt = Database::prepare(" DELETE FROM `" . TABLE_DOMAIN_DNS . "` WHERE `domain_id` = :domainid "); Database::pexecute($del_stmt, array('domainid' => $id)); inserttask('1'); // Using nameserver, insert a task which rebuilds the server config inserttask('4'); redirectTo($filename, array('page' => $page, 's' => $s)); } else { ask_yesno('domains_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['domain'])); } } else { standard_error('domains_cantdeletemaindomain'); } } elseif ($action == 'add') { if ($userinfo['subdomains_used'] < $userinfo['subdomains'] || $userinfo['subdomains'] == '-1') { if (isset($_POST['send']) && $_POST['send'] == 'send') { if (strpos($_POST['subdomain'], '--') !== false) { standard_error('domain_nopunycode'); } $subdomain = $idna_convert->encode(preg_replace(array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['subdomain'], 'subdomain', '', 'subdomainiswrong'))); $domain = $_POST['domain']; $domain_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain` = :domain AND `customerid` = :customerid AND `parentdomainid` = '0' AND `email_only` = '0' AND `caneditdomain` = '1'" ); $domain_check = Database::pexecute_first($domain_stmt, array("domain" => $domain, "customerid" => $userinfo['customerid'])); $completedomain = $subdomain . '.' . $domain; if (Settings::Get('system.validate_domain') && ! validateDomain($completedomain)) { standard_error(array( 'stringiswrong', 'mydomain' )); } if ($completedomain == Settings::Get('system.hostname')) { standard_error('admin_domain_emailsystemhostname'); } $completedomain_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain` = :domain AND `customerid` = :customerid AND `email_only` = '0' AND `caneditdomain` = '1'" ); $completedomain_check = Database::pexecute_first($completedomain_stmt, array("domain" => $completedomain, "customerid" => $userinfo['customerid'])); $aliasdomain = intval($_POST['alias']); $aliasdomain_check = array('id' => 0); $_doredirect = false; if ($aliasdomain != 0) { // also check ip/port combination to be the same, #176 $aliasdomain_stmt = Database::prepare("SELECT `d`.`id` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` = :id AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`customerid` = :customerid AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = :id ) GROUP BY `d`.`domain` ORDER BY `d`.`domain` ASC;" ); $aliasdomain_check = Database::pexecute_first($aliasdomain_stmt, array("id" => $aliasdomain, "customerid" => $userinfo['customerid'])); triggerLetsEncryptCSRForAliasDestinationDomain($aliasdomain, $log); } if (isset($_POST['url']) && $_POST['url'] != '' && validateUrl($_POST['url'])) { $path = $_POST['url']; $_doredirect = true; } else { $path = validate($_POST['path'], 'path'); } if (!preg_match('/^https?\:\/\//', $path) || !validateUrl($path)) { // If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, // set default path to subdomain or domain name if ((($path == '') || ($path == '/')) && Settings::Get('system.documentroot_use_default_value') == 1) { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain); } else { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); } if (strstr($path, ":") !== FALSE) { standard_error('pathmaynotcontaincolon'); } } else { $_doredirect = true; } $openbasedir_path = '0'; if (isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') { $openbasedir_path = '1'; } $ssl_redirect = '0'; if (isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') { // a ssl-redirect only works if there actually is a // ssl ip/port assigned to the domain if (domainHasSslIpPort($domain_check['id']) == true) { $ssl_redirect = '1'; $_doredirect = true; } else { standard_error('sslredirectonlypossiblewithsslipport'); } } $letsencrypt = '0'; if (isset($_POST['letsencrypt']) && $_POST['letsencrypt'] == '1') { // let's encrypt only works if there actually is a // ssl ip/port assigned to the domain if (domainHasSslIpPort($domain_check['id']) == true) { $letsencrypt = '1'; } else { standard_error('letsencryptonlypossiblewithsslipport'); } } // Temporarily deactivate ssl_redirect until Let's Encrypt certificate was generated if ($ssl_redirect > 0 && $letsencrypt == 1) { $ssl_redirect = 2; } // HSTS $hsts_maxage = isset($_POST['hsts_maxage']) ? (int)$_POST['hsts_maxage'] : 0; $hsts_sub = isset($_POST['hsts_sub']) && (int)$_POST['hsts_sub'] == 1 ? 1 : 0; $hsts_preload = isset($_POST['hsts_preload']) && (int)$_POST['hsts_preload'] == 1 ? 1 : 0; if ($path == '') { standard_error('patherror'); } elseif ($subdomain == '') { standard_error(array('stringisempty', 'domainname')); } elseif ($subdomain == 'www' && $domain_check['wwwserveralias'] == '1') { standard_error('wwwnotallowed'); } elseif ($domain == '') { standard_error('domaincantbeempty'); } elseif (strtolower($completedomain_check['domain']) == strtolower($completedomain)) { standard_error('domainexistalready', $completedomain); } elseif (strtolower($domain_check['domain']) != strtolower($domain)) { standard_error('maindomainnonexist', $domain); } elseif ($aliasdomain_check['id'] != $aliasdomain) { standard_error('domainisaliasorothercustomer'); } else { // get the phpsettingid from parentdomain, #107 $phpsid_stmt = Database::prepare("SELECT `phpsettingid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `id` = :id" ); Database::pexecute($phpsid_stmt, array("id" => $domain_check['id'])); $phpsid_result = $phpsid_stmt->fetch(PDO::FETCH_ASSOC); if (!isset($phpsid_result['phpsettingid']) || (int)$phpsid_result['phpsettingid'] <= 0) { // assign default config $phpsid_result['phpsettingid'] = 1; } $stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = :customerid, `domain` = :domain, `documentroot` = :documentroot, `aliasdomain` = :aliasdomain, `parentdomainid` = :parentdomainid, `wwwserveralias` = :wwwserveralias, `isemaildomain` = :isemaildomain, `iswildcarddomain` = :iswildcarddomain, `openbasedir` = :openbasedir, `openbasedir_path` = :openbasedir_path, `speciallogfile` = :speciallogfile, `specialsettings` = :specialsettings, `ssl_redirect` = :ssl_redirect, `phpsettingid` = :phpsettingid, `letsencrypt` = :letsencrypt, `hsts` = :hsts, `hsts_sub` = :hsts_sub, `hsts_preload` = :hsts_preload" ); $params = array( "customerid" => $userinfo['customerid'], "domain" => $completedomain, "documentroot" => $path, "aliasdomain" => $aliasdomain != 0 ? $aliasdomain : null, "parentdomainid" => $domain_check['id'], "wwwserveralias" => $domain_check['wwwserveralias'] == '1' ? '1' : '0', "iswildcarddomain" => $domain_check['iswildcarddomain'] == '1' ? '1' : '0', "isemaildomain" => $domain_check['subcanemaildomain'] == '3' ? '1' : '0', "openbasedir" => $domain_check['openbasedir'], "openbasedir_path" => $openbasedir_path, "speciallogfile" => $domain_check['speciallogfile'], "specialsettings" => $domain_check['specialsettings'], "ssl_redirect" => $ssl_redirect, "phpsettingid" => $phpsid_result['phpsettingid'], "letsencrypt" => $letsencrypt, "hsts" => $hsts_maxage, "hsts_sub" => $hsts_sub, "hsts_preload" => $hsts_preload ); Database::pexecute($stmt, $params); if ($_doredirect) { $did = Database::lastInsertId(); $redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : Settings::Get('customredirect.default'); addRedirectToDomain($did, $redirect); } $stmt = Database::prepare("INSERT INTO `".TABLE_DOMAINTOIP."` (`id_domain`, `id_ipandports`) SELECT LAST_INSERT_ID(), `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = :id_domain" ); Database::pexecute($stmt, array("id_domain" => $domain_check['id'])); $stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used` = `subdomains_used` + 1 WHERE `customerid` = :customerid" ); Database::pexecute($stmt, array("customerid" => $userinfo['customerid'])); $log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'"); inserttask('1'); // Using nameserver, insert a task which rebuilds the server config inserttask('4'); redirectTo($filename, array('page' => $page, 's' => $s)); } } else { $stmt = Database::prepare("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain`,`letsencrypt` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid` = :customerid AND `parentdomainid` = '0' AND `email_only` = '0' AND `caneditdomain` = '1' ORDER BY `domain` ASC" ); Database::pexecute($stmt, array("customerid" => $userinfo['customerid'])); $domains = ''; while ($row = $stmt->fetch(PDO::FETCH_ASSOC)) { $domains .= makeoption($idna_convert->decode($row['domain']), $row['domain']); } $aliasdomains = makeoption($lng['domains']['noaliasdomain'], 0, NULL, true); $domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` <> `c`.`standardsubdomain` AND `d`.`parentdomainid` = '0' AND `d`.`customerid`=`c`.`customerid` AND `d`.`email_only`='0' AND `d`.`customerid`= :customerid ORDER BY `d`.`domain` ASC" ); Database::pexecute($domains_stmt, array("customerid" => $userinfo['customerid'])); while ($row_domain = $domains_stmt->fetch(PDO::FETCH_ASSOC)) { $aliasdomains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']); } $redirectcode = ''; if (Settings::Get('customredirect.enabled') == '1') { $codes = getRedirectCodesArray(); foreach ($codes as $rc) { $redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id']); } } // check if we at least have one ssl-ip/port, #1179 $ssl_ipsandports = ''; $ssl_ip_stmt = Database::prepare("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'"); Database::pexecute($ssl_ip_stmt); $resultX = $ssl_ip_stmt->fetch(PDO::FETCH_ASSOC); if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) { $ssl_ipsandports = 'notempty'; } $openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true); $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']); $subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php'; $subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data); $title = $subdomain_add_data['domain_add']['title']; $image = $subdomain_add_data['domain_add']['image']; eval("echo \"" . getTemplate("domains/domains_add") . "\";"); } } } elseif ($action == 'edit' && $id != 0) { $stmt = Database::prepare("SELECT `d`.*, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid` = :customerid AND `d`.`id` = :id AND ((`d`.`parentdomainid`!='0' AND `pd`.`id` = `d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id` = `d`.`id`)) AND `d`.`caneditdomain`='1'"); $result = Database::pexecute_first($stmt, array("customerid" => $userinfo['customerid'], "id" => $id)); $alias_stmt = Database::prepare("SELECT COUNT(`id`) AS count FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `aliasdomain`= :aliasdomain"); $alias_check = Database::pexecute_first($alias_stmt, array("aliasdomain" => $result['id'])); $alias_check = $alias_check['count']; $_doredirect = false; if (isset($result['customerid']) && $result['customerid'] == $userinfo['customerid']) { if (isset($_POST['send']) && $_POST['send'] == 'send') { if (isset($_POST['url']) && $_POST['url'] != '' && validateUrl($_POST['url'])) { $path = $_POST['url']; $_doredirect = true; } else { $path = validate($_POST['path'], 'path'); } if (!preg_match('/^https?\:\/\//', $path) || !validateUrl($path)) { // If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings, // set default path to subdomain or domain name if ((($path == '') || ($path == '/')) && Settings::Get('system.documentroot_use_default_value') == 1) { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']); } else { $path = makeCorrectDir($userinfo['documentroot'] . '/' . $path); } if (strstr($path, ":") !== FALSE) { standard_error('pathmaynotcontaincolon'); } } else { $_doredirect = true; } $aliasdomain = intval($_POST['alias']); if (isset($_POST['selectserveralias'])) { $iswildcarddomain = ($_POST['selectserveralias'] == '0') ? '1' : '0'; $wwwserveralias = ($_POST['selectserveralias'] == '1') ? '1' : '0'; } else { $iswildcarddomain = $result['iswildcarddomain']; $wwwserveralias = $result['wwwserveralias']; } if ($result['parentdomainid'] != '0' && ($result['subcanemaildomain'] == '1' || $result['subcanemaildomain'] == '2') && isset($_POST['isemaildomain'])) { $isemaildomain = intval($_POST['isemaildomain']); } else { $isemaildomain = $result['isemaildomain']; } $aliasdomain_check = array('id' => 0); if ($aliasdomain != 0) { $aliasdomain_stmt = Database::prepare("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` `d`,`" . TABLE_PANEL_CUSTOMERS . "` `c` WHERE `d`.`customerid`= :customerid AND `d`.`aliasdomain` IS NULL AND `d`.`id`<>`c`.`standardsubdomain` AND `c`.`customerid`= :customerid AND `d`.`id`= :id" ); $aliasdomain_check = Database::pexecute_first($aliasdomain_stmt, array("customerid" => $result['customerid'], "id" => $aliasdomain)); } if ($aliasdomain_check['id'] != $aliasdomain) { standard_error('domainisaliasorothercustomer'); } if (isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') { $openbasedir_path = '1'; } else { $openbasedir_path = '0'; } if (isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') { // a ssl-redirect only works if there actually is a // ssl ip/port assigned to the domain if (domainHasSslIpPort($id) == true) { $ssl_redirect = '1'; $_doredirect = true; } else { standard_error('sslredirectonlypossiblewithsslipport'); } } else { $ssl_redirect = '0'; } if (isset($_POST['letsencrypt']) && $_POST['letsencrypt'] == '1') { // let's encrypt only works if there actually is a // ssl ip/port assigned to the domain if (domainHasSslIpPort($id) == true) { $letsencrypt = '1'; } else { standard_error('letsencryptonlypossiblewithsslipport'); } } else { $letsencrypt = '0'; } // We can't enable let's encrypt for wildcard - domains if ($iswildcarddomain == '1' && $letsencrypt == '1') { standard_error('nowildcardwithletsencrypt'); } // Temporarily deactivate ssl_redirect until Let's Encrypt certificate was generated if ($ssl_redirect > 0 && $letsencrypt == 1 && $result['letsencrypt'] != $letsencrypt) { $ssl_redirect = 2; } // HSTS $hsts_maxage = isset($_POST['hsts_maxage']) ? (int)$_POST['hsts_maxage'] : 0; $hsts_sub = isset($_POST['hsts_sub']) && (int)$_POST['hsts_sub'] == 1 ? 1 : 0; $hsts_preload = isset($_POST['hsts_preload']) && (int)$_POST['hsts_preload'] == 1 ? 1 : 0; if ($path == '') { standard_error('patherror'); } else { if (($result['isemaildomain'] == '1') && ($isemaildomain == '0')) { $params = array("customerid" => $userinfo['customerid'], "domainid" => $id); $stmt = Database::prepare("DELETE FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid`= :customerid AND `domainid`= :domainid"); Database::pexecute($stmt, $params); $stmt = Database::prepare("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`= :customerid AND `domainid`= :domainid"); Database::pexecute($stmt, $params); $log->logAction(USR_ACTION, LOG_NOTICE, "automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'"); } if ($_doredirect) { $redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : false; updateRedirectOfDomain($id, $redirect); } if ($path != $result['documentroot'] || $isemaildomain != $result['isemaildomain'] || $wwwserveralias != $result['wwwserveralias'] || $iswildcarddomain != $result['iswildcarddomain'] || $aliasdomain != $result['aliasdomain'] || $openbasedir_path != $result['openbasedir_path'] || $ssl_redirect != $result['ssl_redirect'] || $letsencrypt != $result['letsencrypt']) { $log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'"); $stmt = Database::prepare("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`= :documentroot, `isemaildomain`= :isemaildomain, `wwwserveralias`= :wwwserveralias, `iswildcarddomain`= :iswildcarddomain, `aliasdomain`= :aliasdomain, `openbasedir_path`= :openbasedir_path, `ssl_redirect`= :ssl_redirect, `letsencrypt`= :letsencrypt, `hsts` = :hsts, `hsts_sub` = :hsts_sub, `hsts_preload` = :hsts_preload WHERE `customerid`= :customerid AND `id`= :id" ); $params = array( "documentroot" => $path, "isemaildomain" => $isemaildomain, "wwwserveralias" => $wwwserveralias, "iswildcarddomain" => $iswildcarddomain, "aliasdomain" => ($aliasdomain != 0 && $alias_check == 0) ? $aliasdomain : null, "openbasedir_path" => $openbasedir_path, "ssl_redirect" => $ssl_redirect, "letsencrypt" => $letsencrypt, "hsts" => $hsts_maxage, "hsts_sub" => $hsts_sub, "hsts_preload" => $hsts_preload, "customerid" => $userinfo['customerid'], "id" => $id ); Database::pexecute($stmt, $params); if ($result['aliasdomain'] != $aliasdomain) { // trigger when domain id for alias destination has changed: both for old and new destination triggerLetsEncryptCSRForAliasDestinationDomain($result['aliasdomain'], $log); triggerLetsEncryptCSRForAliasDestinationDomain($aliasdomain, $log); } else if ($result['wwwserveralias'] != $wwwserveralias || $result['letsencrypt'] != $letsencrypt) { // or when wwwserveralias or letsencrypt was changed triggerLetsEncryptCSRForAliasDestinationDomain($aliasdomain, $log); } inserttask('1'); // Using nameserver, insert a task which rebuilds the server config inserttask('4'); } redirectTo($filename, array('page' => $page, 's' => $s)); } } else { $result['domain'] = $idna_convert->decode($result['domain']); $domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true); // also check ip/port combination to be the same, #176 $domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` <> :id AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`parentdomainid` = '0' AND `d`.`customerid` = :customerid AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = :id) GROUP BY `d`.`id`, `d`.`domain` ORDER BY `d`.`domain` ASC" ); Database::pexecute($domains_stmt, array("id" => $result['id'], "customerid" => $userinfo['customerid'])); while ($row_domain = $domains_stmt->fetch(PDO::FETCH_ASSOC)) { $domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id'], $result['aliasdomain']); } if (preg_match('/^https?\:\/\//', $result['documentroot']) && validateUrl($result['documentroot'])) { if (Settings::Get('panel.pathedit') == 'Dropdown') { $urlvalue = $result['documentroot']; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']); } else { $urlvalue = ''; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $result['documentroot'], true); } } else { $urlvalue = ''; $pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $result['documentroot']); } $redirectcode = ''; if (Settings::Get('customredirect.enabled') == '1') { $def_code = getDomainRedirectId($id); $codes = getRedirectCodesArray(); foreach ($codes as $rc) { $redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $def_code); } } // check if we at least have one ssl-ip/port, #1179 $ssl_ipsandports = ''; $ssl_ip_stmt = Database::prepare("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'"); Database::pexecute($ssl_ip_stmt); $resultX = $ssl_ip_stmt->fetch(PDO::FETCH_ASSOC); if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) { $ssl_ipsandports = 'notempty'; } // Fudge the result for ssl_redirect to hide the Let's Encrypt steps $result['temporary_ssl_redirect'] = $result['ssl_redirect']; $result['ssl_redirect'] = ($result['ssl_redirect'] == 0 ? 0 : 1); $openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true); // create serveralias options $serveraliasoptions = ""; $_value = '2'; if ($result['iswildcarddomain'] == '1') { $_value = '0'; } elseif ($result['wwwserveralias'] == '1') { $_value = '1'; } $serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_wildcard'], '0', $_value, true, true); $serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_www'], '1', $_value, true, true); $serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_none'], '2', $_value, true, true); $ips_stmt = Database::prepare("SELECT `p`.`ip` AS `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` `p` LEFT JOIN `".TABLE_DOMAINTOIP."` `dip` ON ( `dip`.`id_ipandports` = `p`.`id` ) WHERE `dip`.`id_domain` = :id_domain GROUP BY `p`.`ip`" ); Database::pexecute($ips_stmt, array("id_domain" => $result['id'])); $result_ipandport['ip'] = ''; while ($rowip = $ips_stmt->fetch(PDO::FETCH_ASSOC)) { $result_ipandport['ip'] .= $rowip['ip'] . "
"; } $domainip = $result_ipandport['ip']; $result = htmlentities_array($result); $subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php'; $subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data); $title = $subdomain_edit_data['domain_edit']['title']; $image = $subdomain_edit_data['domain_edit']['image']; eval("echo \"" . getTemplate("domains/domains_edit") . "\";"); } } else { standard_error('domains_canteditdomain'); } } } elseif ($page == 'domainssleditor') { if ($action == '' || $action == 'view') { if (isset($_POST['send']) && $_POST['send'] == 'send') { $ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : ''; $ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : ''; $ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : ''; $ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : ''; $do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false; if ($ssl_cert_file != '' && $ssl_key_file == '') { standard_error('sslcertificateismissingprivatekey'); } $do_verify = true; // no cert-file given -> forget everything if ($ssl_cert_file == '') { $ssl_key_file = ''; $ssl_ca_file = ''; $ssl_cert_chainfile = ''; $do_verify = false; } // verify certificate content if ($do_verify) { // array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] ) // openssl_x509_parse() returns information about the supplied x509cert, including fields such as // subject name, issuer name, purposes, valid from and valid to dates etc. $cert_content = openssl_x509_parse($ssl_cert_file); if (is_array($cert_content) && isset($cert_content['subject']) && isset($cert_content['subject']['CN'])) { // bool openssl_x509_check_private_key ( mixed $cert , mixed $key ) // Checks whether the given key is the private key that corresponds to cert. if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) { standard_error('sslcertificateinvalidcertkeypair'); } // check optional stuff if ($ssl_ca_file != '') { $ca_content = openssl_x509_parse($ssl_ca_file); if (!is_array($ca_content)) { // invalid standard_error('sslcertificateinvalidca'); } } if ($ssl_cert_chainfile != '') { $chain_content = openssl_x509_parse($ssl_cert_chainfile); if (!is_array($chain_content)) { // invalid standard_error('sslcertificateinvalidchain'); } } } else { standard_error('sslcertificateinvalidcert'); } } // Add/Update database entry $qrystart = "UPDATE "; $qrywhere = "WHERE "; if ($do_insert) { $qrystart = "INSERT INTO "; $qrywhere = ", "; } $stmt = Database::prepare($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET `ssl_cert_file` = :ssl_cert_file, `ssl_key_file` = :ssl_key_file, `ssl_ca_file` = :ssl_ca_file, `ssl_cert_chainfile` = :ssl_cert_chainfile ".$qrywhere." `domainid`= :domainid" ); $params = array( "ssl_cert_file" => $ssl_cert_file, "ssl_key_file" => $ssl_key_file, "ssl_ca_file" => $ssl_ca_file, "ssl_cert_chainfile" => $ssl_cert_chainfile, "domainid" => $id ); Database::pexecute($stmt, $params); // insert task to re-generate webserver-configs (#1260) inserttask('1'); // back to domain overview redirectTo($filename, array('page' => 'domains', 's' => $s)); } $stmt = Database::prepare("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`= :domainid" ); Database::pexecute($stmt, array("domainid" => $id)); $result = $stmt->fetch(PDO::FETCH_ASSOC); $do_insert = false; // if no entry can be found, behave like we have empty values if (!is_array($result) || !isset($result['ssl_cert_file'])) { $result = array( 'ssl_cert_file' => '', 'ssl_key_file' => '', 'ssl_ca_file' => '', 'ssl_cert_chainfile' => '' ); $do_insert = true; } $result = htmlentities_array($result); $ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php'; $ssleditor_form = htmlform::genHTMLForm($ssleditor_data); $title = $ssleditor_data['domain_ssleditor']['title']; $image = $ssleditor_data['domain_ssleditor']['image']; eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";"); } } elseif ($page == 'domaindnseditor' && $userinfo['dnsenabled'] == '1' && Settings::Get('system.dnsenabled') == '1') { require_once __DIR__.'/dns_editor.php'; } elseif ($page == 'sslcertificates') { require_once __DIR__.'/ssl_certificates.php'; }