Files
Froxlor/lib/Froxlor/Api/Commands/Certificates.php
Oskar Eisemuth 4a912e3902 Feature/crontaskid (#1005)
* Add \Froxlor\Cron\TaskId for fixed task id naming

* Replace Cronjob::inserttask numbers with \Froxlor\Cron\TaskId constants

* Use TaskId in Froxlor\Cron\System\TasksCron

* Use TaskId in Froxlor\System\Cronjob,
simplify getOutstandingTasks.
Rename lng['tasks'] cronjob task description.
WARNING: DELETE_DOMAIN_PDNS, DELETE_DOMAIN_SSL now use %domain%

* Remove Froxlor\System\Cronjob type 3 check
2022-01-21 10:03:45 +01:00

428 lines
15 KiB
PHP

<?php
namespace Froxlor\Api\Commands;
use Froxlor\Database\Database;
use Froxlor\Settings;
/**
* This file is part of the Froxlor project.
* Copyright (c) 2010 the Froxlor Team (see authors).
*
* For the full copyright and license information, please view the COPYING
* file that was distributed with this source code. You can also view the
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
*
* @copyright (c) the authors
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package API
* @since 0.10.0
*
*/
class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntity
{
/**
* add new ssl-certificate entry for given domain by either id or domainname
*
* @param int $id
* optional, the domain-id
* @param string $domainname
* optional, the domainname
* @param string $ssl_cert_file
* @param string $ssl_key_file
* @param string $ssl_ca_file
* optional
* @param string $ssl_cert_chainfile
* optional
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
*/
public function add()
{
$domainid = $this->getParam('domainid', true, 0);
$dn_optional = ($domainid <= 0 ? false : true);
$domainname = $this->getParam('domainname', $dn_optional, '');
if ($this->isAdmin() == false && Settings::IsInList('panel.customer_hide_options', 'domains')) {
throw new \Exception("You cannot access this resource", 405);
}
$domain = $this->apiCall('SubDomains.get', array(
'id' => $domainid,
'domainname' => $domainname
));
$domainid = $domain['id'];
// parameters
$ssl_cert_file = $this->getParam('ssl_cert_file');
$ssl_key_file = $this->getParam('ssl_key_file');
$ssl_ca_file = $this->getParam('ssl_ca_file', true, '');
$ssl_cert_chainfile = $this->getParam('ssl_cert_chainfile', true, '');
// validate whether the domain does not already have an entry
$has_cert = true;
try {
$this->apiCall('Certificates.get', array(
'id' => $domainid
));
} catch (\Exception $e) {
if ($e->getCode() == 412) {
$has_cert = false;
} else {
throw $e;
}
}
if (! $has_cert) {
$this->addOrUpdateCertificate($domain['id'], $ssl_cert_file, $ssl_key_file, $ssl_ca_file, $ssl_cert_chainfile, true);
$this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] added ssl-certificate for '" . $domain['domain'] . "'");
$result = $this->apiCall('Certificates.get', array(
'id' => $domain['id']
));
return $this->response(200, "successful", $result);
}
throw new \Exception("Domain '" . $domain['domain'] . "' already has a certificate. Did you mean to call update?", 406);
}
/**
* return ssl-certificate entry for given domain by either id or domainname
*
* @param int $id
* optional, the domain-id
* @param string $domainname
* optional, the domainname
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
*/
public function get()
{
$id = $this->getParam('id', true, 0);
$dn_optional = ($id <= 0 ? false : true);
$domainname = $this->getParam('domainname', $dn_optional, '');
if ($this->isAdmin() == false && Settings::IsInList('panel.customer_hide_options', 'domains')) {
throw new \Exception("You cannot access this resource", 405);
}
$domain = $this->apiCall('SubDomains.get', array(
'id' => $id,
'domainname' => $domainname
));
$domainid = $domain['id'];
$stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE `domainid`= :domainid");
$this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] get ssl-certificate for '" . $domain['domain'] . "'");
$result = Database::pexecute_first($stmt, array(
"domainid" => $domainid
));
if (! $result) {
throw new \Exception("Domain '" . $domain['domain'] . "' does not have a certificate.", 412);
}
return $this->response(200, "successful", $result);
}
/**
* update ssl-certificate entry for given domain by either id or domainname
*
* @param int $id
* optional, the domain-id
* @param string $domainname
* optional, the domainname
* @param string $ssl_cert_file
* @param string $ssl_key_file
* @param string $ssl_ca_file
* optional
* @param string $ssl_cert_chainfile
* optional
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
*/
public function update()
{
$id = $this->getParam('id', true, 0);
$dn_optional = ($id <= 0 ? false : true);
$domainname = $this->getParam('domainname', $dn_optional, '');
if ($this->isAdmin() == false && Settings::IsInList('panel.customer_hide_options', 'domains')) {
throw new \Exception("You cannot access this resource", 405);
}
$domain = $this->apiCall('SubDomains.get', array(
'id' => $id,
'domainname' => $domainname
));
// parameters
$ssl_cert_file = $this->getParam('ssl_cert_file');
$ssl_key_file = $this->getParam('ssl_key_file');
$ssl_ca_file = $this->getParam('ssl_ca_file', true, '');
$ssl_cert_chainfile = $this->getParam('ssl_cert_chainfile', true, '');
$this->addOrUpdateCertificate($domain['id'], $ssl_cert_file, $ssl_key_file, $ssl_ca_file, $ssl_cert_chainfile, false);
$this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] updated ssl-certificate for '" . $domain['domain'] . "'");
$result = $this->apiCall('Certificates.get', array(
'id' => $domain['id']
));
return $this->response(200, "successful", $result);
}
/**
* lists all certificate entries
*
* @param array $sql_search
* optional array with index = fieldname, and value = array with 'op' => operator (one of <, > or =), LIKE is used if left empty and 'value' => searchvalue
* @param int $sql_limit
* optional specify number of results to be returned
* @param int $sql_offset
* optional specify offset for resultset
* @param array $sql_orderby
* optional array with index = fieldname and value = ASC|DESC to order the resultset by one or more fields
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array count|list
*/
public function listing()
{
// select all my (accessible) certificates
$certs_stmt_query = "SELECT s.*, d.domain, d.letsencrypt, c.customerid, c.loginname
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `d`.`customerid`
WHERE ";
$qry_params = array();
$query_fields = array();
if ($this->isAdmin() && $this->getUserDetail('customers_see_all') == '0') {
// admin with only customer-specific permissions
$certs_stmt_query .= "d.adminid = :adminid ";
$qry_params['adminid'] = $this->getUserDetail('adminid');
} elseif ($this->isAdmin() == false) {
// customer-area
$certs_stmt_query .= "d.customerid = :cid ";
$qry_params['cid'] = $this->getUserDetail('customerid');
} else {
$certs_stmt_query .= "1 ";
}
$certs_stmt = Database::prepare($certs_stmt_query . $this->getSearchWhere($query_fields, true) . $this->getOrderBy() . $this->getLimit());
$qry_params = array_merge($qry_params, $query_fields);
Database::pexecute($certs_stmt, $qry_params, true, true);
$result = array();
while ($cert = $certs_stmt->fetch(\PDO::FETCH_ASSOC)) {
// respect froxlor-hostname
if ($cert['domainid'] == 0) {
$cert['domain'] = Settings::Get('system.hostname');
$cert['letsencrypt'] = Settings::Get('system.le_froxlor_enabled');
$cert['loginname'] = 'froxlor.panel';
}
$result[] = $cert;
}
return $this->response(200, "successful", array(
'count' => count($result),
'list' => $result
));
}
/**
* returns the total number of certificates for the given user
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
*/
public function listingCount()
{
// select all my (accessible) certificates
$certs_stmt_query = "SELECT COUNT(*) as num_certs
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `d`.`customerid`
WHERE ";
$qry_params = array();
if ($this->isAdmin() && $this->getUserDetail('customers_see_all') == '0') {
// admin with only customer-specific permissions
$certs_stmt_query .= "d.adminid = :adminid ";
$qry_params['adminid'] = $this->getUserDetail('adminid');
} elseif ($this->isAdmin() == false) {
// customer-area
$certs_stmt_query .= "d.customerid = :cid ";
$qry_params['cid'] = $this->getUserDetail('customerid');
} else {
$certs_stmt_query .= "1 ";
}
$certs_stmt = Database::prepare($certs_stmt_query);
$result = Database::pexecute_first($certs_stmt, $qry_params, true, true);
if ($result) {
return $this->response(200, "successful", $result['num_certs']);
}
}
/**
* delete certificates entry by id
*
* @param int $id
*
* @throws \Exception
* @return string json-encoded array
*/
public function delete()
{
$id = $this->getParam('id');
if ($this->isAdmin() == false) {
$chk_stmt = Database::prepare("
SELECT d.domain, d.letsencrypt FROM `" . TABLE_PANEL_DOMAINS . "` d
LEFT JOIN `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s ON s.domainid = d.id
WHERE s.`id` = :id AND d.`customerid` = :cid
");
$chk = Database::pexecute_first($chk_stmt, array(
'id' => $id,
'cid' => $this->getUserDetail('customerid')
));
} elseif ($this->isAdmin()) {
$chk_stmt = Database::prepare("
SELECT d.domain, d.letsencrypt FROM `" . TABLE_PANEL_DOMAINS . "` d
LEFT JOIN `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s ON s.domainid = d.id
WHERE s.`id` = :id" . ($this->getUserDetail('customers_see_all') == '0' ? " AND d.`adminid` = :aid" : ""));
$params = array(
'id' => $id
);
if ($this->getUserDetail('customers_see_all') == '0') {
$params['aid'] = $this->getUserDetail('adminid');
}
$chk = Database::pexecute_first($chk_stmt, $params);
if ($chk == false && $this->getUserDetail('change_serversettings')) {
// check whether it might be the froxlor-vhost certificate
$chk_stmt = Database::prepare("
SELECT \"" . Settings::Get('system.hostname') . "\" as domain, \"" . Settings::Get('system.le_froxlor_enabled') . "\" as letsencrypt FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "`
WHERE `id` = :id AND `domainid` = '0'");
$params = array(
'id' => $id
);
$chk = Database::pexecute_first($chk_stmt, $params);
$chk['isFroxlorVhost'] = true;
}
}
if ($chk !== false) {
// additional access check by trying to get the certificate
if (isset($chk['isFroxlorVhost']) && $chk['isFroxlorVhost'] == true) {
$result = $chk;
} else {
$result = $this->apiCall('Certificates.get', array(
'domainname' => $chk['domain']
));
}
$del_stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE id = :id");
Database::pexecute($del_stmt, array(
'id' => $id
));
// trigger removing of certificate from acme.sh if let's encrypt
if ($chk['letsencrypt'] == '1') {
\Froxlor\System\Cronjob::inserttask(\Froxlor\Cron\TaskId::DELETE_DOMAIN_SSL, $chk['domain']);
}
$this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_INFO, "[API] removed ssl-certificate for '" . $chk['domain'] . "'");
return $this->response(200, "successful", $result);
}
throw new \Exception("Unable to determine SSL certificate. Maybe no access?", 406);
}
/**
* insert or update certificates entry
*
* @param int $domainid
* @param string $ssl_cert_file
* @param string $ssl_key_file
* @param string $ssl_ca_file
* @param string $ssl_cert_chainfile
* @param boolean $do_insert
* optional default false
*
* @return boolean
* @throws \Exception
*/
private function addOrUpdateCertificate($domainid = 0, $ssl_cert_file = '', $ssl_key_file = '', $ssl_ca_file = '', $ssl_cert_chainfile = '', $do_insert = false)
{
if ($ssl_cert_file != '' && $ssl_key_file == '') {
\Froxlor\UI\Response::standard_error('sslcertificateismissingprivatekey', '', true);
}
$do_verify = true;
$expirationdate = null;
// no cert-file given -> forget everything
if ($ssl_cert_file == '') {
$ssl_key_file = '';
$ssl_ca_file = '';
$ssl_cert_chainfile = '';
$do_verify = false;
}
// verify certificate content
if ($do_verify) {
// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
// openssl_x509_parse() returns information about the supplied x509cert, including fields such as
// subject name, issuer name, purposes, valid from and valid to dates etc.
$cert_content = openssl_x509_parse($ssl_cert_file);
if (is_array($cert_content) && isset($cert_content['subject']) && isset($cert_content['subject']['CN'])) {
// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
// Checks whether the given key is the private key that corresponds to cert.
if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
\Froxlor\UI\Response::standard_error('sslcertificateinvalidcertkeypair', '', true);
}
// check optional stuff
if ($ssl_ca_file != '') {
$ca_content = openssl_x509_parse($ssl_ca_file);
if (! is_array($ca_content)) {
// invalid
\Froxlor\UI\Response::standard_error('sslcertificateinvalidca', '', true);
}
}
if ($ssl_cert_chainfile != '') {
$chain_content = openssl_x509_parse($ssl_cert_chainfile);
if (! is_array($chain_content)) {
// invalid
\Froxlor\UI\Response::standard_error('sslcertificateinvalidchain', '', true);
}
}
} else {
\Froxlor\UI\Response::standard_error('sslcertificateinvalidcert', '', true);
}
$expirationdate = empty($cert_content['validTo_time_t']) ? null : date("Y-m-d H:i:s", $cert_content['validTo_time_t']);
}
// Add/Update database entry
$qrystart = "UPDATE ";
$qrywhere = "WHERE ";
if ($do_insert) {
$qrystart = "INSERT INTO ";
$qrywhere = ", ";
}
$stmt = Database::prepare($qrystart . " `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` SET
`ssl_cert_file` = :ssl_cert_file,
`ssl_key_file` = :ssl_key_file,
`ssl_ca_file` = :ssl_ca_file,
`ssl_cert_chainfile` = :ssl_cert_chainfile,
`expirationdate` = :expirationdate
" . $qrywhere . " `domainid`= :domainid
");
$params = array(
"ssl_cert_file" => $ssl_cert_file,
"ssl_key_file" => $ssl_key_file,
"ssl_ca_file" => $ssl_ca_file,
"ssl_cert_chainfile" => $ssl_cert_chainfile,
"expirationdate" => $expirationdate,
"domainid" => $domainid
);
Database::pexecute($stmt, $params, true, true);
// insert task to re-generate webserver-configs (#1260)
\Froxlor\System\Cronjob::inserttask(\Froxlor\Cron\TaskId::REBUILD_VHOST);
return true;
}
}