(2010-) * @license GPLv2 http://files.froxlor.org/misc/COPYING.txt * @package API * @since 0.10.0 * */ class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntity { /** * add new ssl-certificate entry for given domain by either id or domainname * * @param int $id * optional, the domain-id * @param string $domainname * optional, the domainname * @param string $ssl_cert_file * @param string $ssl_key_file * @param string $ssl_ca_file * optional * @param string $ssl_cert_chainfile * optional * * @access admin, customer * @throws \Exception * @return string json-encoded array */ public function add() { $domainid = $this->getParam('domainid', true, 0); $dn_optional = ($domainid <= 0 ? false : true); $domainname = $this->getParam('domainname', $dn_optional, ''); if ($this->isAdmin() == false && Settings::IsInList('panel.customer_hide_options', 'domains')) { throw new \Exception("You cannot access this resource", 405); } $domain = $this->apiCall('SubDomains.get', array( 'id' => $domainid, 'domainname' => $domainname )); $domainid = $domain['id']; // parameters $ssl_cert_file = $this->getParam('ssl_cert_file'); $ssl_key_file = $this->getParam('ssl_key_file'); $ssl_ca_file = $this->getParam('ssl_ca_file', true, ''); $ssl_cert_chainfile = $this->getParam('ssl_cert_chainfile', true, ''); // validate whether the domain does not already have an entry $has_cert = true; try { $this->apiCall('Certificates.get', array( 'id' => $domainid )); } catch (\Exception $e) { if ($e->getCode() == 412) { $has_cert = false; } else { throw $e; } } if (! $has_cert) { $this->addOrUpdateCertificate($domain['id'], $ssl_cert_file, $ssl_key_file, $ssl_ca_file, $ssl_cert_chainfile, true); $this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] added ssl-certificate for '" . $domain['domain'] . "'"); $result = $this->apiCall('Certificates.get', array( 'id' => $domain['id'] )); return $this->response(200, "successfull", $result); } throw new \Exception("Domain '" . $domain['domain'] . "' already has a certificate. Did you mean to call update?", 406); } /** * return ssl-certificate entry for given domain by either id or domainname * * @param int $id * optional, the domain-id * @param string $domainname * optional, the domainname * * @access admin, customer * @throws \Exception * @return string json-encoded array */ public function get() { $id = $this->getParam('id', true, 0); $dn_optional = ($id <= 0 ? false : true); $domainname = $this->getParam('domainname', $dn_optional, ''); if ($this->isAdmin() == false && Settings::IsInList('panel.customer_hide_options', 'domains')) { throw new \Exception("You cannot access this resource", 405); } $domain = $this->apiCall('SubDomains.get', array( 'id' => $id, 'domainname' => $domainname )); $domainid = $domain['id']; $stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE `domainid`= :domainid"); $this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] get ssl-certificate for '" . $domain['domain'] . "'"); $result = Database::pexecute_first($stmt, array( "domainid" => $domainid )); if (! $result) { throw new \Exception("Domain '" . $domain['domain'] . "' does not have a certificate.", 412); } return $this->response(200, "successfull", $result); } /** * update ssl-certificate entry for given domain by either id or domainname * * @param int $id * optional, the domain-id * @param string $domainname * optional, the domainname * @param string $ssl_cert_file * @param string $ssl_key_file * @param string $ssl_ca_file * optional * @param string $ssl_cert_chainfile * optional * * @access admin, customer * @throws \Exception * @return string json-encoded array */ public function update() { $id = $this->getParam('id', true, 0); $dn_optional = ($id <= 0 ? false : true); $domainname = $this->getParam('domainname', $dn_optional, ''); if ($this->isAdmin() == false && Settings::IsInList('panel.customer_hide_options', 'domains')) { throw new \Exception("You cannot access this resource", 405); } $domain = $this->apiCall('SubDomains.get', array( 'id' => $id, 'domainname' => $domainname )); // parameters $ssl_cert_file = $this->getParam('ssl_cert_file'); $ssl_key_file = $this->getParam('ssl_key_file'); $ssl_ca_file = $this->getParam('ssl_ca_file', true, ''); $ssl_cert_chainfile = $this->getParam('ssl_cert_chainfile', true, ''); $this->addOrUpdateCertificate($domain['id'], $ssl_cert_file, $ssl_key_file, $ssl_ca_file, $ssl_cert_chainfile, false); $this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] updated ssl-certificate for '" . $domain['domain'] . "'"); $result = $this->apiCall('Certificates.get', array( 'id' => $domain['id'] )); return $this->response(200, "successfull", $result); } /** * lists all certificate entries * * @param array $sql_search * optional array with index = fieldname, and value = array with 'op' => operator (one of <, > or =), LIKE is used if left empty and 'value' => searchvalue * @param int $sql_limit * optional specify number of results to be returned * @param int $sql_offset * optional specify offset for resultset * @param array $sql_orderby * optional array with index = fieldname and value = ASC|DESC to order the resultset by one or more fields * * @access admin, customer * @throws \Exception * @return string json-encoded array count|list */ public function listing() { // select all my (accessable) certificates $certs_stmt_query = "SELECT s.*, d.domain, d.letsencrypt, c.customerid, c.loginname FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid` LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `d`.`customerid` WHERE "; $qry_params = array(); $query_fields = array(); if ($this->isAdmin() && $this->getUserDetail('customers_see_all') == '0') { // admin with only customer-specific permissions $certs_stmt_query .= "d.adminid = :adminid "; $qry_params['adminid'] = $this->getUserDetail('adminid'); } elseif ($this->isAdmin() == false) { // customer-area $certs_stmt_query .= "d.customerid = :cid "; $qry_params['cid'] = $this->getUserDetail('customerid'); } else { $certs_stmt_query .= "1 "; } $certs_stmt = Database::prepare($certs_stmt_query . $this->getSearchWhere($query_fields) . $this->getOrderBy() . $this->getLimit()); $qry_params = array_merge($qry_params, $query_fields); Database::pexecute($certs_stmt, $qry_params, true, true); $result = array(); while ($cert = $certs_stmt->fetch(\PDO::FETCH_ASSOC)) { // respect froxlor-hostname if ($cert['domainid'] == 0) { $cert['domain'] = Settings::Get('system.hostname'); $cert['letsencrypt'] = Settings::Get('system.le_froxlor_enabled'); $cert['loginname'] = 'froxlor.panel'; } $result[] = $cert; } return $this->response(200, "successfull", array( 'count' => count($result), 'list' => $result )); } /** * returns the total number of certificates for the given user * * @access admin, customer * @throws \Exception * @return string json-encoded array */ public function listingCount() { // select all my (accessable) certificates $certs_stmt_query = "SELECT COUNT(*) as num_certs FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid` LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `d`.`customerid` WHERE "; $qry_params = array(); if ($this->isAdmin() && $this->getUserDetail('customers_see_all') == '0') { // admin with only customer-specific permissions $certs_stmt_query .= "d.adminid = :adminid "; $qry_params['adminid'] = $this->getUserDetail('adminid'); } elseif ($this->isAdmin() == false) { // customer-area $certs_stmt_query .= "d.customerid = :cid "; $qry_params['cid'] = $this->getUserDetail('customerid'); } else { $certs_stmt_query .= "1 "; } $certs_stmt = Database::prepare($certs_stmt_query); $result = Database::pexecute_first($certs_stmt, $qry_params, true, true); if ($result) { return $this->response(200, "successfull", $result['num_certs']); } } /** * delete certificates entry by id * * @param int $id * * @throws \Exception * @return string json-encoded array */ public function delete() { $id = $this->getParam('id'); if ($this->isAdmin() == false) { $chk_stmt = Database::prepare(" SELECT d.domain, d.letsencrypt FROM `" . TABLE_PANEL_DOMAINS . "` d LEFT JOIN `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s ON s.domainid = d.id WHERE s.`id` = :id AND d.`customerid` = :cid "); $chk = Database::pexecute_first($chk_stmt, array( 'id' => $id, 'cid' => $this->getUserDetail('customerid') )); } elseif ($this->isAdmin()) { $chk_stmt = Database::prepare(" SELECT d.domain, d.letsencrypt FROM `" . TABLE_PANEL_DOMAINS . "` d LEFT JOIN `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s ON s.domainid = d.id WHERE s.`id` = :id" . ($this->getUserDetail('customers_see_all') == '0' ? " AND d.`adminid` = :aid" : "")); $params = array( 'id' => $id ); if ($this->getUserDetail('customers_see_all') == '0') { $params['aid'] = $this->getUserDetail('adminid'); } $chk = Database::pexecute_first($chk_stmt, $params); if ($chk == false && $this->getUserDetail('change_serversettings')) { // check whether it might be the froxlor-vhost certificate $chk_stmt = Database::prepare(" SELECT \"" . Settings::Get('system.hostname') . "\" as domain, \"" . Settings::Get('system.le_froxlor_enabled') . "\" as letsencrypt FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE `id` = :id AND `domainid` = '0'"); $params = array( 'id' => $id ); $chk = Database::pexecute_first($chk_stmt, $params); $chk['isFroxlorVhost'] = true; } } if ($chk !== false) { // additional access check by trying to get the certificate if (isset($chk['isFroxlorVhost']) && $chk['isFroxlorVhost'] == true) { $result = $chk; } else { $result = $this->apiCall('Certificates.get', array( 'domainname' => $chk['domain'] )); } $del_stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE id = :id"); Database::pexecute($del_stmt, array( 'id' => $id )); // trigger removing of certificate from acme.sh if let's encrypt if ($chk['letsencrypt'] == '1') { \Froxlor\System\Cronjob::inserttask('12', $chk['domain']); } $this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] removed ssl-certificate for '" . $chk['domain'] . "'"); return $this->response(200, "successfull", $result); } throw new \Exception("Unable to determine SSL certificate. Maybe no access?", 406); } /** * insert or update certificates entry * * @param int $domainid * @param string $ssl_cert_file * @param string $ssl_key_file * @param string $ssl_ca_file * @param string $ssl_cert_chainfile * @param boolean $do_insert * optional default false * * @return boolean * @throws \Exception */ private function addOrUpdateCertificate($domainid = 0, $ssl_cert_file = '', $ssl_key_file = '', $ssl_ca_file = '', $ssl_cert_chainfile = '', $do_insert = false) { if ($ssl_cert_file != '' && $ssl_key_file == '') { \Froxlor\UI\Response::standard_error('sslcertificateismissingprivatekey', '', true); } $do_verify = true; $expirationdate = null; // no cert-file given -> forget everything if ($ssl_cert_file == '') { $ssl_key_file = ''; $ssl_ca_file = ''; $ssl_cert_chainfile = ''; $do_verify = false; } // verify certificate content if ($do_verify) { // array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] ) // openssl_x509_parse() returns information about the supplied x509cert, including fields such as // subject name, issuer name, purposes, valid from and valid to dates etc. $cert_content = openssl_x509_parse($ssl_cert_file); if (is_array($cert_content) && isset($cert_content['subject']) && isset($cert_content['subject']['CN'])) { // bool openssl_x509_check_private_key ( mixed $cert , mixed $key ) // Checks whether the given key is the private key that corresponds to cert. if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) { \Froxlor\UI\Response::standard_error('sslcertificateinvalidcertkeypair', '', true); } // check optional stuff if ($ssl_ca_file != '') { $ca_content = openssl_x509_parse($ssl_ca_file); if (! is_array($ca_content)) { // invalid \Froxlor\UI\Response::standard_error('sslcertificateinvalidca', '', true); } } if ($ssl_cert_chainfile != '') { $chain_content = openssl_x509_parse($ssl_cert_chainfile); if (! is_array($chain_content)) { // invalid \Froxlor\UI\Response::standard_error('sslcertificateinvalidchain', '', true); } } } else { \Froxlor\UI\Response::standard_error('sslcertificateinvalidcert', '', true); } $expirationdate = empty($cert_content['validTo_time_t']) ? null : date("Y-m-d H:i:s", $cert_content['validTo_time_t']); } // Add/Update database entry $qrystart = "UPDATE "; $qrywhere = "WHERE "; if ($do_insert) { $qrystart = "INSERT INTO "; $qrywhere = ", "; } $stmt = Database::prepare($qrystart . " `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` SET `ssl_cert_file` = :ssl_cert_file, `ssl_key_file` = :ssl_key_file, `ssl_ca_file` = :ssl_ca_file, `ssl_cert_chainfile` = :ssl_cert_chainfile, `expirationdate` = :expirationdate " . $qrywhere . " `domainid`= :domainid "); $params = array( "ssl_cert_file" => $ssl_cert_file, "ssl_key_file" => $ssl_key_file, "ssl_ca_file" => $ssl_ca_file, "ssl_cert_chainfile" => $ssl_cert_chainfile, "expirationdate" => $expirationdate, "domainid" => $domainid ); Database::pexecute($stmt, $params, true, true); // insert task to re-generate webserver-configs (#1260) \Froxlor\System\Cronjob::inserttask('1'); return true; } }