Compare commits

..

107 Commits

Author SHA1 Message Date
Michael Kaufmann
ec1c37aa06 set version to 0.10.28 for upcoming release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-20 09:23:23 +02:00
Nicolas
67351ec3c2 Adding support for PowerDNS-Replication (#974)
Adding support for powerdns-replication
2021-08-19 12:00:09 +02:00
Michael Kaufmann
f1887aaaf2 enable iterate_query in dovecot by default
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-13 09:28:10 +02:00
Michael Kaufmann
afd2d7b5e9 fix dns-validation in Domains.add() and Domains.update() when using Let's Encrypt DNS-check
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-08 11:14:57 +02:00
Michael Kaufmann
c967e585b5 avoid duplicate entries in mysql-access-host setting
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-06 08:11:06 +02:00
Michael Kaufmann
73e364d4ba fix compare of old/new value of aliasdomain when editing a domain as customer to avoid unnecessary regeneration of configfiles
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-04 14:55:22 +02:00
Michael Kaufmann
eb49331b21 remove superfluous inserttask when editing domain as it will be called when there are actually changes to the domain earlier
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-04 14:06:32 +02:00
Michael Kaufmann
0a1a3e023f check dns for lets encrypt when adding/editing domains and via cron; fixes #971
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-04 13:44:13 +02:00
Michael Kaufmann
bef5cedcd0 only add link to customername when editing domain when panel.allow_domain_change_customer is false
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-02 16:58:34 +02:00
Stefan Weil
f8e2bc7bff Fix some typos in code (found by codespell) (#970)
Signed-off-by: Stefan Weil <sw@weilnetz.de>
2021-08-01 19:00:33 +02:00
Stefan Weil
09038ac7aa Fix some typos (found by codespell) (#969)
Signed-off-by: Stefan Weil <sw@weilnetz.de>
2021-07-31 09:51:54 +02:00
Michael Kaufmann
4c507232c7 add setting for a custom system group for all customer-users (required libnss-extrausers); fixes #953
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-30 12:16:37 +02:00
Michael Kaufmann
86939a64da add buypass testing/staging ACME endpoint; create CAA entries accordingly if activated; refs #968
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-29 21:24:43 +02:00
Jens Meißner
926ce427fc Add Buypass to the list of ACME providers. (#968) 2021-07-29 21:15:49 +02:00
Michael Kaufmann
53401eebfb integrity check should allow utf8_* charachter sets and not only 'utf8', thx to lod
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-29 21:04:46 +02:00
Michael Kaufmann
bef580929e Update README.md 2021-07-27 08:14:08 +02:00
Michael Kaufmann
c7b7c67ff4 normalize ipv6 addresses to avoid possible comparison problems; fixes #965
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-26 17:53:44 +02:00
Michael Kaufmann
ed42d4e3df try to fix github action...
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-24 20:31:34 +02:00
Michael Kaufmann
69a2ebce36 create user as froxlor would create it for mysql-8.0
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-24 20:29:56 +02:00
Michael Kaufmann
15f08739fa add github action workflow for mysql
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-24 20:17:42 +02:00
nachtgeist
571690c8c5 admin_customers/edit domain: make customer login name a link (#962) 2021-07-23 16:35:31 +02:00
rex2630
b2005d7f29 [WIP] Czech language (#870)
* Update czech.lng.php
2021-07-21 20:41:07 +02:00
Michael Kaufmann
4354598c64 fix unittests
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 10:21:58 +02:00
Michael Kaufmann
05d4bdc499 restore behaviour for unittests as 'create stdsubdomain' default was yes in the settings but no for direct API usage
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 10:10:18 +02:00
Michael Kaufmann
25c6a37df2 fix wrong variable-name in Customers.delete()
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 10:03:20 +02:00
Michael Kaufmann
41a470fe36 added option to disable creation of default subdomain; fixes #960
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 09:53:54 +02:00
Michael Kaufmann
8a4aa2a721 fix lng strings
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-20 23:45:57 +02:00
Michael Kaufmann
1d903770fc have more power over theme logo, custom theme logo and uploaded logo; refs #958
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-20 20:35:54 +02:00
Nicolas
934be5a238 Fix SOA-Record (#959) 2021-07-20 19:29:06 +02:00
Michael Kaufmann
5608f0407f correct heredoc indentation in AcmeSh for php-7.1; fixes #957
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-20 08:11:32 +02:00
Kai
ce9d8dad7f Feature-request #672 - database name prefixes + custom name (#956)
* Fix makeoption function call

* Update formfield.mysql_add.php

Added database name

* Update formfield.mysql_add.php

* Update formfield.mysql_add.php

* Update Mysqls.php

* Update DbManager.php

* Update formfield.mysql_add.php

* Update german.lng.php

* Update formfield.mysql_add.php

* Update Mysqls.php

* Added field database_name (Feature #672)

* Added Testfunction for customer choosed database name

* Fixed test for customer choosed database name
Added docs for param $name

* Fixed mysql api command add
Removed doubled code

* Set settings for customer choosed db name

* Fixed wrong excepted for database name

* Renamed parameter database_name to custom_suffix

* Changed testCustomerMysqlsList
Added testCustomerMysqlsDBNameDelete
2021-07-19 19:10:12 +02:00
Michael Kaufmann
d6fe263e68 Update issue templates 2021-07-19 07:20:46 +02:00
Michael Kaufmann
156846a845 set version to 0.10.27 for upcoming release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-18 10:57:38 +02:00
Michael Kaufmann
abe00b79a7 Update README.md
add github actions build badge
2021-07-17 14:16:29 +02:00
Michael Kaufmann
26ab659c6a Ga testing (#955)
* switch from travis-ci to github actions

Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-17 14:14:35 +02:00
Michael Kaufmann
b0273c68d2 remove debian jessie config-templates (outdated); set debian stretch as deprecated; add debian bullseye config templates
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-16 12:15:03 +02:00
Michael Kaufmann
720cf9d74f Merge branch 'master' of github.com:Froxlor/Froxlor 2021-07-13 09:01:25 +02:00
Michael Kaufmann
35cd567c48 check whether there was an image upload at all
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-13 09:01:22 +02:00
Michael Kaufmann
2332d5be7b Merge pull request #949 from bashgeek/custom-css
Custom CSS File in default theme
2021-07-13 08:38:23 +02:00
Daniel
14cdc3801a Merge branch 'Froxlor-master' into custom-css 2021-07-13 10:31:35 +08:00
Daniel
d85efe480e conflict 2021-07-13 10:31:24 +08:00
Daniel
4f2ceaa3ab wip 2021-07-13 10:29:36 +08:00
Michael Kaufmann
3b6792d548 Merge branch 'master' of github.com:Froxlor/Froxlor 2021-07-12 17:29:25 +02:00
Michael Kaufmann
36de6e09d4 remove beta notice from let's encrypt settings
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-12 17:29:21 +02:00
Michael Kaufmann
300c410b18 Merge pull request #948 from bashgeek/logo-custom-login
Custom Logo(s) via Image-Upload in Panel Settings
2021-07-12 17:28:42 +02:00
Daniel Schmitz
282d7d9101 migrate old image + fix versioning 2021-07-09 17:07:50 +08:00
Daniel Schmitz
48f6601003 check mime types 2021-07-09 16:42:21 +08:00
Daniel
c4c4279171 Merge branch 'Froxlor:master' into logo-custom-login 2021-07-09 16:32:59 +08:00
Michael Kaufmann
b88f9c1f18 allow defining php_value/php_admin_value for session.save_path when using php-fpm; fixes #954
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-09 08:23:46 +02:00
Daniel Schmitz
0dac045dc9 wip 2021-07-07 14:11:54 +08:00
Daniel Schmitz
80b5f97367 wip 2021-07-07 14:10:21 +08:00
Daniel Schmitz
7a8b39fad0 wip 2021-07-07 14:00:55 +08:00
Daniel Schmitz
9f5978e875 german translations 2021-07-07 13:33:33 +08:00
Daniel
155fd757bf Merge branch 'Froxlor:master' into logo-custom-login 2021-07-07 13:30:22 +08:00
Daniel Schmitz
518ec202ab wip 2021-07-07 13:26:15 +08:00
Michael Kaufmann
871083d613 Merge pull request #952 from bashgeek/install-warnings
Installer Cleanup & Bug Fixes
2021-06-28 08:06:59 +02:00
Daniel Schmitz
79f0c8d28f wip 2021-06-28 11:01:22 +08:00
Daniel
dfbb4127e2 Merge branch 'Froxlor:master' into logo-custom-login 2021-06-28 10:39:02 +08:00
Daniel Schmitz
b9b2f00f30 wip 2021-06-28 10:37:23 +08:00
Daniel Schmitz
6923f9d926 Revert "wip"
This reverts commit cacbf7fec7.
2021-06-28 10:35:15 +08:00
Daniel Schmitz
cacbf7fec7 wip 2021-06-28 10:34:21 +08:00
Michael Kaufmann
73991e855c Support ZeroSSL via acme.sh (v3); refs #946
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-27 09:00:44 +02:00
Michael Kaufmann
0208812013 prefer custom zone entries over automatically created ones when system.dns_createmailentry is enabled, fixes #944
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-27 08:41:16 +02:00
Michael Kaufmann
48bd2561f7 Merge pull request #947 from Froxlor/dependabot/composer/phpmailer/phpmailer-6.5.0
Bump phpmailer/phpmailer from 6.4.1 to 6.5.0
2021-06-27 08:37:38 +02:00
Michael Kaufmann
af12c4102b Merge pull request #950 from kruegerj/patch-1
Update focal.xml
2021-06-24 07:57:00 +02:00
kruegerj
d2efa3ecc4 Update focal.xml 2021-06-24 03:16:12 +02:00
Daniel Schmitz
acb04566f5 wip 2021-06-23 11:28:07 +08:00
Daniel Schmitz
abb98ae960 wip 2021-06-23 11:21:33 +08:00
Daniel Schmitz
0d202a7e4d wip 2021-06-23 11:20:18 +08:00
Daniel Schmitz
c69ef20b17 wip 2021-06-23 10:58:52 +08:00
dependabot[bot]
5872d0682a Bump phpmailer/phpmailer from 6.4.1 to 6.5.0
Bumps [phpmailer/phpmailer](https://github.com/PHPMailer/PHPMailer) from 6.4.1 to 6.5.0.
- [Release notes](https://github.com/PHPMailer/PHPMailer/releases)
- [Changelog](https://github.com/PHPMailer/PHPMailer/blob/master/changelog.md)
- [Commits](https://github.com/PHPMailer/PHPMailer/compare/v6.4.1...v6.5.0)

---
updated-dependencies:
- dependency-name: phpmailer/phpmailer
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>
2021-06-22 15:20:44 +00:00
Michael Kaufmann
c4fa8feb8c update dev tools
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-17 08:25:43 +02:00
Michael Kaufmann
61a50cc657 add setting for default serveralias value for new domains, refs #944
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-16 15:10:52 +02:00
Michael Kaufmann
3df3261ac0 switch from freenode irc network to libera.chat irc network as freenode is dead
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-16 11:57:38 +02:00
Michael Kaufmann
f2636e14f0 Merge pull request #945 from MisterDuval/patch-1
Deny all robots
2021-06-01 15:06:31 +02:00
MisterDuval
a23f22f561 Deny all robots
Search engine and all Robots should be denied to the whole Froxlor directory. This file will help!
2021-06-01 14:45:47 +02:00
Michael Kaufmann
8cf3f4ee24 set version to 0.10.26 for upcoming maintenance releasae
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-05-14 08:21:53 +02:00
Michael Kaufmann
e83f7634f8 Merge pull request #938 from Froxlor/dependabot/composer/phpmailer/phpmailer-6.4.1
Bump phpmailer/phpmailer from 6.2.0 to 6.4.1
2021-05-04 19:57:10 +02:00
dependabot[bot]
6eb6595a46 Bump phpmailer/phpmailer from 6.2.0 to 6.4.1
Bumps [phpmailer/phpmailer](https://github.com/PHPMailer/PHPMailer) from 6.2.0 to 6.4.1.
- [Release notes](https://github.com/PHPMailer/PHPMailer/releases)
- [Changelog](https://github.com/PHPMailer/PHPMailer/blob/master/changelog.md)
- [Commits](https://github.com/PHPMailer/PHPMailer/compare/v6.2.0...v6.4.1)

Signed-off-by: dependabot[bot] <support@github.com>
2021-05-04 17:43:20 +00:00
Michael Kaufmann
bd48fb7328 catch exception of password-complexity check when changing account password; fixes #935
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-04-14 08:59:44 +02:00
Michael Kaufmann
769525bb56 do not touch/chown error/access log if log is disabled, fixes #934
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-04-12 09:42:25 +02:00
Michael Kaufmann
9195fb3c98 additionally sort by length of username for libnss-extrausers passwd file to have the main user as first in result in any case; fixes #933
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-04-12 09:37:36 +02:00
Michael Kaufmann
82922f7aea add new settings for legal-notes; terms-of-use and privacy-policy; fixes #930
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-24 14:36:48 +01:00
Michael Kaufmann
db1a39b6d9 match composePhpOptions() definition everywhere
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-24 13:49:58 +01:00
Michael Kaufmann
7fbbc2ea0b add vhost replacer {FPMSOCKET} for custom vhost configs; fixes #931
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-24 13:46:24 +01:00
Michael Kaufmann
91d4432108 check rr against possible existing CNAME entries, fixes #927
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-15 17:33:30 +01:00
Michael Kaufmann
c8914312aa Refactoring columns from large table to avoid '1118 Row size too large' error
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-11 09:45:52 +01:00
Michael Kaufmann
3fd89c48e8 set version to 0.10.25 for upcoming maintenance release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-05 20:27:55 +01:00
Michael Kaufmann
eceb144a77 also trigger removal of domain in powerdns database if used; refs #923
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-04 12:09:03 +01:00
Michael Kaufmann
1d9651b18a trgger acme.sh removal for domains if customers is being deleted; fixes #923
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-04 12:07:20 +01:00
Michael Kaufmann
49db4e60cb escape passwords for email content (new email-account, new ftp-account and new database); fixes #905
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-03 11:25:58 +01:00
Michael Kaufmann
53e8ccbccb added 'deactivated' parameter to EmailAccounts.update() so admins can disable individual email-accounts, will be overridden if customer is deactivatd and re-enabled; fixes #921
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-03 10:59:16 +01:00
Michael Kaufmann
6d8fc215f1 add description field to panel_domains and mail_virtual table, API parameter 'description' for Domains.add()/Domains.update() and Email.add()/Emails.update(); fixes #910
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-03 10:25:42 +01:00
Michael Kaufmann
f94c303cb3 add API parameter 'show_usages' for Customers.listing() and Customers.get() to return number of domains, and diskspaced used split into webspace_used, mailspace_used and dbspace_used; fixes #912
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-03-03 09:50:30 +01:00
Michael Kaufmann
2be1873354 fix frontend issue with displaying correct options in domain listing when using php8, thx to cscholz
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-02-24 19:56:26 +01:00
Michael Kaufmann
d1d36c32fe Merge pull request #920 from RipClaw2971/patch-1
lowercase domain names for ssl-certificate file check (fallback)
2021-02-24 13:07:26 +01:00
RipClaw2971
3b3527348f Update AcmeSh.php
Renewed certificates are not recognized if the domain is in upper/lower case.
2021-02-24 13:00:31 +01:00
Michael Kaufmann
036d5f0713 Merge pull request #919 from nachtgeist/soa
dns: make mail address of SOA records configurable
2021-02-21 18:27:57 +01:00
Daniel Reichelt
a1b8807b0f dns: make mail address of SOA records configurable 2021-02-21 13:00:30 +01:00
Michael Kaufmann
356a087b6a Merge pull request #918 from nachtgeist/pns
dns: check NS entry to be used as primary NS
2021-02-21 09:14:37 +01:00
Michael Kaufmann
0a77fd7150 Merge pull request #917 from nachtgeist/pw
system: validatePassword(): also quote the delimiter ('/')
2021-02-21 09:13:02 +01:00
Daniel Reichelt
67d67a287f system: validatePassword(): also quote the delimiter ('/')
Quoting the default regex delimiter is required for the password
complexity check to work if '/' had been specified as special character
in Froxlor's account settings.
2021-02-21 02:33:46 +01:00
Daniel Reichelt
1f792466bf dns: check NS entry to be used as primary NS
Don't just blindly use the first custom NS entry for SOA, actually check
if it pertains to the domain in question
2021-02-21 02:33:23 +01:00
Michael Kaufmann
5a6343b47c php8 compatibility, fixes #916
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-02-16 12:38:01 +01:00
Michael Kaufmann
841c529107 fix check for required firstname/name/company in Customers.update(), fixes #915
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-02-15 23:26:18 +01:00
Michael Kaufmann
41c3f21f0b list only phpenabled and http-enabled domains in php-configuration overview; fixes #911
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-02-11 16:16:04 +01:00
Michael Kaufmann
b8c0688ba0 added possibility to use 'in' sql-operation in sql_where parameter for Api-calls; php-8 compat fix in admin_traffic
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-02-11 12:09:42 +01:00
129 changed files with 5185 additions and 1795 deletions

View File

@@ -1,6 +1,6 @@
# Bug report vs. support request
If you're unsure of whether your problem is a bug or a configuration error
* contact us via IRC in #froxlor on freenode
* contact us via IRC in #froxlor on irc.libera.chat
* or post a thread in our forum at https://forum.froxlor.org
As a rule of thumb: before reporting an issue

40
.github/ISSUE_TEMPLATE/bug_report.md vendored Normal file
View File

@@ -0,0 +1,40 @@
---
name: Bug report
about: Create a report to help us improve
title: ''
labels: ''
assignees: ''
---
**As a rule of thumb: before reporting an issue**
* see if it hasn't been [reported](https://github.com/Froxlor/froxlor/issues) (and possibly already been [fixed](https://github.com/Froxlor/froxlor/issues?utf8=✓&q=is:issue%20is:closed)) first
* try with the git master
**Describe the bug**
A clear and concise description of what the bug is.
**System information**
* Froxlor version: $version/$gitSHA1
* Web server: apache2/nginx/lighttpd
* DNS server: Bind/PowerDNS (standalone)/PowerDNS (Bind-backend)
* POP/IMAP server: Courier/Dovecot
* SMTP server: postfix/exim
* FTP server: proftpd/pureftpd
* OS/Version: ...
**To Reproduce**
Steps to reproduce the behavior:
1. Go to '...'
2. Click on '....'
3. Scroll down to '....'
4. See error
**Expected behavior**
A clear and concise description of what you expected to happen.
**Logfiles**
If applicable, add log-entries to help explain your problem.
**Additional context**
Add any other context about the problem here.

View File

@@ -0,0 +1,20 @@
---
name: Feature request
about: Suggest an idea for this project
title: ''
labels: ''
assignees: ''
---
**Is your feature request related to a problem? Please describe.**
A clear and concise description of what the problem is. Ex. I'm always frustrated when [...]
**Describe the solution you'd like**
A clear and concise description of what you want to happen.
**Describe alternatives you've considered**
A clear and concise description of any alternative solutions or features you've considered.
**Additional context**
Add any other context or screenshots about the feature request here.

80
.github/workflows/build-mariadb.yml vendored Normal file
View File

@@ -0,0 +1,80 @@
name: Froxlor-CI-MariaDB
on: ['push', 'pull_request', 'create']
jobs:
froxlor:
name: Froxlor (PHP ${{ matrix.php-versions }}, MariaDB ${{ matrix.mariadb-version }})
runs-on: ubuntu-latest
strategy:
fail-fast: false
matrix:
php-versions: ['7.4', '8.0']
mariadb-version: [10.5, 10.4]
steps:
- name: Checkout
uses: actions/checkout@v2
- name: Setup PHP, with composer and extensions
uses: shivammathur/setup-php@v2
with:
php-version: ${{ matrix.php-versions }}
tools: composer:v2
extensions: mbstring, xml, ctype, pdo_mysql, mysql, curl, json, zip, session, filter, posix, openssl, fileinfo, bcmath
- name: Install tools
run: sudo apt-get install -y ant
- name: Adjust firewall
run: |
sudo ufw allow out 3306/tcp
sudo ufw allow in 3306/tcp
- name: Setup MariaDB
uses: getong/mariadb-action@v1.1
with:
mariadb version: ${{ matrix.mariadb-version }}
mysql database: 'froxlor010'
mysql root password: 'fr0xl0r.TravisCI'
- name: Wait for database
run: sleep 15
- name: Setup databases
run: |
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "CREATE USER 'froxlor010'@'%' IDENTIFIED BY 'fr0xl0r.TravisCI';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "GRANT ALL ON froxlor010.* TO 'froxlor010'@'%';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI froxlor010 < install/froxlor.sql
- name: Run testing
run: ant quick-build
# - name: irc push
# uses: rectalogic/notify-irc@v1
# if: github.event_name == 'push'
# with:
# channel: "#froxlor"
# server: "irc.libera.chat"
# nickname: froxlor-ci
# message: |
# ${{ github.actor }} pushed ${{ github.event.ref }} ${{ github.event.compare }}
# ${{ join(github.event.commits.*.message) }}
# - name: irc pull request
# uses: rectalogic/notify-irc@v1
# if: github.event_name == 'pull_request'
# with:
# channel: "#froxlor"
# server: "irc.libera.chat"
# nickname: froxlor-ci
# message: |
# ${{ github.actor }} opened PR ${{ github.event.pull_request.html_url }}
# - name: irc tag created
# uses: rectalogic/notify-irc@v1
# if: github.event_name == 'create' && github.event.ref_type == 'tag'
# with:
# channel: "#froxlor"
# server: "irc.libera.chat"
# nickname: froxlor-ci
# message: |
# ${{ github.actor }} tagged ${{ github.repository }} ${{ github.event.ref }}

57
.github/workflows/build-mysql.yml vendored Normal file
View File

@@ -0,0 +1,57 @@
name: Froxlor-CI-MySQL
on: ['push', 'pull_request', 'create']
jobs:
froxlor:
name: Froxlor (PHP ${{ matrix.php-versions }}, MySQL ${{ matrix.mysql-version }})
runs-on: ubuntu-latest
strategy:
fail-fast: false
matrix:
php-versions: ['7.4', '8.0']
mysql-version: [8.0, 5.7]
steps:
- name: Checkout
uses: actions/checkout@v2
- name: Setup PHP, with composer and extensions
uses: shivammathur/setup-php@v2
with:
php-version: ${{ matrix.php-versions }}
tools: composer:v2
extensions: mbstring, xml, ctype, pdo_mysql, mysql, curl, json, zip, session, filter, posix, openssl, fileinfo, bcmath
- name: Install tools
run: sudo apt-get install -y ant
- name: Adjust firewall
run: |
sudo ufw allow out 3306/tcp
sudo ufw allow in 3306/tcp
- name: Setup MySQL
uses: samin/mysql-action@v1.3
with:
mysql version: ${{ matrix.mysql-version }}
mysql database: 'froxlor010'
mysql root password: 'fr0xl0r.TravisCI'
- name: Wait for database
run: sleep 15
- name: Setup database (8.0)
if: matrix.mysql-version == '8.0'
run: |
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "CREATE USER 'froxlor010'@'%' IDENTIFIED WITH mysql_native_password BY 'fr0xl0r.TravisCI';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "GRANT ALL ON froxlor010.* TO 'froxlor010'@'%';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI froxlor010 < install/froxlor.sql
- name: Setup database (5.7)
if: matrix.mysql-version == '5.7'
run: |
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "CREATE USER 'froxlor010'@'%' IDENTIFIED BY 'fr0xl0r.TravisCI';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "GRANT ALL ON froxlor010.* TO 'froxlor010'@'%';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI froxlor010 < install/froxlor.sql
- name: Run testing
run: ant quick-build

3
.gitignore vendored
View File

@@ -12,9 +12,10 @@ logs/*
.well-known
.idea
*.iml
img/
!templates/Froxlor/
!templates/Sparkle/
!templates/misc/
templates/Froxlor/assets/img/logo_custom.png
templates/Sparkle/assets/css/custom.css
vendor/

View File

@@ -55,7 +55,7 @@ script:
- ant phpunit-no-coverage
notifications:
irc: "chat.freenode.net#froxlor"
irc: "irc.libera.chat#froxlor"
webhooks:
urls:
- https://webhooks.gitter.im/e/bdf91d1c3f745e51f796

View File

@@ -1,4 +1,5 @@
[![Build Status](https://travis-ci.com/Froxlor/Froxlor.svg?branch=master)](https://travis-ci.com/Froxlor/Froxlor)
[![Froxlor-CI](https://github.com/Froxlor/Froxlor/actions/workflows/build-mariadb.yml/badge.svg?branch=master)](https://github.com/Froxlor/Froxlor/actions/workflows/build-mariadb.yml)
[![Froxlor-CI](https://github.com/Froxlor/Froxlor/actions/workflows/build-mysql.yml/badge.svg?branch=master)](https://github.com/Froxlor/Froxlor/actions/workflows/build-mysql.yml)
[![Gitter](https://badges.gitter.im/Froxlor/community.svg)](https://gitter.im/Froxlor/community?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge)
# Froxlor
@@ -28,8 +29,8 @@ You may find help in the following places:
### IRC
froxlor may be found on freenode.net, channel #froxlor:
irc://chat.freenode.net/froxlor
froxlor may be found on libera.chat, channel #froxlor:
irc://irc.libera.chat/froxlor
### Forum

View File

@@ -77,14 +77,6 @@ return array(
'default' => false,
'save_method' => 'storeSettingField'
),
'panel_no_robots' => array(
'label' => $lng['serversettings']['no_robots'],
'settinggroup' => 'panel',
'varname' => 'no_robots',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField'
),
'panel_paging' => array(
'label' => $lng['serversettings']['paging'],
'settinggroup' => 'panel',
@@ -265,7 +257,71 @@ return array(
'traffic.mail' => $lng['menue']['traffic']['traffic'] . " / Mail"
),
'save_method' => 'storeSettingField'
)
),
'panel_imprint_url' => array(
'label' => $lng['serversettings']['imprint_url'],
'settinggroup' => 'panel',
'varname' => 'imprint_url',
'type' => 'string',
'string_type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
),
'panel_terms_url' => array(
'label' => $lng['serversettings']['terms_url'],
'settinggroup' => 'panel',
'varname' => 'terms_url',
'type' => 'string',
'string_type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
),
'panel_privacy_url' => array(
'label' => $lng['serversettings']['privacy_url'],
'settinggroup' => 'panel',
'varname' => 'privacy_url',
'type' => 'string',
'string_type' => 'url',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
),
'panel_logo_overridetheme' => array(
'label' => $lng['serversettings']['logo_overridetheme'],
'settinggroup' => 'panel',
'varname' => 'logo_overridetheme',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField'
),
'panel_logo_overridecustom' => array(
'label' => $lng['serversettings']['logo_overridecustom'],
'settinggroup' => 'panel',
'varname' => 'logo_overridecustom',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField'
),
'panel_logo_image_header' => array(
'label' => $lng['serversettings']['logo_image_header'],
'settinggroup' => 'panel',
'varname' => 'logo_image_header',
'type' => 'image',
'image_name' => 'logo_header',
'default' => '',
'save_method' => 'storeSettingImage'
),
'panel_logo_image_login' => array(
'label' => $lng['serversettings']['logo_image_login'],
'settinggroup' => 'panel',
'varname' => 'logo_image_login',
'type' => 'image',
'image_name' => 'logo_login',
'default' => '',
'save_method' => 'storeSettingImage'
),
)
)
)

View File

@@ -205,9 +205,21 @@ return array(
'default' => false,
'cronmodule' => 'froxlor/backup',
'save_method' => 'storeSettingField'
)
),
'system_createstdsubdom_default' => array(
'label' => $lng['serversettings']['createstdsubdom_default'],
'settinggroup' => 'system',
'varname' => 'createstdsubdom_default',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options' => array(
'0' => $lng['panel']['no'],
'1' => $lng['panel']['yes']
),
'save_method' => 'storeSettingField'
),
)
)
)
);

View File

@@ -270,6 +270,20 @@ return array(
'default' => true,
'save_method' => 'storeSettingField'
),
'system_domaindefaultalias' => array(
'label' => $lng['admin']['domaindefaultalias'],
'settinggroup' => 'system',
'varname' => 'domaindefaultalias',
'type' => 'option',
'default' => '0',
'option_mode' => 'one',
'option_options' => array(
'0' => $lng['domains']['serveraliasoption_wildcard'],
'1' => $lng['domains']['serveraliasoption_www'],
'2' => $lng['domains']['serveraliasoption_none']
),
'save_method' => 'storeSettingField'
),
'hide_incompatible_settings' => array(
'label' => $lng['serversettings']['hide_incompatible_settings'],
'settinggroup' => 'system',

View File

@@ -142,6 +142,9 @@ return array(
'default' => '/etc/apache2/conf-enabled/acme.conf',
'save_method' => 'storeSettingField'
),
/**
* currently the only option anyway
*
'system_leapiversion' => array(
'label' => $lng['serversettings']['leapiversion'],
'settinggroup' => 'system',
@@ -154,16 +157,20 @@ return array(
),
'save_method' => 'storeSettingField'
),
*/
'system_letsencryptca' => array(
'label' => $lng['serversettings']['letsencryptca'],
'settinggroup' => 'system',
'varname' => 'letsencryptca',
'type' => 'option',
'default' => 'production',
'default' => 'letsencrypt',
'option_mode' => 'one',
'option_options' => array(
'testing' => 'https://acme-staging-v0' . \Froxlor\Settings::Get('system.leapiversion') . '.api.letsencrypt.org (Test)',
'production' => 'https://acme-v0' . \Froxlor\Settings::Get('system.leapiversion') . '.api.letsencrypt.org (Live)'
'letsencrypt_test' => 'Let\'s Encrypt (Test / Staging)',
'letsencrypt' => 'Let\'s Encrypt (Live)',
'buypass_test' => 'Buypass (Test / Staging)',
'buypass' => 'Buypass (Live)',
'zerossl' => 'ZeroSSL (Live)'
),
'save_method' => 'storeSettingField'
),

View File

@@ -99,6 +99,19 @@ return array(
'default' => '',
'save_method' => 'storeSettingField'
),
'system_powerdns_mode' => array(
'label' => $lng['serversettings']['powerdns_mode'],
'settinggroup' => 'system',
'varname' => 'powerdns_mode',
'type' => 'option',
'default' => 'Native',
'option_mode' => 'one',
'option_options' => array(
'Native' => 'Native',
'Master' => 'Master'
),
'save_method' => 'storeSettingField'
),
'system_dns_createmailentry' => array(
'label' => $lng['serversettings']['mail_also_with_mxservers'],
'settinggroup' => 'system',
@@ -132,6 +145,16 @@ return array(
'int_min' => 3600, /* 1 hour */
'int_max' => 2147483647, /* integer max */
'save_method' => 'storeSettingField'
),
'system_soaemail' => array(
'label' => $lng['serversettings']['soaemail'],
'settinggroup' => 'system',
'varname' => 'soaemail',
'type' => 'string',
'string_type' => 'mail',
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
)
)
)

View File

@@ -82,7 +82,20 @@ return array(
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
)
),
'system_froxlorusergroup' => array(
'label' => $lng['serversettings']['froxlorusergroup'],
'settinggroup' => 'system',
'varname' => 'froxlorusergroup',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
'plausibility_check_method' => array(
'\\Froxlor\\Validate\\Check',
'checkLocalGroup'
),
'visible' => \Froxlor\Settings::Get('system.nssextrausers')
),
)
)
)

View File

@@ -87,7 +87,7 @@ if ($page == 'showinfo') {
$hits = $cache['num_hits'] . @sprintf(" (%.1f%%)", $cache['num_hits'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
$misses = $cache['num_misses'] . @sprintf(" (%.1f%%)", $cache['num_misses'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
// Fragementation: (freeseg - 1) / total_seg
// Fragmentation: (freeseg - 1) / total_seg
$nseg = $freeseg = $fragsize = $freetotal = 0;
for ($i = 0; $i < $mem['num_seg']; $i ++) {
$ptr = 0;

View File

@@ -290,9 +290,9 @@ if ($page == 'domains' || $page == 'overview') {
// create serveralias options
$serveraliasoptions = "";
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_wildcard'], '0', '0', true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_www'], '1', '0', true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_none'], '2', '0', true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_wildcard'], '0', Settings::Get('system.domaindefaultalias'), true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_www'], '1', Settings::Get('system.domaindefaultalias'), true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_none'], '2', Settings::Get('system.domaindefaultalias'), true, true);
$subcanemaildomain = \Froxlor\UI\HTML::makeoption($lng['admin']['subcanemaildomain']['never'], '0', '0', true, true);
$subcanemaildomain .= \Froxlor\UI\HTML::makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', '0', true, true);
@@ -428,7 +428,7 @@ if ($page == 'domains' || $page == 'overview') {
$customer = Database::pexecute_first($customer_stmt, array(
'customerid' => $result['customerid']
));
$result['customername'] = \Froxlor\User::getCorrectFullUserDetails($customer) . ' (' . $customer['loginname'] . ')';
$result['customername'] = \Froxlor\User::getCorrectFullUserDetails($customer);
}
if ($userinfo['customers_see_all'] == '1') {
@@ -594,6 +594,10 @@ if ($page == 'domains' || $page == 'overview') {
}
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
if (Settings::Get('panel.allow_domain_change_customer') != '1') {
$result['customername'] .= ' (<a href="' . $linker->getLink(array('section' => 'customers', 'page' => 'customers',
'action' => 'su', 'id' => $customer['customerid'])) . '" rel="external">' . $customer['loginname'] . '</a>)';
}
$domain_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/domains/formfield.domains_edit.php';
$domain_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($domain_edit_data);

View File

@@ -193,8 +193,12 @@ if ($page == 'overview') {
\Froxlor\UI\Response::standard_error('oldpasswordnotcorrect');
}
$new_password = \Froxlor\Validate\Validate::validate($_POST['new_password'], 'new password');
$new_password_confirm = \Froxlor\Validate\Validate::validate($_POST['new_password_confirm'], 'new password confirm');
try {
$new_password = \Froxlor\System\Crypt::validatePassword($_POST['new_password'], 'new password');
$new_password_confirm = \Froxlor\System\Crypt::validatePassword($_POST['new_password_confirm'], 'new password confirm');
} catch (Exception $e) {
\Froxlor\UI\Response::dynamic_error($e->getMessage());
}
if ($old_password == '') {
\Froxlor\UI\Response::standard_error(array(

View File

@@ -32,10 +32,10 @@ if ($page == 'message') {
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'viewed panel_message');
if (isset($_POST['send']) && $_POST['send'] == 'send') {
if ($_POST['receipient'] == 0 && $userinfo['customers_see_all'] == '1') {
if ($_POST['recipient'] == 0 && $userinfo['customers_see_all'] == '1') {
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'sending messages to admins');
$result = Database::query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`");
} elseif ($_POST['receipient'] == 1) {
} elseif ($_POST['recipient'] == 1) {
if ($userinfo['customers_see_all'] == '1') {
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers');
$result = Database::query('SELECT `firstname`, `name`, `company`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`");
@@ -49,7 +49,7 @@ if ($page == 'message') {
));
}
} else {
\Froxlor\UI\Response::standard_error('noreceipientsgiven');
\Froxlor\UI\Response::standard_error('norecipientsgiven');
}
$subject = $_POST['subject'];
@@ -105,7 +105,7 @@ if ($page == 'message') {
$sentitems = isset($_GET['sentitems']) ? (int) $_GET['sentitems'] : 0;
if ($sentitems == 0) {
$successmessage = $lng['message']['noreceipients'];
$successmessage = $lng['message']['norecipients'];
} else {
$successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
}
@@ -116,12 +116,12 @@ if ($page == 'message') {
}
$action = '';
$receipients = '';
$recipients = '';
if ($userinfo['customers_see_all'] == '1') {
$receipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['reseller'], 0);
$recipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['reseller'], 0);
}
$receipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['customer'], 1);
$recipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['customer'], 1);
eval("echo \"" . \Froxlor\UI\Template::getTemplate('message/message') . "\";");
}

View File

@@ -22,7 +22,7 @@ require './lib/init.php';
if ($action == 'reset' && function_exists('opcache_reset') && $userinfo['change_serversettings'] == '1') {
opcache_reset();
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "reseted OPcache");
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "reset OPcache");
header('Location: ' . $linker->getLink(array(
'section' => 'opcacheinfo',
'page' => 'showinfo'

View File

@@ -56,6 +56,26 @@ if ($page == 'overview' || $page == 'customers') {
$maxyears = date("Y") - $minyear['year'];
}
$params = [];
if ($userinfo['customers_see_all'] == '0') {
$params = [
'id' => $userinfo['adminid']
];
}
$customer_name_list_stmt = Database::prepare("
SELECT `customerid`,`company`,`name`,`firstname`
FROM `" . TABLE_PANEL_CUSTOMERS . "`
WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = :id") . "
ORDER BY name"
);
$traffic_list_stmt = Database::prepare("
SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic
FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE year = :year AND `customerid` = :id
GROUP BY month ORDER BY month"
);
for ($years = 0; $years <= $maxyears; $years ++) {
$overview['year'] = date("Y") - $years;
@@ -76,14 +96,7 @@ if ($page == 'overview' || $page == 'customers') {
'dec' => 0
);
$customer_name_list_stmt = Database::prepare("
SELECT `customerid`,`company`,`name`,`firstname`
FROM `" . TABLE_PANEL_CUSTOMERS . "`
WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = :id") . "
ORDER BY name");
Database::pexecute($customer_name_list_stmt, array(
'id' => $userinfo['adminid']
));
Database::pexecute($customer_name_list_stmt, $params);
while ($customer_name = $customer_name_list_stmt->fetch(PDO::FETCH_ASSOC)) {
@@ -104,11 +117,6 @@ if ($page == 'overview' || $page == 'customers') {
'dec' => '-'
);
$traffic_list_stmt = Database::prepare("
SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic
FROM `" . TABLE_PANEL_TRAFFIC . "`
WHERE year = :year AND `customerid` = :id
GROUP BY month ORDER BY month");
Database::pexecute($traffic_list_stmt, array(
'year' => (date("Y") - $years),
'id' => $customer_name['customerid']

View File

@@ -127,7 +127,7 @@ if ($action == 'delete') {
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed api::api_keys");
// select all my (accessable) certificates
// select all my (accessible) certificates
$keys_stmt_query = "SELECT ak.*, c.loginname, a.loginname as adminname
FROM `" . TABLE_API_KEYS . "` ak
LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `ak`.`customerid`

View File

@@ -6,21 +6,20 @@
<property name="pdepend" value="${basedir}/vendor/bin/pdepend" />
<property name="phpcpd" value="${basedir}/vendor/bin/phpcpd" />
<property name="phpcs" value="${basedir}/vendor/bin/phpcs" />
<property name="phpdox" value="${basedir}/vendor/bin/phpdox" />
<property name="phploc" value="${basedir}/vendor/bin/phploc" />
<property name="phpmd" value="${basedir}/vendor/bin/phpmd" />
<property name="phpunit" value="${basedir}/vendor/bin/phpunit" />
<target name="full-build"
depends="prepare,composer,static-analysis,phpunit,phpdox,-check-failure"
depends="prepare,composer,static-analysis,phpunit,-check-failure"
description="Performs static analysis, runs the tests, and generates project documentation" />
<target name="full-build-parallel"
depends="prepare,composer,static-analysis-parallel,phpunit,phpdox,-check-failure"
depends="prepare,composer,static-analysis-parallel,phpunit,-check-failure"
description="Performs static analysis (executing the tools in parallel), runs the tests, and generates project documentation" />
<target name="quick-build"
depends="prepare,composer,lint,phpunit-no-coverage"
depends="prepare,composer,lint,phpunit-no-coverage,-check-failure"
description="Performs a lint check and runs the tests (without generating code coverage reports)" />
<target name="static-analysis"
@@ -49,7 +48,6 @@
<delete dir="${basedir}/build/coverage" />
<delete dir="${basedir}/build/logs" />
<delete dir="${basedir}/build/pdepend" />
<delete dir="${basedir}/build/phpdox" />
<property name="clean.done" value="true" />
</target>
@@ -59,7 +57,6 @@
<mkdir dir="${basedir}/build/coverage" />
<mkdir dir="${basedir}/build/logs" />
<mkdir dir="${basedir}/build/pdepend" />
<mkdir dir="${basedir}/build/phpdox" />
<property name="prepare.done" value="true" />
</target>
@@ -257,7 +254,7 @@
<target name="phpunit-no-coverage" unless="phpunit.done"
depends="composer"
description="Run unit tests with PHPUnit (without generating code coverage reports)">
<exec executable="${phpunit}" failonerror="true"
<exec executable="${phpunit}" failonerror="true" resultproperty="result.phpunit"
taskname="phpunit">
<arg value="--configuration" />
<arg path="${basedir}/phpunit.xml" />
@@ -269,18 +266,6 @@
<property name="phpunit.done" value="true" />
</target>
<target name="phpdox" unless="phpdox.done"
depends="phploc-ci,phpcs-ci,phpcompat-ci,phpmd-ci"
description="Generate project documentation using phpDox">
<exec executable="${phpdox}" dir="${basedir}/build"
taskname="phpdox">
<arg value="--file" />
<arg path="${basedir}/phpdox.xml" />
</exec>
<property name="phpdox.done" value="true" />
</target>
<target name="-check-failure">
<fail message="PHPUnit did not finish successfully">
<condition>

View File

@@ -25,7 +25,7 @@
"issues": "https://github.com/Froxlor/Froxlor/issues",
"forum": "https://forum.froxlor.org/",
"wiki": "https://github.com/Froxlor/Froxlor/wiki",
"irc": "irc://chat.freenode.net/froxlor",
"irc": "irc://irc.libera.chat/froxlor",
"source": "https://github.com/Froxlor/Froxlor",
"docs": "https://github.com/Froxlor/Froxlor/wiki"
},
@@ -43,23 +43,24 @@
"ext-curl": "*",
"ext-json": "*",
"ext-openssl": "*",
"ext-fileinfo": "*",
"phpmailer/phpmailer": "~6.0",
"monolog/monolog": "^1.24",
"robthree/twofactorauth": "^1.6",
"froxlor/idna-convert-legacy": "^2.1",
"voku/anti-xss": "^4.1"
},
},
"require-dev": {
"phpunit/phpunit": "8.4.1",
"phpunit/phpunit": "^9",
"php": ">=7.3",
"ext-pcntl": "*",
"phpcompatibility/php-compatibility": "*",
"squizlabs/php_codesniffer": "*",
"pdepend/pdepend": "^2.5",
"sebastian/phpcpd": "^4.1",
"theseer/phpdox": "^0.12.0",
"phploc/phploc": "^5.0",
"phpmd/phpmd": "^2.6"
"pdepend/pdepend": "^2.9",
"sebastian/phpcpd": "^6.0",
"phploc/phploc": "^7.0",
"phpmd/phpmd": "^2.10",
"phpunit/php-timer" : "^5"
},
"suggest": {
"ext-bcmath": "*",

1689
composer.lock generated

File diff suppressed because it is too large Load Diff

View File

@@ -136,14 +136,20 @@ if ($page == 'overview') {
eval("echo \"" . \Froxlor\UI\Template::getTemplate('index/index') . "\";");
} elseif ($page == 'change_password') {
if (isset($_POST['send']) && $_POST['send'] == 'send') {
$old_password = \Froxlor\Validate\Validate::validate($_POST['old_password'], 'old password');
if (! \Froxlor\System\Crypt::validatePasswordLogin($userinfo, $old_password, TABLE_PANEL_CUSTOMERS, 'customerid')) {
\Froxlor\UI\Response::standard_error('oldpasswordnotcorrect');
}
$new_password = \Froxlor\System\Crypt::validatePassword($_POST['new_password'], 'new password');
$new_password_confirm = \Froxlor\System\Crypt::validatePassword($_POST['new_password_confirm'], 'new password confirm');
try {
$new_password = \Froxlor\System\Crypt::validatePassword($_POST['new_password'], 'new password');
$new_password_confirm = \Froxlor\System\Crypt::validatePassword($_POST['new_password_confirm'], 'new password confirm');
} catch (Exception $e) {
\Froxlor\UI\Response::dynamic_error($e->getMessage());
}
if ($old_password == '') {
\Froxlor\UI\Response::standard_error(array(

View File

@@ -114,7 +114,7 @@ if ($action == '2fa_entercode') {
));
$row = $stmt->fetch(PDO::FETCH_ASSOC);
if ($row['customer'] == $loginname) {
if ($row && $row['customer'] == $loginname) {
$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid';
$adminsession = '0';
@@ -142,7 +142,7 @@ if ($action == '2fa_entercode') {
"loginname" => $loginname
));
$row3 = $stmt->fetch(PDO::FETCH_ASSOC);
if ($row3['customer'] == $loginname) {
if ($row3 && $row3['customer'] == $loginname) {
$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
$uid = 'customerid';
$adminsession = '0';
@@ -181,7 +181,7 @@ if ($action == '2fa_entercode') {
$row = $stmt->fetch(PDO::FETCH_ASSOC);
}
if ($row['admin'] == $loginname) {
if ($row && $row['admin'] == $loginname) {
$table = "`" . TABLE_PANEL_ADMINS . "`";
$uid = 'adminid';
$adminsession = '1';

View File

@@ -71,6 +71,7 @@ CREATE TABLE `mail_virtual` (
`customerid` int(11) NOT NULL default '0',
`popaccountid` int(11) NOT NULL default '0',
`iscatchall` tinyint(1) unsigned NOT NULL default '0',
`description` varchar(255) NOT NULL DEFAULT '',
PRIMARY KEY (`id`),
KEY `email` (`email`)
) ENGINE=InnoDB CHARSET=utf8 COLLATE=utf8_general_ci;
@@ -269,12 +270,13 @@ CREATE TABLE `panel_domains` (
`writeaccesslog` tinyint(1) DEFAULT '1',
`writeerrorlog` tinyint(1) DEFAULT '1',
`override_tls` tinyint(1) DEFAULT '0',
`ssl_protocols` text,
`ssl_cipher_list` text,
`tlsv13_cipher_list` text,
`ssl_protocols` varchar(255) NOT NULL DEFAULT '',
`ssl_cipher_list` varchar(500) NOT NULL DEFAULT '',
`tlsv13_cipher_list` varchar(500) NOT NULL DEFAULT '',
`ssl_enabled` tinyint(1) DEFAULT '1',
`ssl_honorcipherorder` tinyint(1) DEFAULT '0',
`ssl_sessiontickets` tinyint(1) DEFAULT '1',
`description` varchar(255) NOT NULL DEFAULT '',
PRIMARY KEY (`id`),
KEY `customerid` (`customerid`),
KEY `parentdomain` (`parentdomainid`),
@@ -609,6 +611,7 @@ opcache.interned_strings_buffer'),
('system', 'documentroot_use_default_value', '0'),
('system', 'passwordcryptfunc', '3'),
('system', 'axfrservers', ''),
('system', 'powerdns_mode', 'Native'),
('system', 'customer_ssl_path', '/etc/ssl/froxlor-custom/'),
('system', 'allow_error_report_admin', '1'),
('system', 'allow_error_report_customer', '0'),
@@ -626,7 +629,7 @@ opcache.interned_strings_buffer'),
('system', 'apacheitksupport', '0'),
('system', 'leprivatekey', 'unset'),
('system', 'lepublickey', 'unset'),
('system', 'letsencryptca', 'production'),
('system', 'letsencryptca', 'letsencrypt'),
('system', 'letsencryptcountrycode', 'DE'),
('system', 'letsencryptstate', 'Hessen'),
('system', 'letsencryptchallengepath', '/var/www/froxlor'),
@@ -674,6 +677,11 @@ opcache.interned_strings_buffer'),
('system', 'apply_phpconfigs_default', '1'),
('system', 'hide_incompatible_settings', '0'),
('system', 'include_default_vhostconf', '0'),
('system', 'soaemail', ''),
('system', 'domaindefaultalias', '0'),
('system', 'createstdsubdom_default', '1'),
('system', 'froxlorusergroup', ''),
('system', 'froxlorusergroup_gid', ''),
('api', 'enabled', '0'),
('2fa', 'enabled', '1'),
('panel', 'decimal_places', '4'),
@@ -686,7 +694,6 @@ opcache.interned_strings_buffer'),
('panel', 'paging', '20'),
('panel', 'natsorting', '1'),
('panel', 'sendalternativemail', '0'),
('panel', 'no_robots', '1'),
('panel', 'allow_domain_change_admin', '0'),
('panel', 'allow_domain_change_customer', '0'),
('panel', 'frontend', 'froxlor'),
@@ -708,8 +715,15 @@ opcache.interned_strings_buffer'),
('panel', 'password_special_char', '!?<>§$%+#=@'),
('panel', 'customer_hide_options', ''),
('panel', 'is_configured', '0'),
('panel', 'version', '0.10.24'),
('panel', 'db_version', '202101200');
('panel', 'imprint_url', ''),
('panel', 'terms_url', ''),
('panel', 'privacy_url', ''),
('panel', 'logo_image_header', ''),
('panel', 'logo_image_login', ''),
('panel', 'logo_overridetheme', '0'),
('panel', 'logo_overridecustom', '0'),
('panel', 'version', '0.10.28'),
('panel', 'db_version', '202108180');
DROP TABLE IF EXISTS `panel_tasks`;
@@ -926,7 +940,7 @@ CREATE TABLE IF NOT EXISTS `ftp_quotalimits` (
INSERT INTO `ftp_quotalimits` (`name`, `quota_type`, `per_session`, `limit_type`, `bytes_in_avail`, `bytes_out_avail`, `bytes_xfer_avail`, `files_in_avail`, `files_out_avail`, `files_xfer_avail`) VALUES
INSERT INTO `ftp_quotalimits` (`name`, `quota_type`, `per_session`, `limit_type`, `bytes_in_avail`, `bytes_out_avail`, `bytes_xfer_avail`, `files_in_avail`, `files_out_avail`, `files_xfer_avail`) VALUES
('froxlor', 'user', 'false', 'hard', 0, 0, 0, 0, 0, 0);

View File

@@ -28,7 +28,7 @@
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install
*
*
*/
class FroxlorInstall
{
@@ -123,7 +123,7 @@ class FroxlorInstall
if ((isset($_POST['installstep']) && $_POST['installstep'] == '1') || (isset($_GET['check']) && $_GET['check'] == '1')) {
$pagetitle = $this->_lng['install']['title'];
if ($this->_checkPostData()) {
// ceck data and create userdata etc.etc.etc.
// check data and create userdata etc.etc.etc.
$result = $this->_doInstall();
} elseif (isset($_GET['check']) && $_GET['check'] == '1') {
// gather data
@@ -687,7 +687,7 @@ class FroxlorInstall
if (version_compare($db_root->getAttribute(\PDO::ATTR_SERVER_VERSION), '8.0.11', '>=')) {
// create user
$stmt = $db_root->prepare("
CREATE USER '" . $username . "'@'" . $access_host . "' IDENTIFIED BY :password
CREATE USER '" . $username . "'@'" . $access_host . "' IDENTIFIED WITH mysql_native_password BY :password
");
$stmt->execute(array(
"password" => $password
@@ -739,7 +739,7 @@ class FroxlorInstall
}
if ($tables_exist) {
// tell whats going on
// tell what's going on
$content .= $this->_status_message('begin', $this->_lng['install']['backup_old_db']);
// create temporary backup-filename
@@ -784,7 +784,7 @@ class FroxlorInstall
}
// language selection
$language_options = '';
foreach ($this->_languages as $language_name => $language_file) {
foreach ($this->_languages as $language_file => $language_name) {
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, $this->_activelng, true, true);
}
// get language-form-template
@@ -867,19 +867,24 @@ class FroxlorInstall
}
// show list of available distro's
$distributions_select_data = [];
$distros = glob(\Froxlor\FileDir::makeCorrectDir(\Froxlor\Froxlor::getInstallDir() . '/lib/configfiles/') . '*.xml');
foreach ($distros as $_distribution) {
$dist = new \Froxlor\Config\ConfigParser($_distribution);
$dist_display = $dist->distributionName . " " . $dist->distributionCodename . " (" . $dist->distributionVersion . ")";
if (!array_key_exists($dist_display, $distributions_select_data)) {
$distributions_select_data[$dist_display] = '';
}
$distributions_select_data[$dist_display] .= str_replace(".xml", "", strtolower(basename($_distribution)));
}
// sort by distribution name
ksort($distributions_select_data);
$distributions_select = '';
foreach ($distributions_select_data as $dist_display => $dist_index) {
// create select-box-option
$distributions_select .= \Froxlor\UI\HTML::makeoption($dist_display, $dist_index, $this->_data['distribution']);
$distributions_select .= \Froxlor\UI\HTML::makeoption($dist_display, $dist_index, $this->_data['distribution'] ?? '');
// $this->_data['distribution']
}
@@ -947,7 +952,7 @@ class FroxlorInstall
* optional css
* @param string $type
* optional type of input-box (default: text)
*
*
* @return string
*/
private function _getSectionItemString($fieldname = null, $required = false, $style = "", $type = 'text')
@@ -994,7 +999,6 @@ class FroxlorInstall
*/
private function _getSectionItemSelectbox($fieldname = null, $options = null, $style = "")
{
$groupname = $this->_lng['install'][$groupname];
$fieldlabel = $this->_lng['install'][$fieldname];
$sectionitem = "";
@@ -1239,7 +1243,7 @@ class FroxlorInstall
*
* @param string $template
* name of the template including subdirectory
*
*
* @return string
*/
private function _getTemplate($template = null)
@@ -1306,10 +1310,12 @@ class FroxlorInstall
// from form
if (! empty($_POST['serverip'])) {
$this->_data['serverip'] = $_POST['serverip'];
$this->_data['serverip'] = inet_ntop(inet_pton($this->_data['serverip']));
return;
// from $_SERVER
} elseif (! empty($_SERVER['SERVER_ADDR'])) {
$this->_data['serverip'] = $_SERVER['SERVER_ADDR'];
$this->_data['serverip'] = inet_ntop(inet_pton($this->_data['serverip']));
return;
}
// empty

View File

@@ -23,7 +23,7 @@ $lng['requirements']['notfound'] = 'not found';
$lng['requirements']['notinstalled'] = 'not installed';
$lng['requirements']['activated'] = 'enabled';
$lng['requirements']['phpversion'] = 'PHP version >= 7.0';
$lng['requirements']['newerphpprefered'] = 'Good, but php-7.1 is prefered.';
$lng['requirements']['newerphpprefered'] = 'Good, but php-7.1 is preferred.';
$lng['requirements']['phppdo'] = 'PHP PDO extension and PDO-MySQL driver...';
$lng['requirements']['phpsession'] = 'PHP session-extension...';
$lng['requirements']['phpctype'] = 'PHP ctype-extension...';
@@ -39,7 +39,7 @@ $lng['requirements']['phpjson'] = 'PHP json-extension...';
$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
$lng['requirements']['zipdescription'] = 'The auto-update feature requires the zip extension.';
$lng['requirements']['openbasedir'] = 'open_basedir...';
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the coresponding php.ini';
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the corresponding php.ini';
$lng['requirements']['mysqldump'] = 'MySQL dump tool';
$lng['requirements']['mysqldumpmissing'] = 'Automatic backup of possible existing database is not possible. Please install mysql-client tools';
$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';

View File

@@ -1,6 +1,7 @@
<?php
use Froxlor\Database\Database;
use Froxlor\Settings;
use Froxlor\Validate\Validate;
/**
* This file is part of the Froxlor project.
@@ -14,7 +15,7 @@ use Froxlor\Settings;
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install
*
*
*/
if (! defined('_CRON_UPDATE')) {
if (! defined('AREA') || (defined('AREA') && AREA != 'admin') || ! isset($userinfo['loginname']) || (isset($userinfo['loginname']) && $userinfo['loginname'] == '')) {
@@ -725,3 +726,203 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.10.23.1')) {
showUpdateStep("Updating from 0.10.23.1 to 0.10.24", false);
\Froxlor\Froxlor::updateToVersion('0.10.24');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202101200')) {
showUpdateStep("Adding setting for mail address used in SOA records", true);
Settings::AddNew("system.soaemail", '');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202102200');
}
/*
* skip due to potential "1118 Row size too large" error
*
if (\Froxlor\Froxlor::isDatabaseVersion('202102200')) {
showUpdateStep("Add new description fields to mail and domain table", true);
Database::query("ALTER TABLE panel_domains ADD `description` varchar(255) NOT NULL DEFAULT '' AFTER `ssl_sessiontickets`;");
Database::query("ALTER TABLE mail_virtual ADD `description` varchar(255) NOT NULL DEFAULT '' AFTER `iscatchall`");
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202103030');
}
*/
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.24')) {
showUpdateStep("Updating from 0.10.24 to 0.10.25", false);
\Froxlor\Froxlor::updateToVersion('0.10.25');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202102200') || \Froxlor\Froxlor::isDatabaseVersion('202103030')) {
showUpdateStep("Refactoring columns from large tables", true);
Database::query("ALTER TABLE panel_domains CHANGE `ssl_protocols` `ssl_protocols` varchar(255) NOT NULL DEFAULT '';");
Database::query("ALTER TABLE panel_domains CHANGE `ssl_cipher_list` `ssl_cipher_list` varchar(500) NOT NULL DEFAULT '';");
Database::query("ALTER TABLE panel_domains CHANGE `tlsv13_cipher_list` `tlsv13_cipher_list` varchar(500) NOT NULL DEFAULT '';");
lastStepStatus(0);
showUpdateStep("Add new description fields to mail and domain table", true);
$result = Database::query("DESCRIBE `panel_domains`");
$columnfound = 0;
while ($row = $result->fetch(PDO::FETCH_ASSOC)) {
if ($row['Field'] == 'description') {
$columnfound = 1;
}
}
if (! $columnfound) {
Database::query("ALTER TABLE panel_domains ADD `description` varchar(255) NOT NULL DEFAULT '' AFTER `ssl_sessiontickets`;");
}
$result = Database::query("DESCRIBE `mail_virtual`");
$columnfound = 0;
while ($row = $result->fetch(PDO::FETCH_ASSOC)) {
if ($row['Field'] == 'description') {
$columnfound = 1;
}
}
if (! $columnfound) {
Database::query("ALTER TABLE mail_virtual ADD `description` varchar(255) NOT NULL DEFAULT '' AFTER `iscatchall`");
}
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202103110');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202103110')) {
showUpdateStep("Adding settings for imprint, terms of use and privacy policy URLs", true);
Settings::AddNew("panel.imprint_url", '');
Settings::AddNew("panel.terms_url", '');
Settings::AddNew("panel.privacy_url", '');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202103240');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.25')) {
showUpdateStep("Updating from 0.10.25 to 0.10.26", false);
\Froxlor\Froxlor::updateToVersion('0.10.26');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202103240')) {
showUpdateStep("Adding setting for default serveralias value for new domains", true);
Settings::AddNew("system.domaindefaultalias", '0');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202106160');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202106160')) {
showUpdateStep("Adjusting Let's Encrypt endpoint configuration to support ZeroSSL", true);
if (Settings::Get('system.letsencryptca') == 'testing') {
Settings::Set("system.letsencryptca", 'letsencrypt_test');
} else {
Settings::Set("system.letsencryptca", 'letsencrypt');
}
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202106270');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202106270')) {
showUpdateStep("Adding custom logo image settings", true);
Settings::AddNew("panel.logo_image_header", '');
Settings::AddNew("panel.logo_image_login", '');
lastStepStatus(0);
// Migrating old custom logo over, if exists
$custom_logo_file_old = \Froxlor\Froxlor::getInstallDir() . '/templates/Sparkle/assets/img/logo_custom.png';
if (file_exists($custom_logo_file_old)) {
showUpdateStep("Migrating existing custom logo to new settings", true);
$path = \Froxlor\Froxlor::getInstallDir().'/img/';
if (!is_dir($path) && !mkdir($path, 0775)) {
throw new \Exception("img directory does not exist and cannot be created");
}
if (!is_writable($path)) {
if (!chmod($path, '0775')) {
throw new \Exception("Cannot write to img directory");
}
}
// Save as new custom logo header
$save_to = 'logo_header.png';
copy($custom_logo_file_old, $path.$save_to);
Settings::Set("panel.logo_image_header", "img/{$save_to}?v=".time());
// Save as new custom logo login
$save_to = 'logo_login.png';
copy($custom_logo_file_old, $path.$save_to);
Settings::Set("panel.logo_image_login", "img/{$save_to}?v=".time());
lastStepStatus(0);
}
\Froxlor\Froxlor::updateToDbVersion('202107070');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.26')) {
showUpdateStep("Updating from 0.10.26 to 0.10.27", false);
\Froxlor\Froxlor::updateToVersion('0.10.27');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107070')) {
showUpdateStep("Adding settings to overwrite theme- or custom theme-logo with the new logo settings", true);
Settings::AddNew("panel.logo_overridetheme", '0');
Settings::AddNew("panel.logo_overridecustom", '0');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107200');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107200')) {
showUpdateStep("Adding settings to define default value of 'create std-subdomain' when creating a customer", true);
Settings::AddNew("system.createstdsubdom_default", '1');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107210');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107210')) {
showUpdateStep("Normalizing ipv6 for correct comparison", true);
$result_stmt = Database::prepare("
SELECT `id`, `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "`"
);
Database::pexecute($result_stmt);
$upd_stmt = Database::prepare("UPDATE `" . TABLE_PANEL_IPSANDPORTS . "` SET `ip` = :ip WHERE `id` = :id");
while ($iprow = $result_stmt->fetch(\PDO::FETCH_ASSOC)) {
if (Validate::is_ipv6($iprow['ip'])) {
$ip = inet_ntop(inet_pton($iprow['ip']));
Database::pexecute($upd_stmt, [
'ip' => $ip,
'id' => $iprow['id']
]);
}
}
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107260');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107260')) {
showUpdateStep("Removing setting for search-engine allow yes/no", true);
Database::query("DELETE FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `settinggroup` = 'panel' AND `varname` = 'no_robots'");
lastStepStatus(0);
showUpdateStep("Adding setting to have all froxlor customers in a local group", true);
Settings::AddNew("system.froxlorusergroup", '');
Settings::AddNew("system.froxlorusergroup_gid", '');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107300');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107300')) {
showUpdateStep("Adds the possibility to select the PowerDNS Operation Mode", true);
Settings::AddNew("system.powerdns_mode", 'Native');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202108180');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.27')) {
showUpdateStep("Updating from 0.10.27 to 0.10.28", false);
\Froxlor\Froxlor::updateToVersion('0.10.28');
}

View File

@@ -2505,7 +2505,7 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.9.30')) {
showUpdateStep("Updating from 0.9.30 to 0.9.31-dev1", true);
lastStepStatus(0);
showUpdateStep("Removing unsused tables");
showUpdateStep("Removing unused tables");
Database::query("DROP TABLE IF EXISTS `ipsandports_docrootsettings`;");
Database::query("DROP TABLE IF EXISTS `domain_docrootsettings`;");
lastStepStatus(0);
@@ -2856,7 +2856,7 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.9.32-rc1')) {
Settings::AddNew("system.croncmdline", $croncmdline);
// add task to generate cron.d-file
\Froxlor\System\Cronjob::inserttask('99');
// silenty add the auto-update setting - we do not want everybody to know and use this
// silently add the auto-update setting - we do not want everybody to know and use this
// as it is a very dangerous setting
Settings::AddNew("system.cron_allowautoupdate", 0);
lastStepStatus(0);
@@ -3872,7 +3872,7 @@ opcache.interned_strings_buffer');
if (\Froxlor\Froxlor::isDatabaseVersion('201801110')) {
showUpdateStep("Adding php-fpm php PATH setting for envrironment");
showUpdateStep("Adding php-fpm php PATH setting for environment");
Settings::AddNew("phpfpm.envpath", '/usr/local/bin:/usr/bin:/bin');
lastStepStatus(0);

View File

@@ -19,7 +19,7 @@
* Function getPreConfig
*
* outputs various content before the update process
* can be continued (askes for agreement whatever is being asked)
* can be continued (asks for agreement whatever is being asked)
*
* @param string $current_version
* @param int $current_db_version

View File

@@ -414,7 +414,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version, $c
if (Settings::Get('system.webserver') == 'apache2') {
$has_preconfig = true;
$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in ordner to use it.<br />';
$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in order to use it.<br />';
$description .= '<pre>LoadModule authz_core_module modules/mod_authz_core.so
LoadModule authz_host_module modules/mod_authz_host.so</pre><br />';
$question = '<strong>Do you want to enable the Apache-2.4 modification?:</strong>&nbsp;';

View File

@@ -310,6 +310,13 @@ abstract class ApiCommand extends ApiParameter
} elseif (in_array($valoper['op'], $ops)) {
$condition .= $field . ' ' . $valoper['op'] . ':' . $cleanfield;
$query_fields[':' . $cleanfield] = $valoper['value'] ?? '';
} elseif (strtolower($valoper['op']) == 'in' && is_array($valoper['value']) && count($valoper['value']) > 0) {
$condition .= $field . ' ' . $valoper['op'] . ' (';
foreach ($valoper['value'] as $incnt => $invalue) {
$condition .= ":" . $cleanfield . $incnt . ", ";
$query_fields[':' . $cleanfield . $incnt] = $invalue ?? '';
}
$condition = substr($condition, 0, - 2) . ')';
} else {
continue;
}
@@ -518,7 +525,7 @@ abstract class ApiCommand extends ApiParameter
$customer_ids[] = $customer['customerid'];
}
} else {
if (!$this->isInternal() && ! empty($customer_hide_option) && \Froxlor\Settings::IsInList('panel.customer_hide_options', $customer_hide_option)) {
if (! $this->isInternal() && ! empty($customer_hide_option) && \Froxlor\Settings::IsInList('panel.customer_hide_options', $customer_hide_option)) {
throw new \Exception("You cannot access this resource", 405);
}
$customer_ids = array(

View File

@@ -189,7 +189,7 @@ class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
*/
public function listing()
{
// select all my (accessable) certificates
// select all my (accessible) certificates
$certs_stmt_query = "SELECT s.*, d.domain, d.letsencrypt, c.customerid, c.loginname
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
@@ -237,7 +237,7 @@ class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
*/
public function listingCount()
{
// select all my (accessable) certificates
// select all my (accessible) certificates
$certs_stmt_query = "SELECT COUNT(*) as num_certs
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`

View File

@@ -23,7 +23,7 @@ class CustomerBackups extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Re
{
/**
* check whether backup is enabled systemwide and if accessable for customer (hide_options)
* check whether backup is enabled systemwide and if accessible for customer (hide_options)
*
* @throws \Exception
*/

View File

@@ -33,7 +33,9 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* optional specify offset for resultset
* @param array $sql_orderby
* optional array with index = fieldname and value = ASC|DESC to order the resultset by one or more fields
*
* @param bool $show_usages
* optional, default false
*
* @access admin
* @throws \Exception
* @return string json-encoded array count|list
@@ -41,6 +43,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
public function listing()
{
if ($this->isAdmin()) {
$show_usages = $this->getBoolParam('show_usages', true, false);
$this->logger()->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "[API] list customers");
$query_fields = array();
$result_stmt = Database::prepare("
@@ -57,7 +60,47 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
$params = array_merge($params, $query_fields);
Database::pexecute($result_stmt, $params, true, true);
$result = array();
$domains_stmt = null;
$usages_stmt = null;
if ($show_usages) {
$domains_stmt = Database::prepare("
SELECT COUNT(`id`) AS `domains`
FROM `" . TABLE_PANEL_DOMAINS . "`
WHERE `customerid` = :cid
AND `parentdomainid` = '0'
AND `id`<> :stdd
");
$usages_stmt = Database::prepare("
SELECT * FROM `" . TABLE_PANEL_DISKSPACE . "`
WHERE `customerid` = :cid
ORDER BY `stamp` DESC LIMIT 1
");
}
while ($row = $result_stmt->fetch(\PDO::FETCH_ASSOC)) {
if ($show_usages) {
// get number of domains
Database::pexecute($domains_stmt, array(
'cid' => $row['customerid'],
'stdd' => $row['standardsubdomain']
));
$domains = $domains_stmt->fetch(\PDO::FETCH_ASSOC);
$row['domains'] = intval($domains['domains']);
// get disk-space usages for web, mysql and mail
$usages = Database::pexecute_first($usages_stmt, array(
'cid' => $row['customerid']
));
if ($usages) {
$row['webspace_used'] = $usages['webspace'];
$row['mailspace_used'] = $usages['mail'];
$row['dbspace_used'] = $usages['mysql'];
} else {
$row['webspace_used'] = 0;
$row['mailspace_used'] = 0;
$row['dbspace_used'] = 0;
}
}
$result[] = $row;
}
return $this->response(200, "successful", array(
@@ -103,6 +146,8 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* optional, the customer-id
* @param string $loginname
* optional, the loginname
* @param bool $show_usages
* optional, default false
*
* @access admin, customer
* @throws \Exception
@@ -113,6 +158,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
$id = $this->getParam('id', true, 0);
$ln_optional = ($id <= 0 ? false : true);
$loginname = $this->getParam('loginname', $ln_optional, '');
$show_usages = $this->getBoolParam('show_usages', true, false);
if ($this->isAdmin()) {
$result_stmt = Database::prepare("
@@ -142,6 +188,40 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
if (! $this->isAdmin() && $result['custom_notes_show'] != 1) {
$result['custom_notes'] = "";
}
if ($show_usages) {
// get number of domains
$domains_stmt = Database::prepare("
SELECT COUNT(`id`) AS `domains`
FROM `" . TABLE_PANEL_DOMAINS . "`
WHERE `customerid` = :cid
AND `parentdomainid` = '0'
AND `id`<> :stdd
");
Database::pexecute($domains_stmt, array(
'cid' => $result['customerid'],
'stdd' => $result['standardsubdomain']
));
$domains = $domains_stmt->fetch(\PDO::FETCH_ASSOC);
$result['domains'] = intval($domains['domains']);
// get disk-space usages for web, mysql and mail
$usages_stmt = Database::prepare("
SELECT * FROM `" . TABLE_PANEL_DISKSPACE . "`
WHERE `customerid` = :cid
ORDER BY `stamp` DESC LIMIT 1
");
$usages = Database::pexecute_first($usages_stmt, array(
'cid' => $result['customerid']
));
if ($usages) {
$result['webspace_used'] = $usages['webspace'];
$result['mailspace_used'] = $usages['mail'];
$result['dbspace_used'] = $usages['mysql'];
} else {
$result['webspace_used'] = 0;
$result['mailspace_used'] = 0;
$result['dbspace_used'] = 0;
}
}
$this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "[API] get customer '" . $result['loginname'] . "'");
return $this->response(200, "successful", $result);
}
@@ -228,7 +308,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* @param bool $mysqls_ul
* optional, whether customer should have unlimited mysql-databases, default 0 (false)
* @param bool $createstdsubdomain
* optional, whether to create a standard-subdomain ([loginname].froxlor-hostname.tld), default 0 (false)
* optional, whether to create a standard-subdomain ([loginname].froxlor-hostname.tld), default [system.createstdsubdom_default]
* @param bool $phpenabled
* optional, whether to allow usage of PHP, default 0 (false)
* @param array $allowed_phpconfigs
@@ -236,9 +316,9 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, wether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, wether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
* @param bool $store_defaultindex
* optional, whether to store the default index file to customers homedir
* @param int $hosting_plan_id
@@ -272,7 +352,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
$gender = (int) $this->getParam('gender', true, 0);
$custom_notes = $this->getParam('custom_notes', true, '');
$custom_notes_show = $this->getBoolParam('custom_notes_show', true, 0);
$createstdsubdomain = $this->getBoolParam('createstdsubdomain', true, 0);
$createstdsubdomain = $this->getBoolParam('createstdsubdomain', true, Settings::Get('system.createstdsubdom_default'));
$password = $this->getParam('new_customer_password', true, '');
$sendpassword = $this->getBoolParam('sendpassword', true, 0);
$store_defaultindex = $this->getBoolParam('store_defaultindex', true, 0);
@@ -843,9 +923,9 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
* @param string $theme
* optional, change theme
*
@@ -873,7 +953,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
$email = $this->getParam('email', true, $idna_convert->decode($result['email']));
$name = $this->getParam('name', true, $result['name']);
$firstname = $this->getParam('firstname', true, $result['firstname']);
$company_required = (! empty($name) && empty($firstname)) || (empty($name) && ! empty($firstname)) || (empty($name) && empty($firstname));
$company_required = empty($result['company']) && ((! empty($name) && empty($firstname)) || (empty($name) && ! empty($firstname)) || (empty($name) && empty($firstname)));
$company = $this->getParam('company', ($company_required ? false : true), $result['company']);
$street = $this->getParam('street', true, $result['street']);
$zipcode = $this->getParam('zipcode', true, $result['zipcode']);
@@ -1411,7 +1491,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
), true, true);
// first gather all domain-id's to clean up panel_domaintoip, dns-entries and certificates accordingly
$did_stmt = Database::prepare("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid` = :id");
$did_stmt = Database::prepare("SELECT `id`, `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid` = :id");
Database::pexecute($did_stmt, array(
'id' => $id
), true, true);
@@ -1431,6 +1511,10 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
Database::pexecute($stmt, array(
'did' => $row['id']
), true, true);
// remove domains DNS from powerDNS if used, #581
\Froxlor\System\Cronjob::inserttask('11', $row['domain']);
// remove domain from acme.sh / lets encrypt if used
\Froxlor\System\Cronjob::inserttask('12', $row['domain']);
}
// remove customer domains
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid` = :id");

View File

@@ -322,7 +322,7 @@ class DirOptions extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
/**
* returns the total number of accessable directory options
* returns the total number of accessible directory options
*
* @param int $customerid
* optional, admin-only, select directory-protections of a specific customer by id

View File

@@ -305,7 +305,7 @@ class DirProtections extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Res
}
/**
* returns the total number of accessable directory protections
* returns the total number of accessible directory protections
*
* @param int $customerid
* optional, admin-only, select directory-protections of a specific customer by id

View File

@@ -136,8 +136,24 @@ class DomainZones extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
// types
if ($type == 'A' && filter_var($content, FILTER_VALIDATE_IP, FILTER_FLAG_IPV4) === false) {
$errors[] = $this->lng['error']['dns_arec_noipv4'];
} elseif ($type == 'A') {
// check whether there is a CNAME-record for the same resource
foreach ($dom_entries as $existing_entries) {
if ($existing_entries['type'] == 'CNAME' && $existing_entries['record'] == $record) {
$errors[] = $this->lng['error']['dns_other_nomorerr'];
break;
}
}
} elseif ($type == 'AAAA' && filter_var($content, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6) === false) {
$errors[] = $this->lng['error']['dns_aaaarec_noipv6'];
} elseif ($type == 'AAAA') {
// check whether there is a CNAME-record for the same resource
foreach ($dom_entries as $existing_entries) {
if ($existing_entries['type'] == 'CNAME' && $existing_entries['record'] == $record) {
$errors[] = $this->lng['error']['dns_other_nomorerr'];
break;
}
}
} elseif ($type == 'CAA' && ! empty($content)) {
$re = '/(?\'critical\'\d)\h*(?\'type\'iodef|issue|issuewild)\h*(?\'value\'(?\'issuevalue\'"(?\'domain\'(?=.{3,128}$)(?>(?>[a-zA-Z0-9]+[a-zA-Z0-9-]*[a-zA-Z0-9]+|[a-zA-Z0-9]+)\.)*(?>[a-zA-Z]{2,}|[a-zA-Z0-9]{2,}\.[a-zA-Z]{2,}))[;\h]*(?\'parameters\'(?>[a-zA-Z0-9]{1,60}=[a-zA-Z0-9]{1,60}\h*)+)?")|(?\'iodefvalue\'"(?\'url\'(mailto:.*|http:\/\/.*|https:\/\/.*))"))/';
preg_match($re, $content, $matches);
@@ -198,6 +214,10 @@ class DomainZones extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$errors[] = $this->lng['error']['dns_mx_noalias'];
break;
}
elseif ($existing_entries['type'] == 'CNAME' && $existing_entries['record'] == $record) {
$errors[] = $this->lng['error']['dns_other_nomorerr'];
break;
}
}
}
// append trailing dot (again)
@@ -210,6 +230,14 @@ class DomainZones extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
}
if (! \Froxlor\Validate\Validate::validateDomain($content)) {
$errors[] = $this->lng['error']['dns_ns_invaliddom'];
} else {
// check whether there is a CNAME-record for the same resource
foreach ($dom_entries as $existing_entries) {
if ($existing_entries['type'] == 'CNAME' && $existing_entries['record'] == $record) {
$errors[] = $this->lng['error']['dns_other_nomorerr'];
break;
}
}
}
// append trailing dot (again)
$content .= '.';

View File

@@ -77,7 +77,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
}
/**
* returns the total number of accessable domains
* returns the total number of accessible domains
*
* @access admin
* @throws \Exception
@@ -193,6 +193,27 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
return $ipandports;
}
/**
* get ips from array of id's
*
* @param array $ips
* @return array
*/
private function getIpsFromIdArray(array $ids)
{
$resultips_stmt = Database::prepare("
SELECT `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE id = :id
");
$result = [];
foreach ($ids as $id) {
$entry = Database::pexecute_first($resultips_stmt, array(
'id' => $id
));
$result[] = $entry['ip'];
}
return $result;
}
/**
* add new domain entry
*
@@ -213,7 +234,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
* @param bool $email_only
* optional, restrict domain to email usage, default 0 (false)
* @param int $selectserveralias
* optional, 0 = wildcard, 1 = www-alias, 2 = none, default 0
* optional, 0 = wildcard, 1 = www-alias, 2 = none, default [system.domaindefaultalias]
* @param bool $speciallogfile
* optional, whether to create an exclusive web-logfile for this domain, default 0 (false)
* @param int $alias
@@ -288,6 +309,8 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
* optional list of allowed/used ssl/tls ciphers, see system.ssl_cipher_list setting, only used/required if $override_tls is true, default empty or system.ssl_cipher_list setting if $override_tls is true
* @param string $tlsv13_cipher_list
* optional list of allowed/used tls-1.3 specific ciphers, see system.tlsv13_cipher_list setting, only used/required if $override_tls is true, default empty or system.tlsv13_cipher_list setting if $override_tls is true
* @param string $description
* optional custom description (currently not used/shown in the frontend), default empty
*
* @access admin
* @throws \Exception
@@ -307,7 +330,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$subcanemaildomain = $this->getParam('subcanemaildomain', true, 0);
$isemaildomain = $this->getBoolParam('isemaildomain', true, 0);
$email_only = $this->getBoolParam('email_only', true, 0);
$serveraliasoption = $this->getParam('selectserveralias', true, 0);
$serveraliasoption = $this->getParam('selectserveralias', true, Settings::Get('system.domaindefaultalias'));
$speciallogfile = $this->getBoolParam('speciallogfile', true, 0);
$aliasdomain = intval($this->getParam('alias', true, 0));
$issubof = $this->getParam('issubof', true, 0);
@@ -354,6 +377,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$tlsv13_cipher_list = $this->getParam('tlsv13_cipher_list', true, Settings::Get('system.tlsv13_cipher_list'));
}
}
$description = $this->getParam('description', true, '');
// validation
$p_domain = strtolower($p_domain);
@@ -571,6 +595,15 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$include_specialsettings = 0;
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($domain);
$selected_ips = $this->getIpsFromIdArray($ssl_ipandports);
if ($domain_ips == false || count(array_intersect($selected_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// We can't enable let's encrypt for wildcard-domains
if ($serveraliasoption == '0' && $letsencrypt == '1') {
\Froxlor\UI\Response::standard_error('nowildcardwithletsencrypt', '', true);
@@ -728,7 +761,8 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
'tlsv13_cipher_list' => $tlsv13_cipher_list,
'sslenabled' => $sslenabled,
'honorcipherorder' => $honorcipherorder,
'sessiontickets' => $sessiontickets
'sessiontickets' => $sessiontickets,
'description' => $description
);
$ins_stmt = Database::prepare("
@@ -780,7 +814,8 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
`tlsv13_cipher_list` = :tlsv13_cipher_list,
`ssl_enabled` = :sslenabled,
`ssl_honorcipherorder` = :honorcipherorder,
`ssl_sessiontickets`= :sessiontickets
`ssl_sessiontickets` = :sessiontickets,
`description` = :description
");
Database::pexecute($ins_stmt, $ins_data, true, true);
$domainid = Database::lastInsertId();
@@ -932,6 +967,8 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
* optional whether to honor the (server) cipher order for this domain. default 0 (false), requires SSL
* @param bool $sessiontickets
* optional whether to enable or disable TLS sessiontickets (RFC 5077) for this domain. default 1 (true), requires SSL
* @param string $description
* optional custom description (currently not used/shown in the frontend), default empty
*
* @access admin
* @throws \Exception
@@ -1027,6 +1064,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$ssl_cipher_list = $result['ssl_cipher_list'];
$tlsv13_cipher_list = $result['tlsv13_cipher_list'];
}
$description = $this->getParam('description', true, $result['description']);
// count subdomain usage of source-domain
$subdomains_stmt = Database::prepare("
@@ -1318,6 +1356,15 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$include_specialsettings = 0;
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($result['domain']);
$selected_ips = $this->getIpsFromIdArray($ssl_ipandports);
if ($domain_ips == false || count(array_intersect($selected_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// We can't enable let's encrypt for wildcard-domains
if ($serveraliasoption == '0' && $letsencrypt == '1') {
\Froxlor\UI\Response::standard_error('nowildcardwithletsencrypt', '', true);
@@ -1589,6 +1636,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$update_data['sslenabled'] = $sslenabled;
$update_data['honorcipherorder'] = $honorcipherorder;
$update_data['sessiontickets'] = $sessiontickets;
$update_data['description'] = $description;
$update_data['id'] = $id;
$update_stmt = Database::prepare("
@@ -1634,7 +1682,8 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
`tlsv13_cipher_list` = :tlsv13_cipher_list,
`ssl_enabled` = :sslenabled,
`ssl_honorcipherorder` = :honorcipherorder,
`ssl_sessiontickets` = :sessiontickets
`ssl_sessiontickets` = :sessiontickets,
`description` = :description
WHERE `id` = :id
");
Database::pexecute($update_stmt, $update_data, true, true);
@@ -1692,9 +1741,6 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
");
Database::pexecute($_update_stmt, $_update_data, true, true);
// insert a rebuild-task
\Froxlor\System\Cronjob::inserttask('1');
// Cleanup domain <-> ip mapping
$del_stmt = Database::prepare("
DELETE FROM `" . TABLE_DOMAINTOIP . "` WHERE `id_domain` = :id

View File

@@ -100,7 +100,7 @@ class EmailAccounts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Reso
// alternative email address to send info to
if (Settings::Get('panel.sendalternativemail') == 1) {
$alternative_email = $idna_convert->encode(\Froxlor\Validate\Validate::validate($alternative_email, 'alternative_email', '', '', array(), true));
if (!empty($alternative_email) && ! \Froxlor\Validate\Validate::validateEmail($alternative_email)) {
if (! empty($alternative_email) && ! \Froxlor\Validate\Validate::validateEmail($alternative_email)) {
\Froxlor\UI\Response::standard_error('alternativeemailiswrong', $alternative_email, true);
}
} else {
@@ -192,7 +192,7 @@ class EmailAccounts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Reso
$replace_arr = array(
'EMAIL' => $email_full,
'USERNAME' => $username,
'PASSWORD' => $password,
'PASSWORD' => htmlentities(htmlentities($password)),
'SALUTATION' => \Froxlor\User::getCorrectUserSalutation($customer),
'NAME' => $customer['name'],
'FIRSTNAME' => $customer['firstname'],
@@ -236,7 +236,7 @@ class EmailAccounts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Reso
$this->mailer()->clearAddresses();
// customer wants to send the e-mail to an alternative email address too
if (Settings::Get('panel.sendalternativemail') == 1 && !empty($alternative_email)) {
if (Settings::Get('panel.sendalternativemail') == 1 && ! empty($alternative_email)) {
// get template for mail subject
$mail_subject = $this->getMailTemplate($customer, 'mails', 'pop_success_alternative_subject', $replace_arr, $this->lng['mails']['pop_success_alternative']['subject']);
// get template for mail body
@@ -302,6 +302,8 @@ class EmailAccounts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Reso
* optional, update quota
* @param string $email_password
* optional, update password
* @param bool $deactivated
* optional, admin-only
*
* @access admin, customer
* @throws \Exception
@@ -331,6 +333,7 @@ class EmailAccounts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Reso
$password = $this->getParam('email_password', true, '');
$quota = $this->getParam('email_quota', true, $result['quota']);
$deactivated = $this->getBoolParam('deactivated', true, (strtolower($result['postfix']) == 'n' ? true : false));
// get needed customer info to reduce the email-account-counter by one
$customer = $this->getCustomerData();
@@ -372,6 +375,18 @@ class EmailAccounts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Reso
$quota = 0;
}
if ($this->isAdmin()) {
if (($deactivated == true && strtolower($result['postfix']) == 'y') || ($deactivated == false && strtolower($result['postfix']) == 'n')) {
if (! empty($upd_query)) {
$upd_query .= ", ";
}
$upd_query .= "`postfix` = :postfix, `imap` = :imap, `pop3` = :pop3";
$upd_params['postfix'] = $deactivated ? 'N' : 'Y';
$upd_params['imap'] = $deactivated ? '0' : '1';
$upd_params['pop3'] = $deactivated ? '0' : '1';
}
}
// build update query
if (! empty($upd_query)) {
$upd_stmt = Database::prepare("

View File

@@ -35,6 +35,8 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, required when called as admin (if $loginname is not specified)
* @param string $loginname
* optional, required when called as admin (if $customerid is not specified)
* @param string $description
* optional custom description (currently not used/shown in the frontend), default empty
*
* @access admin, customer
* @throws \Exception
@@ -54,6 +56,7 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
// parameters
$iscatchall = $this->getBoolParam('iscatchall', true, 0);
$description = $this->getParam('description', true, '');
// validation
if (substr($domain, 0, 4) != 'xn--') {
@@ -121,14 +124,16 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
`email` = :email,
`email_full` = :email_full,
`iscatchall` = :iscatchall,
`domainid` = :domainid
`domainid` = :domainid,
`description` = :description
");
$params = array(
"cid" => $customer['customerid'],
"email" => $email,
"email_full" => $email_full,
"iscatchall" => $iscatchall,
"domainid" => $domain_check['id']
"domainid" => $domain_check['id'],
"description" => $description
);
Database::pexecute($stmt, $params, true, true);
@@ -167,7 +172,7 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
$customer_ids = $this->getAllowedCustomerIds('email');
$params['idea'] = ($id <= 0 ? $emailaddr : $id);
$result_stmt = Database::prepare("SELECT v.`id`, v.`email`, v.`email_full`, v.`iscatchall`, v.`destination`, v.`customerid`, v.`popaccountid`, v.`domainid`, u.`quota`
$result_stmt = Database::prepare("SELECT v.`id`, v.`email`, v.`email_full`, v.`iscatchall`, v.`destination`, v.`customerid`, v.`popaccountid`, v.`domainid`, v.`description`, u.`quota`, u.`imap`, u.`pop3`, u.`postfix`, u.`mboxsize`
FROM `" . TABLE_MAIL_VIRTUAL . "` v
LEFT JOIN `" . TABLE_MAIL_USERS . "` u ON v.`popaccountid` = u.`id`
WHERE v.`customerid` IN (" . implode(", ", $customer_ids) . ")
@@ -195,6 +200,8 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, required when called as admin (if $customerid is not specified)
* @param boolean $iscatchall
* optional
* @param string $description
* optional custom description (currently not used/shown in the frontend), default empty
*
* @access admin, customer
* @throws \Exception
@@ -227,6 +234,7 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
// parameters
$iscatchall = $this->getBoolParam('iscatchall', true, $result['iscatchall']);
$description = $this->getParam('description', true, $result['description']);
// get needed customer info to reduce the email-address-counter by one
$customer = $this->getCustomerData();
@@ -256,12 +264,13 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
$stmt = Database::prepare("
UPDATE `" . TABLE_MAIL_VIRTUAL . "`
SET `email` = :email , `iscatchall` = :caflag
SET `email` = :email , `iscatchall` = :caflag, `description` = :description
WHERE `customerid`= :cid AND `id`= :id
");
$params = array(
"email" => $email,
"caflag" => $iscatchall,
"description" => $description,
"cid" => $customer['customerid'],
"id" => $id
);
@@ -300,7 +309,7 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
$result = array();
$query_fields = array();
$result_stmt = Database::prepare("
SELECT m.`id`, m.`domainid`, m.`email`, m.`email_full`, m.`iscatchall`, u.`quota`, m.`destination`, m.`popaccountid`, d.`domain`, u.`mboxsize`
SELECT m.`id`, m.`domainid`, m.`email`, m.`email_full`, m.`iscatchall`, m.`destination`, m.`popaccountid`, d.`domain`, u.`quota`, u.`imap`, u.`pop3`, u.`postfix`, u.`mboxsize`
FROM `" . TABLE_MAIL_VIRTUAL . "` m
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON (m.`domainid` = d.`id`)
LEFT JOIN `" . TABLE_MAIL_USERS . "` u ON (m.`popaccountid` = u.`id`)
@@ -317,7 +326,7 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
}
/**
* returns the total number of accessable email addresses
* returns the total number of accessible email addresses
*
* @param int $customerid
* optional, admin-only, select email addresses of a specific customer by id

View File

@@ -79,7 +79,7 @@ class FpmDaemons extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
/**
* returns the total number of accessable fpm daemons
* returns the total number of accessible fpm daemons
*
* @access admin
* @throws \Exception

View File

@@ -62,7 +62,7 @@ class Ftps extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntit
if (($this->getUserDetail('ftps_used') < $this->getUserDetail('ftps') || $this->getUserDetail('ftps') == '-1') || $this->isAdmin() && $is_defaultuser == 1) {
// required paramters
// required parameters
$path = $this->getParam('path');
$password = $this->getParam('ftp_password');
@@ -245,7 +245,7 @@ class Ftps extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntit
'COMPANY' => $customer['company'],
'CUSTOMER_NO' => $customer['customernumber'],
'USR_NAME' => $username,
'USR_PASS' => $password,
'USR_PASS' => htmlentities(htmlentities($password)),
'USR_PATH' => \Froxlor\FileDir::makeCorrectDir(str_replace($customer['documentroot'], "/", $path))
);
// get template for mail subject
@@ -512,7 +512,7 @@ class Ftps extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntit
}
/**
* returns the total number of accessable ftp accounts
* returns the total number of accessible ftp accounts
*
* @param int $customerid
* optional, admin-only, select ftp-users of a specific customer by id

View File

@@ -66,7 +66,7 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
}
/**
* returns the total number of accessable hosting plans
* returns the total number of accessible hosting plans
*
* @access admin
* @throws \Exception
@@ -182,9 +182,9 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
*
* @access admin
* @throws \Exception
@@ -309,9 +309,9 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, either to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, either to allow access to webserver access/error-logs, default 0 (false)
*
* @access admin
* @throws \Exception

View File

@@ -65,7 +65,7 @@ class IpsAndPorts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
}
/**
* returns the total number of accessable ip/port entries
* returns the total number of accessible ip/port entries
*
* @access admin
* @throws \Exception
@@ -247,6 +247,9 @@ class IpsAndPorts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$docroot = '';
}
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($ip));
$result_checkfordouble_stmt = Database::prepare("
SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "`
WHERE `ip` = :ip AND `port` = :port");
@@ -462,6 +465,9 @@ class IpsAndPorts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$docroot = '';
}
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($ip));
if ($result['ip'] != $ip && $result['ip'] == Settings::Get('system.ipaddress') && $result_sameipotherport == false) {
\Froxlor\UI\Response::standard_error('cantchangesystemip', '', true);
} elseif ($result_checkfordouble && $result_checkfordouble['id'] != '' && $result_checkfordouble['id'] != $id) {

View File

@@ -17,7 +17,7 @@ use Froxlor\Settings;
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package API
* @since 0.10.0
*
*
*/
class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntity
{
@@ -31,25 +31,28 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, default is 0
* @param string $description
* optional, description for database
* @param string $custom_suffix
* optional, name for database
* @param bool $sendinfomail
* optional, send created resource-information to customer, default: false
* @param int $customerid
* optional, required when called as admin (if $loginname is not specified)
* @param string $loginname
* optional, required when called as admin (if $customerid is not specified)
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
*/
public function add()
{
// required paramters
// required parameters
$password = $this->getParam('mysql_password');
// parameters
$dbserver = $this->getParam('mysql_server', true, 0);
$databasedescription = $this->getParam('description', true, '');
$databasename = $this->getParam('custom_suffix', true, '');
$sendinfomail = $this->getBoolParam('sendinfomail', true, 0);
// get needed customer info to reduce the mysql-usage-counter by one
$customer = $this->getCustomerData('mysqls');
@@ -58,6 +61,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
$password = \Froxlor\Validate\Validate::validate($password, 'password', '', '', array(), true);
$password = \Froxlor\System\Crypt::validatePassword($password, true);
$databasedescription = \Froxlor\Validate\Validate::validate(trim($databasedescription), 'description', '', '', array(), true);
$databasename = \Froxlor\Validate\Validate::validate(trim($databasename), 'database_name', '', '', array(), true);
// validate whether the dbserver exists
$dbserver = \Froxlor\Validate\Validate::validate($dbserver, html_entity_decode($this->lng['mysql']['mysql_server']), '', '', 0, true);
@@ -79,7 +83,12 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
);
// create database, user, set permissions, etc.pp.
$dbm = new \Froxlor\Database\DbManager($this->logger());
$username = $dbm->createDatabase($newdb_params['loginname'], $password, $newdb_params['mysql_lastaccountnumber']);
if(strtoupper(Settings::Get('customer.mysqlprefix')) == 'DBNAME' && !empty($databasename)) {
$username = $dbm->createDatabase($newdb_params['loginname'].'_'.$databasename, $password);
} else {
$username = $dbm->createDatabase($newdb_params['loginname'], $password, $newdb_params['mysql_lastaccountnumber']);
}
// we've checked against the password in dbm->createDatabase
if ($username == false) {
@@ -88,13 +97,13 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
// add database info to froxlor
$stmt = Database::prepare("
INSERT INTO `" . TABLE_PANEL_DATABASES . "`
SET
`customerid` = :customerid,
`databasename` = :databasename,
`description` = :description,
`dbserver` = :dbserver
");
INSERT INTO `" . TABLE_PANEL_DATABASES . "`
SET
`customerid` = :customerid,
`databasename` = :databasename,
`description` = :description,
`dbserver` = :dbserver
");
$params = array(
"customerid" => $customer['customerid'],
"databasename" => $username,
@@ -130,7 +139,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
'COMPANY' => $userinfo['company'],
'CUSTOMER_NO' => $userinfo['customernumber'],
'DB_NAME' => $username,
'DB_PASS' => $password,
'DB_PASS' => htmlentities(htmlentities($password)),
'DB_DESC' => $databasedescription,
'DB_SRV' => $sql_root['host'],
'PMA_URI' => $pma
@@ -181,7 +190,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, the databasename
* @param int $mysql_server
* optional, specify database-server, default is none
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
@@ -281,7 +290,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, required when called as admin (if $loginname is not specified)
* @param string $loginname
* optional, required when called as admin (if $customerid is not specified)
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
@@ -305,7 +314,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
));
$id = $result['id'];
// paramters
// parameters
$password = $this->getParam('mysql_password', true, '');
$databasedescription = $this->getParam('description', true, $result['description']);
@@ -370,7 +379,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional specify offset for resultset
* @param array $sql_orderby
* optional array with index = fieldname and value = ASC|DESC to order the resultset by one or more fields
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array count|list
@@ -428,13 +437,13 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
}
/**
* returns the total number of accessable databases
* returns the total number of accessible databases
*
* @param int $customerid
* optional, admin-only, select dbs of a specific customer by id
* @param string $loginname
* optional, admin-only, select dbs of a specific customer by loginname
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
@@ -465,7 +474,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, required when called as admin (if $loginname is not specified)
* @param string $loginname
* optional, required when called as admin (if $customerid is not specified)
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array

View File

@@ -59,7 +59,7 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
);
$query = "SELECT * FROM `" . TABLE_PANEL_DOMAINS . "`
WHERE `phpsettingid` = :id";
WHERE `phpsettingid` = :id AND `email_only` = '0' AND `phpenabled` = '1'";
if (! $with_subdomains) {
$query .= " AND `parentdomainid` = '0'";
@@ -122,7 +122,7 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
}
/**
* returns the total number of accessable php-setting entries
* returns the total number of accessible php-setting entries
*
* @access admin
* @throws \Exception

View File

@@ -2,6 +2,7 @@
namespace Froxlor\Api\Commands;
use Froxlor\Database\Database;
use Froxlor\Domain\Domain;
use Froxlor\Settings;
/**
@@ -230,6 +231,15 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$our_ips = Domain::getIpsOfDomain($domain_check['id']);
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($completedomain);
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// Temporarily deactivate ssl_redirect until Let's Encrypt certificate was generated
if ($ssl_redirect > 0 && $letsencrypt == 1) {
$ssl_redirect = 2;
@@ -595,6 +605,15 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($result['letsencrypt'] != $letsencrypt && $letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$our_ips = Domain::getIpsOfDomain($result['parentdomainid']);
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($result['domain']);
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// We can't enable let's encrypt for wildcard-domains
if ($iswildcarddomain == '1' && $letsencrypt == '1') {
\Froxlor\UI\Response::standard_error('nowildcardwithletsencrypt');
@@ -624,7 +643,7 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
\Froxlor\Domain\Domain::updateRedirectOfDomain($id, $redirectcode);
}
if ($path != $result['documentroot'] || $isemaildomain != $result['isemaildomain'] || $wwwserveralias != $result['wwwserveralias'] || $iswildcarddomain != $result['iswildcarddomain'] || $aliasdomain != $result['aliasdomain'] || $openbasedir_path != $result['openbasedir_path'] || $ssl_redirect != $result['ssl_redirect'] || $letsencrypt != $result['letsencrypt'] || $hsts_maxage != $result['hsts'] || $hsts_sub != $result['hsts_sub'] || $hsts_preload != $result['hsts_preload'] || $phpsettingid != $result['phpsettingid']) {
if ($path != $result['documentroot'] || $isemaildomain != $result['isemaildomain'] || $wwwserveralias != $result['wwwserveralias'] || $iswildcarddomain != $result['iswildcarddomain'] || $aliasdomain != (int)$result['aliasdomain'] || $openbasedir_path != $result['openbasedir_path'] || $ssl_redirect != $result['ssl_redirect'] || $letsencrypt != $result['letsencrypt'] || $hsts_maxage != $result['hsts'] || $hsts_sub != $result['hsts_sub'] || $hsts_preload != $result['hsts_preload'] || $phpsettingid != $result['phpsettingid']) {
$stmt = Database::prepare("
UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
`documentroot` = :documentroot,
@@ -810,7 +829,7 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
/**
* returns the total number of accessable subdomain entries
* returns the total number of accessible subdomain entries
*
* @param int $customerid
* optional, admin-only, select (sub)domains of a specific customer by id

View File

@@ -150,7 +150,7 @@ abstract class BulkAction
/**
* reads in the csv import file and returns an array with
* all the entites to be imported
* all the entities to be imported
*
* @param string $separator
*

View File

@@ -402,7 +402,7 @@ class ConfigServicesAction extends \Froxlor\Cli\Action
} elseif (! file_exists($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
} elseif (! is_readable($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor direcotry cannot be read ('" . $this->_args["froxlor-dir"] . "')");
throw new \Exception("Given froxlor directory cannot be read ('" . $this->_args["froxlor-dir"] . "')");
}
}
}

View File

@@ -62,7 +62,7 @@ class SwitchServerIpAction extends \Froxlor\Cli\Action
$ip_list = $this->_args['switch'];
if (empty($ip_list) || is_bool($ip_list)) {
throw new \Exception("No paramters given for --switch action.");
throw new \Exception("No parameters given for --switch action.");
}
$ips_to_switch = array();
@@ -179,7 +179,7 @@ class SwitchServerIpAction extends \Froxlor\Cli\Action
} elseif (! file_exists($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
} elseif (! is_readable($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor direcotry cannot be read ('" . $this->_args["froxlor-dir"] . "')");
throw new \Exception("Given froxlor directory cannot be read ('" . $this->_args["froxlor-dir"] . "')");
}
}
}

View File

@@ -55,7 +55,7 @@ class ConfigDaemon
private $isparsed = false;
/**
* Sub - area of the full - XML only holding the daemon - data we are interessted in
* Sub - area of the full - XML only holding the daemon - data we are interested in
*
* @var \SimpleXMLElement
*/

View File

@@ -1,6 +1,8 @@
<?php
namespace Froxlor\Cron\Dns;
use Froxlor\Settings;
/**
* This file is part of the Froxlor project.
* Copyright (c) 2016 the Froxlor Team (see authors).
@@ -13,7 +15,7 @@ namespace Froxlor\Cron\Dns;
* @author Froxlor team <team@froxlor.org> (2016-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Cron
*
*
*/
class PowerDNS extends DnsBase
{
@@ -111,15 +113,16 @@ class PowerDNS extends DnsBase
private function insertZone($domainname, $serial = 0)
{
$ins_stmt = \Froxlor\Dns\PowerDNS::getDB()->prepare("
INSERT INTO domains set `name` = :domainname, `notified_serial` = :serial, `type` = 'NATIVE'
$ins_stmt = \Froxlor\Dns\PowerDNS::getDB()->prepare("
INSERT INTO domains set `name` = :domainname, `notified_serial` = :serial, `type` = :type
");
$ins_stmt->execute(array(
'domainname' => $domainname,
'serial' => $serial
));
$lastid = \Froxlor\Dns\PowerDNS::getDB()->lastInsertId();
return $lastid;
$ins_stmt->execute(array(
'domainname' => $domainname,
'serial' => $serial,
'type' => strtoupper(Settings::Get('system.powerdns_mode'))
));
$lastid = \Froxlor\Dns\PowerDNS::getDB()->lastInsertId();
return $lastid;;
}
private function insertRecords($domainid = 0, $records = array(), $origin = "")

View File

@@ -565,7 +565,7 @@ class Apache extends HttpConfigBase
*
* @return string
*/
protected function composePhpOptions($domain, $ssl_vhost = false)
protected function composePhpOptions(&$domain, $ssl_vhost = false)
{
$php_options_text = '';
@@ -788,14 +788,6 @@ class Apache extends HttpConfigBase
));
$logfiles_text .= ' CustomLog "|' . $command . '" ' . $logtype . "\n";
} else {
// Create the logfile if it does not exist (fixes #46)
touch($error_log);
chown($error_log, Settings::Get('system.httpuser'));
chgrp($error_log, Settings::Get('system.httpgroup'));
touch($access_log);
chown($access_log, Settings::Get('system.httpuser'));
chgrp($access_log, Settings::Get('system.httpgroup'));
$logfiles_text .= ' ErrorLog "' . $error_log . '"' . "\n";
$logfiles_text .= ' CustomLog "' . $access_log . '" ' . $logtype . "\n";
}
@@ -834,7 +826,7 @@ class Apache extends HttpConfigBase
// After inserting the AWStats information,
// be sure to build the awstats conf file as well
// and chown it using $awstats_params, #258
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
}
}

View File

@@ -24,7 +24,7 @@ use Froxlor\Cron\Http\Php\PhpInterface;
class ApacheFcgi extends Apache
{
protected function composePhpOptions($domain, $ssl_vhost = false)
protected function composePhpOptions(&$domain, $ssl_vhost = false)
{
$php_options_text = '';
@@ -43,6 +43,8 @@ class ApacheFcgi extends Apache
$php_options_text .= ' SuexecUserGroup "' . $domain['loginname'] . '" "' . $domain['loginname'] . '"' . "\n";
}
$domain['fpm_socket'] = $php->getInterface()->getSocketFile();
// mod_proxy stuff for apache-2.4
if (Settings::Get('system.apache24') == '1' && Settings::Get('phpfpm.use_mod_proxy') == '1') {
$filesmatch = $phpconfig['fpm_settings']['limit_extensions'];
@@ -54,7 +56,7 @@ class ApacheFcgi extends Apache
// start block, cut off last pipe and close block
$filesmatch = '(' . str_replace(".", "\.", substr($filesmatch, 0, - 1)) . ')';
$php_options_text .= ' <FilesMatch \.' . $filesmatch . '$>' . "\n";
$php_options_text .= ' SetHandler proxy:unix:' . $php->getInterface()->getSocketFile() . '|fcgi://localhost' . "\n";
$php_options_text .= ' SetHandler proxy:unix:' . $domain['fpm_socket'] . '|fcgi://localhost' . "\n";
$php_options_text .= ' </FilesMatch>' . "\n";
$mypath_dir = new \Froxlor\Http\Directory($domain['documentroot']);
@@ -80,7 +82,7 @@ class ApacheFcgi extends Apache
if ($phpconfig['pass_authorizationheader'] == '1') {
$addheader = " -pass-header Authorization";
}
$php_options_text .= ' FastCgiExternalServer ' . $php->getInterface()->getAliasConfigDir() . $srvName . ' -socket ' . $php->getInterface()->getSocketFile() . ' -idle-timeout ' . $phpconfig['fpm_settings']['idle_timeout'] . $addheader . "\n";
$php_options_text .= ' FastCgiExternalServer ' . $php->getInterface()->getAliasConfigDir() . $srvName . ' -socket ' . $domain['fpm_socket'] . ' -idle-timeout ' . $phpconfig['fpm_settings']['idle_timeout'] . $addheader . "\n";
$php_options_text .= ' <Directory "' . \Froxlor\FileDir::makeCorrectDir($domain['documentroot']) . '">' . "\n";
$filesmatch = $phpconfig['fpm_settings']['limit_extensions'];
$extensions = explode(" ", $filesmatch);

View File

@@ -287,7 +287,7 @@ class ConfigIO
}
/**
* returns a file/direcotry from the settings and checks whether it exists
* returns a file/directory from the settings and checks whether it exists
*
* @param string $group
* settings-group

View File

@@ -98,8 +98,12 @@ class HttpConfigBase
'IP' => $ip,
'PORT' => $port,
'SCHEME' => ($is_ssl_vhost) ? 'https' : 'http',
'DOCROOT' => $domain['documentroot']
'DOCROOT' => $domain['documentroot'],
'FPMSOCKET' => ''
);
if ((int) Settings::Get('phpfpm.enabled') == 1 && isset($domain['fpm_socket']) && !empty($domain['fpm_socket'])) {
$templateVars['FPMSOCKET'] = $domain['fpm_socket'];
}
return \Froxlor\PhpHelper::replaceVariables($template, $templateVars);
}

View File

@@ -21,13 +21,21 @@ use Froxlor\FileDir;
* @author Froxlor team <team@froxlor.org> (2016-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Cron
*
*
* @since 0.9.35
*
*
*/
class AcmeSh extends \Froxlor\Cron\FroxlorCron
{
const ACME_PROVIDER = [
'letsencrypt' => "https://acme-v02.api.letsencrypt.org/directory",
'letsencrypt_test' => "https://acme-staging-v02.api.letsencrypt.org/directory",
'buypass' => "https://api.buypass.com/acme/directory",
'buypass_test' => "https://api.test4.buypass.no/acme/directory",
'zerossl' => "https://acme.zerossl.com/v2/DV90"
];
private static $apiserver = "";
private static $acmesh = "/root/.acme.sh/acme.sh";
@@ -63,7 +71,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
$issue_domains = self::issueDomains();
$renew_froxlor = self::renewFroxlorVhost();
$renew_domains = self::renewDomains(true);
if ($issue_froxlor || !empty($issue_domains) || !empty($renew_froxlor) || $renew_domains) {
if ($issue_froxlor || ! empty($issue_domains) || ! empty($renew_froxlor) || $renew_domains) {
// insert task to generate certificates and vhost-configs
\Froxlor\System\Cronjob::inserttask(1);
}
@@ -71,7 +79,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
}
// set server according to settings
self::$apiserver = 'https://acme-' . (Settings::Get('system.letsencryptca') == 'testing' ? 'staging-' : '') . 'v0' . \Froxlor\Settings::Get('system.leapiversion') . '.api.letsencrypt.org/directory';
self::$apiserver = self::ACME_PROVIDER[Settings::Get('system.letsencryptca')];
// validate acme.sh installation
if (! self::checkInstall()) {
@@ -279,12 +287,18 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
$our_ips = Domain::getIpsOfDomain($domain_id);
foreach ($loop_domains as $idx => $domain) {
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_INFO, "Validating DNS of " . $domain);
// ips accordint to NS
// ips according to NS
$domain_ips = PhpHelper::gethostbynamel6($domain);
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
// no common ips...
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_WARNING, "Skipping Let's Encrypt generation for " . $domain . " due to no system known IP address via DNS check");
unset($domains[$idx]);
// in order to avoid a cron-loop that tries to get a certificate every 5 minutes, we disable let's encrypt for this domain
$upd_stmt = Database::prepare("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `letsencrypt` = '0' WHERE `id` = :did");
Database::pexecute($upd_stmt, [
'did' => $domain_id
]);
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_WARNING, "Let's Encrypt deactivated for domain " . $domain);
}
}
}
@@ -306,7 +320,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
if (Settings::Get('system.letsencryptreuseold') != '1') {
$acmesh_cmd .= " --always-force-new-domain-key";
}
if (Settings::Get('system.letsencryptca') == 'testing') {
if (Settings::Get('system.letsencryptca') == 'letsencrypt_test') {
$acmesh_cmd .= " --staging";
}
if ($force) {
@@ -497,8 +511,8 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
private static function checkFsFilesAreNewer($domain, $cert_date = 0)
{
$certificate_folder = self::getWorkingDirFromEnv($domain);
$ssl_file = \Froxlor\FileDir::makeCorrectFile($certificate_folder . '/' . $domain . '.cer');
$certificate_folder = self::getWorkingDirFromEnv(strtolower($domain));
$ssl_file = \Froxlor\FileDir::makeCorrectFile($certificate_folder . '/' . strtolower($domain) . '.cer');
if (is_dir($certificate_folder) && file_exists($ssl_file) && is_readable($ssl_file)) {
$cert_data = openssl_x509_parse(file_get_contents($ssl_file));
@@ -517,7 +531,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
$env_file = FileDir::makeCorrectFile(dirname(self::$acmesh) . '/acme.sh.env');
if (file_exists($env_file)) {
$output = [];
$cut = <<<EOC
$cut = <<<EOC
cut -d'"' -f2
EOC;
exec('grep "LE_WORKING_DIR" ' . escapeshellarg($env_file) . ' | ' . $cut, $output);

View File

@@ -364,7 +364,7 @@ class Lighttpd extends HttpConfigBase
return;
}
protected function composePhpOptions($domain)
protected function composePhpOptions(&$domain)
{
return;
}
@@ -678,7 +678,7 @@ class Lighttpd extends HttpConfigBase
// After inserting the AWStats information,
// be sure to build the awstats conf file as well
// and chown it using $awstats_params, #258
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
}
}

View File

@@ -22,7 +22,7 @@ use Froxlor\Cron\Http\Php\PhpInterface;
class LighttpdFcgi extends Lighttpd
{
protected function composePhpOptions($domain)
protected function composePhpOptions(&$domain)
{
$php_options_text = '';
@@ -32,10 +32,11 @@ class LighttpdFcgi extends Lighttpd
// vhost data for php-fpm
if ((int) Settings::Get('phpfpm.enabled') == 1) {
$domain['fpm_socket'] = $php->getInterface()->getSocketFile();
$php_options_text = ' fastcgi.server = ( ' . "\n";
$php_options_text .= "\t" . '".php" => (' . "\n";
$php_options_text .= "\t\t" . '"localhost" => (' . "\n";
$php_options_text .= "\t\t" . '"socket" => "' . $php->getInterface()->getSocketFile() . '",' . "\n";
$php_options_text .= "\t\t" . '"socket" => "' . $domain['fpm_socket'] . '",' . "\n";
$php_options_text .= "\t\t" . '"check-local" => "enable",' . "\n";
$php_options_text .= "\t\t" . '"disable-time" => 1' . "\n";
$php_options_text .= "\t" . ')' . "\n";

View File

@@ -970,7 +970,7 @@ class Nginx extends HttpConfigBase
return $returnval;
}
protected function composePhpOptions($domain, $ssl_vhost = false)
protected function composePhpOptions(&$domain, $ssl_vhost = false)
{
$phpopts = '';
if ($domain['phpenabled_customer'] == 1 && $domain['phpenabled_vhost'] == '1') {
@@ -1153,7 +1153,7 @@ class Nginx extends HttpConfigBase
// After inserting the AWStats information,
// be sure to build the awstats conf file as well
// and chown it using $awstats_params, #258
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
}
}

View File

@@ -22,7 +22,7 @@ use Froxlor\Cron\Http\Php\PhpInterface;
class NginxFcgi extends Nginx
{
protected function composePhpOptions($domain, $ssl_vhost = false)
protected function composePhpOptions(&$domain, $ssl_vhost = false)
{
$php_options_text = '';
@@ -43,7 +43,8 @@ class NginxFcgi extends Nginx
if ($domain['ssl'] == '1' && $ssl_vhost) {
$php_options_text .= "\t\t" . 'fastcgi_param HTTPS on;' . "\n";
}
$php_options_text .= "\t\t" . 'fastcgi_pass unix:' . $php->getInterface()->getSocketFile() . ";\n";
$domain['fpm_socket'] = $php->getInterface()->getSocketFile();
$php_options_text .= "\t\t" . 'fastcgi_pass unix:' . $domain['fpm_socket'] . ";\n";
$php_options_text .= "\t\t" . 'fastcgi_index index.php;' . "\n";
$php_options_text .= "\t}\n\n";

View File

@@ -94,7 +94,7 @@ class Fcgid
// Set Binary
$starter_file .= "exec " . $phpconfig['binary'] . " -c " . escapeshellarg($this->getConfigDir()) . "\n";
// remove +i attibute, so starter can be overwritten
// remove +i attribute, so starter can be overwritten
if (file_exists($this->getStarterFile())) {
\Froxlor\FileDir::removeImmutable($this->getStarterFile());
}

View File

@@ -218,7 +218,7 @@ class Fpm
$openbasedir .= $_phpappendopenbasedir;
}
}
$fpm_config .= 'php_admin_value[session.save_path] = ' . \Froxlor\FileDir::makeCorrectDir(Settings::Get('phpfpm.tmpdir') . '/' . $this->domain['loginname'] . '/') . "\n";
$fpm_config .= 'php_admin_value[upload_tmp_dir] = ' . \Froxlor\FileDir::makeCorrectDir(Settings::Get('phpfpm.tmpdir') . '/' . $this->domain['loginname'] . '/') . "\n";
$admin = $this->getAdminData($this->domain['adminid']);
@@ -261,6 +261,11 @@ class Fpm
$fpm_config .= 'php_admin_value[sendmail_path] = /usr/sbin/sendmail -t -i -f ' . $this->domain['email'] . "\n";
}
// check for session.save_path, whether it has been specified by the user, if not, set a default
if (strpos($fpm_config, 'php_value[session.save_path]') === false && strpos($fpm_config, 'php_admin_value[session.save_path]') === false) {
$fpm_config .= 'php_admin_value[session.save_path] = ' . $this->getTempDir() . "\n";
}
// append custom phpfpm configuration
if (! empty($fpm_custom_config)) {
$fpm_config .= "\n; Custom Configuration\n";

View File

@@ -2,6 +2,7 @@
namespace Froxlor\Cron\System;
use Froxlor\Database\Database;
use Froxlor\Settings;
/**
* This file is part of the Froxlor project.
@@ -24,13 +25,14 @@ class Extrausers
{
// passwd
$passwd = '/var/lib/extrausers/passwd';
$sql = "SELECT customerid,username,'x' as password,uid,gid,'Froxlor User' as comment,homedir,shell, login_enabled FROM ftp_users ORDER BY uid ASC";
self::generateFile($passwd, $sql, $cronlog);
$sql = "SELECT customerid,username,'x' as password,uid,gid,'Froxlor User' as comment,homedir,shell, login_enabled FROM ftp_users ORDER BY uid, LENGTH(username) ASC";
$users_list = [];
self::generateFile($passwd, $sql, $cronlog, $users_list);
// group
$group = '/var/lib/extrausers/group';
$sql = "SELECT groupname,'x' as password,gid,members FROM ftp_groups ORDER BY gid ASC";
self::generateFile($group, $sql, $cronlog);
self::generateFile($group, $sql, $cronlog, $users_list);
// shadow
$shadow = '/var/lib/extrausers/shadow';
@@ -44,7 +46,7 @@ class Extrausers
@chmod('/var/lib/extrausers/shadow', 0640);
}
private static function generateFile($file, $query, &$cronlog)
private static function generateFile($file, $query, &$cronlog, &$result_list = null)
{
$type = basename($file);
$cronlog->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, 'Creating ' . $type . ' file');
@@ -74,6 +76,9 @@ class Extrausers
$u['comment'] = 'Locked Froxlor User';
}
$line = $u['username'] . ':' . $u['password'] . ':' . $u['uid'] . ':' . $u['gid'] . ':' . $u['comment'] . ':' . $u['homedir'] . ':' . $u['shell'] . PHP_EOL;
if (is_array($result_list)) {
$result_list[] = $u['username'];
}
break;
case 'group':
$line = $u['groupname'] . ':' . $u['password'] . ':' . $u['gid'] . ':' . $u['members'] . PHP_EOL;
@@ -84,6 +89,19 @@ class Extrausers
}
$data_content .= $line;
}
// check for local group to generate
if ($type == 'group' && Settings::Get('system.froxlorusergroup') != '') {
$guid = intval(Settings::Get('system.froxlorusergroup_gid'));
if (empty($guid)) {
$guid = intval(Settings::Get('system.lastguid')) + 1;
Settings::Set('system.lastguid', $guid, true);
Settings::Set('system.froxlorusergroup_gid', $guid, true);
}
$line = Settings::Get('system.froxlorusergroup') . ':x:' . $guid . ':' . implode(',', $result_list) . PHP_EOL;
$data_content .= $line;
}
if (file_put_contents($file, $data_content) !== false) {
$cronlog->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, 'Succesfully wrote ' . $type . ' file');
} else {

View File

@@ -69,7 +69,7 @@ class TrafficCron extends \Froxlor\Cron\FroxlorCron
}
/**
* TRAFFIC AND DISKUSAGE MESSURE
* TRAFFIC AND DISKUSAGE MEASURE
*/
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_INFO, 'Traffic run started...');
$admin_traffic = array();

View File

@@ -165,7 +165,7 @@ class Database
}
/**
* returns the sql-access data as array using indeces
* returns the sql-access data as array using indices
* 'user', 'passwd' and 'host'.
* Returns false if not enabled
*

View File

@@ -16,9 +16,9 @@ use Froxlor\Settings;
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Classes
*
*
* @since 0.9.31
*
*
*/
/**
@@ -87,6 +87,8 @@ class DbManager
while (in_array($username, $allsqlusers)) {
$username = $loginname . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
}
} elseif (strtoupper(Settings::Get('customer.mysqlprefix')) == 'DBNAME') {
$username = $loginname;
} else {
$username = $loginname . Settings::Get('customer.mysqlprefix') . (intval($last_accnumber) + 1);
}

View File

@@ -90,7 +90,7 @@ class IntegrityCheck
'dbname' => Database::getDbName()
));
$charset = isset($resp['default_character_set_name']) ? $resp['default_character_set_name'] : null;
if (! empty($charset) && strtolower($charset) != 'utf8') {
if (! empty($charset) && substr(strtolower($charset), 0, 4) != 'utf8') {
$this->log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "database charset seems to be different from UTF-8, integrity-check can fix that");
if ($fix) {
// fix database

View File

@@ -53,7 +53,7 @@ class Dns
$domain = $domain_id;
}
if ($domain['isbinddomain'] != '1') {
if (!isset($domain['isbinddomain']) || $domain['isbinddomain'] != '1') {
return;
}
@@ -181,8 +181,8 @@ class Dns
// unset special spf required-entry
unset($required_entries[$entry['type']][md5("@SPF@")]);
}
if (empty($primary_ns) && $entry['type'] == 'NS') {
// use the first NS entry as primary ns
if (empty($primary_ns) && $entry['record'] == '@' && $entry['type'] == 'NS') {
// use the first NS entry pertaining to the current domain as primary ns
$primary_ns = $entry['content'];
}
// check for CNAME on @, www- or wildcard-Alias and remove A/AAAA record accordingly
@@ -190,12 +190,26 @@ class Dns
'@',
'www',
'*'
] as $crceord) {
if ($entry['type'] == 'CNAME' && $entry['record'] == '@' && (array_key_exists(md5($crceord), $required_entries['A']) || array_key_exists(md5($crceord), $required_entries['AAAA']))) {
unset($required_entries['A'][md5($crceord)]);
unset($required_entries['AAAA'][md5($crceord)]);
] as $crecord) {
if ($entry['type'] == 'CNAME' && $entry['record'] == '@' && (array_key_exists(md5($crecord), $required_entries['A']) || array_key_exists(md5($crecord), $required_entries['AAAA']))) {
unset($required_entries['A'][md5($crecord)]);
unset($required_entries['AAAA'][md5($crecord)]);
}
}
// also allow overriding of auto-generated values (imap,pop3,mail,smtp) if enabled in the settings
if (Settings::Get('system.dns_createmailentry')) {
foreach (array(
'imap',
'pop3',
'mail',
'smtp'
) as $crecord) {
if ($entry['type'] == 'CNAME' && $entry['record'] == $crecord && (array_key_exists(md5($crecord), $required_entries['A']) || array_key_exists(md5($crecord), $required_entries['AAAA']))) {
unset($required_entries['A'][md5($crecord)]);
unset($required_entries['AAAA'][md5($crecord)]);
}
}
}
$zonerecords[] = new DnsEntry($entry['record'], $entry['type'], $entry['content'], $entry['prio'], $entry['ttl']);
}
@@ -324,11 +338,28 @@ class Dns
foreach ($records as $record) {
if ($record == '@CAA@') {
$caa_entries = explode(PHP_EOL, Settings::Get('caa.caa_entry'));
if ($domain['letsencrypt'] == 1) {
$le_entry = $domain['iswildcarddomain'] == '1' ? '0 issuewild "letsencrypt.org"' : '0 issue "letsencrypt.org"';
array_push($caa_entries, $le_entry);
$caa_domain = "letsencrypt.org";
if (Settings::Get('system.letsencryptca') == 'buypass' || Settings::Get('system.letsencryptca') == 'buypass_test') {
$caa_domain = "buypass.com";
}
if ($domain['letsencrypt'] == 1) {
if (Settings::Get('system.letsencryptca') == 'zerossl') {
$caa_domains = [
"sectigo.com",
"trust-provider.com",
"usertrust.com",
"comodoca.com",
"comodo.com"
];
foreach ($caa_domains as $caa_domain) {
$le_entry = $domain['iswildcarddomain'] == '1' ? '0 issuewild "' . $caa_domain . '"' : '0 issue "' . $caa_domain . '"';
array_push($caa_entries, $le_entry);
}
} else {
$le_entry = $domain['iswildcarddomain'] == '1' ? '0 issuewild "' . $caa_domain . '"' : '0 issue "' . $caa_domain . '"';
array_push($caa_entries, $le_entry);
}
}
foreach ($caa_entries as $entry) {
if (empty($entry)) continue;
$zonerecords[] = new DnsEntry('@', 'CAA', $entry);
@@ -365,10 +396,14 @@ class Dns
}
// PowerDNS does not like multi-line-format
$soa_content = $primary_ns . " " . self::escapeSoaAdminMail(Settings::Get('panel.adminmail')) . " ";
$soa_email = Settings::Get('system.soaemail');
if ($soa_email == "") {
$soa_email = Settings::Get('panel.adminmail');
}
$soa_content = $primary_ns . " " . self::escapeSoaAdminMail($soa_email) . " ";
$soa_content .= $domain['bindserial'] . " ";
// TODO for now, dummy time-periods
$soa_content .= "3600 900 604800 " . (int) Settings::Get('system.defaultttl');
$soa_content .= "3600 900 1209600 1200";
$soa_record = new DnsEntry('@', 'SOA', $soa_content);
array_unshift($zonerecords, $soa_record);

View File

@@ -370,7 +370,7 @@ class FileDir
* @param
* integer uid The uid which must match the found directories
* @param
* integer gid The gid which must match the found direcotries
* integer gid The gid which must match the found directories
* @param
* string value the value for the input-field
*
@@ -461,7 +461,7 @@ class FileDir
* @param int $uid
* the uid which must match the found directories
* @param int $gid
* the gid which must match the found direcotries
* the gid which must match the found directories
*
* @return array Array of found valid paths
*/

View File

@@ -7,10 +7,10 @@ final class Froxlor
{
// Main version variable
const VERSION = '0.10.24';
const VERSION = '0.10.28';
// Database version (YYYYMMDDC where C is a daily counter)
const DBVERSION = '202101200';
const DBVERSION = '202108180';
// Distribution branding-tag (used for Debian etc.)
const BRANDING = '';
@@ -63,7 +63,7 @@ final class Froxlor
*
* @param string $to_check
* version to check, if empty current version is used
*
*
* @return bool true if version to check does not match, else false
*/
public static function hasUpdates($to_check = null)
@@ -84,7 +84,7 @@ final class Froxlor
*
* @param int $to_check
* version to check, if empty current dbversion is used
*
*
* @return bool true if version to check does not match, else false
*/
public static function hasDbUpdates($to_check = null)
@@ -105,7 +105,7 @@ final class Froxlor
*
* @param int $to_check
* version to check
*
*
* @return bool true if version to check matches, else false
*/
public static function isDatabaseVersion($to_check = null)
@@ -124,7 +124,7 @@ final class Froxlor
*
* @param string $new_version
* new-version
*
*
* @return bool true on success, else false
*/
public static function updateToDbVersion($new_version = null)
@@ -150,7 +150,7 @@ final class Froxlor
*
* @param string $new_version
* new-version
*
*
* @return bool true on success, else false
*/
public static function updateToVersion($new_version = null)
@@ -191,7 +191,7 @@ final class Froxlor
*
* @param string $to_check
* version to check
*
*
* @return bool true if version to check matches, else false
*/
public static function isFroxlorVersion($to_check = null)

View File

@@ -157,7 +157,7 @@ class FroxlorLogger
echo "[" . $this->getLogLevelDesc($type) . "] " . $text . PHP_EOL;
}
// warnings, errors and critical mesages WILL be logged
// warnings, errors and critical messages WILL be logged
if (Settings::Get('logger.log_cron') == '0' && $action == \Froxlor\FroxlorLogger::CRON_ACTION && $type > LOG_WARNING) {
return;
}

View File

@@ -241,10 +241,14 @@ class PhpHelper
$ips = array();
foreach ($dns as $record) {
if ($record["type"] == "A") {
$ips[] = $record["ip"];
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($record["ip"]));
$ips[] = $ip;
}
if ($record["type"] == "AAAA") {
$ips[] = $record["ipv6"];
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($record["ipv6"]));
$ips[] = $ip;
}
}
if (count($ips) < 1) {

View File

@@ -16,9 +16,9 @@ use Froxlor\Database\Database;
* @author Froxlor team <team@froxlor.org> (2018-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Classes
*
*
* @since 0.9.39
*
*
*/
/**
@@ -60,6 +60,13 @@ class SImExporter
public static function export()
{
$settings_definitions = [];
foreach (\Froxlor\PhpHelper::loadConfigArrayDir('./actions/admin/settings/')['groups'] AS $group) {
foreach ($group['fields'] AS $field) {
$settings_definitions[$field['settinggroup']][$field['varname']] = $field;
}
}
$result_stmt = Database::query("
SELECT * FROM `" . TABLE_PANEL_SETTINGS . "` ORDER BY `settingid` ASC
");
@@ -69,13 +76,26 @@ class SImExporter
if (! in_array($index, self::$no_export)) {
$_data[$index] = $row['value'];
}
if (array_key_exists($row['settinggroup'], $settings_definitions) && array_key_exists($row['varname'], $settings_definitions[$row['settinggroup']])) {
// Export image file
if ($settings_definitions[$row['settinggroup']][$row['varname']]['type'] === "image") {
if ($row['value'] === "") {
continue;
}
$_data[$index.'.image_data'] = base64_encode(file_get_contents(explode('?', $row['value'], 2)[0]));
}
}
}
// add checksum for validation
$_data['_sha'] = sha1(var_export($_data, true));
$_export = json_encode($_data, JSON_PRETTY_PRINT | JSON_UNESCAPED_SLASHES);
if (! $_export) {
throw new \Exception("Error exporting settings: " . json_last_error_msg());
}
return $_export;
}
@@ -98,7 +118,7 @@ class SImExporter
if ($_sha != sha1(var_export($_data, true))) {
throw new \Exception("SHA check of import data failed. Unable to import.");
}
// do not import version info - but we need that to possibily update settings
// do not import version info - but we need that to possibly update settings
// when there were changes in the variable-name or similar
unset($_data['panel.version']);
unset($_data['panel.db_version']);
@@ -120,6 +140,26 @@ class SImExporter
}
// store new data
foreach ($_data as $index => $value) {
$index_split = explode('.', $index, 3);
// Catch image_data and save it
if (isset($index_split[2]) && $index_split[2] === 'image_data' && !empty($_data[$index_split[0].'.'.$index_split[1]])) {
$path = \Froxlor\Froxlor::getInstallDir().'/img/';
if (!is_dir($path) && !mkdir($path, '0775')) {
throw new \Exception("img directory does not exist and cannot be created");
}
// Make sure we can write to the upload directory
if (!is_writable($path)) {
if (!chmod($path, '0775')) {
throw new \Exception("Cannot write to img directory");
}
}
file_put_contents(\Froxlor\Froxlor::getInstallDir() . '/' . explode('?', $_data[$index_split[0].'.'.$index_split[1]], 2)[0], base64_decode($value));
continue;
}
Settings::Set($index, $value);
}
// save to DB

View File

@@ -367,4 +367,67 @@ class Store
return $returnvalue;
}
public static function storeSettingImage($fieldname, $fielddata)
{
if (isset($fielddata['settinggroup'], $fielddata['varname']) && is_array($fielddata) && $fielddata['settinggroup'] !== '' && $fielddata['varname'] !== '') {
$save_to = null;
$path = \Froxlor\Froxlor::getInstallDir().'/img/';
// New file?
if (isset($_FILES[$fieldname]) && $_FILES[$fieldname]['tmp_name']) {
// Make sure upload directory exists
if (!is_dir($path) && !mkdir($path, '0775')) {
throw new \Exception("img directory does not exist and cannot be created");
}
// Make sure we can write to the upload directory
if (!is_writable($path)) {
if (!chmod($path, '0775')) {
throw new \Exception("Cannot write to img directory");
}
}
// Make sure mime-type matches an image
if (!in_array(mime_content_type($_FILES[$fieldname]['tmp_name']), ['image/jpeg','image/jpg','image/png','image/gif'])) {
throw new \Exception("Uploaded file not a valid image");
}
// Determine file extension
$spl = explode('.', $_FILES[$fieldname]['name']);
$file_extension = strtolower(array_pop($spl));
unset($spl);
// Move file
if (!move_uploaded_file($_FILES[$fieldname]['tmp_name'], $path.$fielddata['image_name'].'.'.$file_extension)) {
throw new \Exception("Unable to save image to img folder");
}
$save_to = 'img/'.$fielddata['image_name'].'.'.$file_extension.'?v='.time();
}
// Delete file?
if ($fielddata['value'] !== "" && array_key_exists($fieldname.'_delete', $_POST) && $_POST[$fieldname.'_delete']) {
@unlink(\Froxlor\Froxlor::getInstallDir() . '/' . explode('?', $fielddata['value'], 2)[0]);
$save_to = '';
}
// Nothing changed
if ($save_to === null) {
return array(
$fielddata['settinggroup'] . '.' . $fielddata['varname'] => $fielddata['value']
);
}
if (Settings::Set($fielddata['settinggroup'] . '.' . $fielddata['varname'], $save_to) === false) {
return false;
}
return array(
$fielddata['settinggroup'] . '.' . $fielddata['varname'] => $save_to
);
}
return false;
}
}

View File

@@ -59,20 +59,20 @@ class Crypt
}
/**
* Make crypted password from clear text password
* Make encrypted password from clear text password
*
* @author Michal Wojcik <m.wojcik@sonet3.pl>
* @author Michael Kaufmann <mkaufmann@nutime.de>
* @author Froxlor team <team@froxlor.org> (2010-)
*
* 0 - default crypt (depenend on system configuration)
* 0 - default crypt (depends on system configuration)
* 1 - MD5 $1$
* 2 - BLOWFISH $2y$07$
* 3 - SHA-256 $5$ (default)
* 4 - SHA-512 $6$
*
* @param string $password
* Password to be crypted
* Password to be encrypted
* @param bool $htpasswd
* optional whether to generate a SHA1 password for directory protection
*
@@ -168,7 +168,7 @@ class Crypt
$password = \Froxlor\Validate\Validate::validate($password, '/.*[0-9]+.*/', '/.*[0-9]+.*/', 'notrequiredpasswordcomplexity', array(), $json_response);
}
if (Settings::Get('panel.password_special_char_required')) {
$password = \Froxlor\Validate\Validate::validate($password, '/.*[' . preg_quote(Settings::Get('panel.password_special_char')) . ']+.*/', '/.*[' . preg_quote(Settings::Get('panel.password_special_char')) . ']+.*/', 'notrequiredpasswordcomplexity', array(), $json_response);
$password = \Froxlor\Validate\Validate::validate($password, '/.*[' . preg_quote(Settings::Get('panel.password_special_char'), '/') . ']+.*/', '/.*[' . preg_quote(Settings::Get('panel.password_special_char'), '/') . ']+.*/', 'notrequiredpasswordcomplexity', array(), $json_response);
}
}

View File

@@ -7,7 +7,7 @@ class Mailer extends \PHPMailer\PHPMailer\PHPMailer
{
/**
* class construtor
* class constructor
*
* @param string $exceptions
* whether to throw exceptions or not

View File

@@ -52,6 +52,12 @@ class Data
return $newfieldvalue;
}
public static function getFormFieldDataImage($fieldname, $fielddata, $input)
{
// We always make the system think we have new data to trigger the save function where we actually check everything
return time();
}
public static function manipulateFormFieldDataDate($fieldname, $fielddata, $newfieldvalue)
{
if (isset($fielddata['date_timestamp']) && $fielddata['date_timestamp'] === true) {

View File

@@ -89,6 +89,15 @@ class Fields
return $returnvalue;
}
public static function getFormFieldOutputImage($fieldname, $fielddata, $do_show = true)
{
global $lng;
$label = $fielddata['label'];
$value = htmlentities($fielddata['value']);
eval("\$returnvalue = \"" . \Froxlor\UI\Template::getTemplate("formfields/image", true) . "\";");
return $returnvalue;
}
public static function getFormFieldOutputDate($fieldname, $fielddata, $do_show = true)
{
if (isset($fielddata['date_timestamp']) && $fielddata['date_timestamp'] === true) {

View File

@@ -77,7 +77,7 @@ class User
}
/**
* Function which updates all counters of used ressources in panel_admins and panel_customers
* Function which updates all counters of used resources in panel_admins and panel_customers
*
* @param bool $returndebuginfo
* Set to true to get an array with debug information
@@ -237,7 +237,7 @@ class User
$admin_domains = Database::pexecute_first($admin_domains_stmt, array(
"aid" => $admin['adminid']
));
// substract the amount of domains that are std-subdomains later when we iterated through all customers and know for sure
// subtract the amount of domains that are std-subdomains later when we iterated through all customers and know for sure
$admin['domains_used_new'] = $admin_domains['number_domains'];
// set current admin
$cur_adm = $admin['adminid'];

View File

@@ -74,7 +74,7 @@ class Check
public static function checkMysqlAccessHost($fieldname, $fielddata, $newfieldvalue, $allnewfieldvalues)
{
$mysql_access_host_array = array_map('trim', explode(',', $newfieldvalue));
$mysql_access_host_array = array_unique(array_map('trim', explode(',', $newfieldvalue)));
foreach ($mysql_access_host_array as $host_entry) {
if (Validate::validate_ip2($host_entry, true, 'invalidip', true, true, true, true, false) == false && Validate::validateDomain($host_entry) == false && Validate::validateLocalHostname($host_entry) == false && $host_entry != '%') {
@@ -207,4 +207,30 @@ class Check
}
return $returnvalue;
}
public static function checkLocalGroup($fieldname, $fielddata, $newfieldvalue, $allnewfieldvalues)
{
if (empty($newfieldvalue) || $fielddata == $newfieldvalue) {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_OK
];
} elseif (function_exists('posix_getgrnam') && posix_getgrnam($newfieldvalue) == false) {
if (Validate::validateUsername($newfieldvalue, Settings::Get('panel.unix_names'), 32)) {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_OK
];
} else {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_ERROR,
'local_group_invalid'
];
}
} else {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_ERROR,
'local_group_exists'
];
}
return $returnvalue;
}
}

View File

@@ -388,7 +388,7 @@ exit "$RETVAL"
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -931,7 +931,7 @@ gmysql-password=
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -2228,7 +2228,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2642,7 +2642,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2745,7 +2745,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3707,7 +3707,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3965,7 +3965,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3990,7 +3990,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4237,7 +4237,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4295,7 +4295,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4595,7 +4595,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

File diff suppressed because it is too large Load Diff

View File

@@ -377,7 +377,7 @@ exit "$RETVAL"
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -905,7 +905,7 @@ gmysql-password=
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -2187,7 +2187,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2707,7 +2707,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM mail_users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -4167,7 +4167,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -4192,7 +4192,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4439,7 +4439,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4497,7 +4497,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4797,7 +4797,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -226,7 +226,7 @@ query = SELECT gid FROM mail_users WHERE email = '%s'
# FQDN from Froxlor
mydomain = <SERVERNAME>
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
# set myhostname to $mydomain because Froxlor already uses a FQDN
myhostname = $mydomain
mydestination = $myhostname,
@@ -1536,7 +1536,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -1754,7 +1754,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -1857,8 +1857,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
# FROM users WHERE userid = '%u'
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = SELECT username AS user FROM mail_users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -2237,7 +2236,7 @@ ControlsLog /var/log/proftpd/controls.log
DefaultRoot ~
# Reject rootlogin (just for security)
RootLogin off
# Noo need to require valid shell, because user is virtual
# No need to require valid shell, because user is virtual
RequireValidShell off
</Global>
@@ -2447,7 +2446,7 @@ aliases: files nisplus
</content>
</file>
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
<!-- clear group chache -->
<!-- clear group cache -->
<command><![CDATA[nscd --invalidate=group]]></command>
</daemon>
<!-- Logrotate -->
@@ -2457,7 +2456,7 @@ aliases: files nisplus
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -227,7 +227,7 @@ query = SELECT gid FROM mail_users WHERE email = '%s'
# FQDN from Froxlor
mydomain = <SERVERNAME>
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
# set myhostname to $mydomain because Froxlor already uses a FQDN
myhostname = $mydomain
mydestination = $myhostname,
@@ -1537,7 +1537,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -1755,7 +1755,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -1859,7 +1859,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = SELECT username AS user FROM mail_users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -2238,7 +2238,7 @@ ControlsLog /var/log/proftpd/controls.log
DefaultRoot ~
# Reject rootlogin (just for security)
RootLogin off
# Noo need to require valid shell, because user is virtual
# No need to require valid shell, because user is virtual
RequireValidShell off
</Global>
@@ -2449,7 +2449,7 @@ aliases: files nisplus
</content>
</file>
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
<!-- clear group chache -->
<!-- clear group cache -->
<command><![CDATA[nscd --invalidate=group]]></command>
</daemon>
<!-- Logrotate -->
@@ -2459,7 +2459,7 @@ aliases: files nisplus
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -74,7 +74,7 @@ Alias "/.well-known/acme-challenge" "{{settings.system.letsencryptchallengepath}
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/apache2 restart]]></command>
<command><![CDATA[service apache2 restart]]></command>
</daemon>
<!-- HTTP Lighttpd -->
<daemon name="lighttpd" title="LigHTTPd">
@@ -138,7 +138,7 @@ include_shell "/usr/share/lighttpd/include-conf-enabled.pl"
</command>
<command><![CDATA[lighty-disable-mod cgi]]></command>
<command><![CDATA[lighty-disable-mod fastcgi]]></command>
<command><![CDATA[/etc/init.d/lighttpd restart]]></command>
<command><![CDATA[service lighttpd restart]]></command>
</daemon>
<!-- HTTP Nginx -->
<daemon name="nginx" title="nginx">
@@ -354,7 +354,6 @@ exit "$RETVAL"
</visibility>
<content><![CDATA[/etc/init.d/php-fcgi restart]]></content>
</command>
<command><![CDATA[/etc/init.d/nginx restart]]></command>
</daemon>
</service>
<!--DNS -->
@@ -366,7 +365,7 @@ exit "$RETVAL"
<command><![CDATA[touch {{settings.system.bindconf_directory}}froxlor_bind.conf]]></command>
<command><![CDATA[chown bind:0 {{settings.system.bindconf_directory}}froxlor_bind.conf]]></command>
<command><![CDATA[chmod 0644 {{settings.system.bindconf_directory}}froxlor_bind.conf]]></command>
<command><![CDATA[/etc/init.d/bind9 restart]]></command>
<command><![CDATA[service bind9 restart]]></command>
</daemon>
<daemon name="powerdns" title="PowerDNS (standalone)">
<install><![CDATA[apt-get install pdns-server pdns-backend-mysql]]></install>
@@ -376,7 +375,7 @@ exit "$RETVAL"
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -908,7 +907,7 @@ gmysql-password=
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/pdns restart]]></command>
<command><![CDATA[service pdns restart]]></command>
</daemon>
<daemon name="powerdns_bind"
title="PowerDNS via bind-backend">
@@ -919,7 +918,7 @@ gmysql-password=
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1455,7 +1454,7 @@ bind-check-interval=180
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/pdns restart]]></command>
<command><![CDATA[service pdns restart]]></command>
</daemon>
</service>
<!-- SMTP services -->
@@ -1578,7 +1577,7 @@ root: root@<SERVERNAME>
</files>
<commands index="3">
<command><![CDATA[newaliases]]></command>
<command><![CDATA[/etc/init.d/postfix restart]]></command>
<command><![CDATA[service postfix restart]]></command>
</commands>
</general>
<!-- postfix with dovecot -->
@@ -2059,7 +2058,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2162,7 +2161,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3124,7 +3123,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3299,7 +3298,7 @@ plugin {
</file>
</files>
<commands index="1">
<command><![CDATA[/etc/init.d/dovecot restart]]></command>
<command><![CDATA[service dovecot restart]]></command>
</commands>
</general>
<!-- Dovecot with postfix -->
@@ -3382,7 +3381,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3407,7 +3406,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -3654,7 +3653,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -3712,7 +3711,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -3722,7 +3721,7 @@ TLSVerifyClient off
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/proftpd restart]]></command>
<command><![CDATA[service proftpd restart]]></command>
</daemon>
<!-- Pureftpd -->
<daemon name="pureftpd" title="PureFTPd">
@@ -3948,7 +3947,7 @@ UPLOADGID=
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/pure-ftpd-mysql restart]]></command>
<command><![CDATA[service pure-ftpd-mysql restart]]></command>
</daemon>
</service>
<!-- System tools/services -->
@@ -4020,7 +4019,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok
@@ -4088,7 +4087,7 @@ aliases: files
<commands index="5">
<visibility mode="equals" value="apache2">{{settings.system.webserver}}
</visibility>
<command><![CDATA[/etc/init.d/apache2 restart]]></command>
<command><![CDATA[service apache2 restart]]></command>
</commands>
<!-- instead of just restarting apache, we let the cronjob do all the
dirty work -->

View File

@@ -398,7 +398,7 @@ mail IN A <SERVERIP>
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -927,7 +927,7 @@ gmysql-password=
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1587,7 +1587,7 @@ sendmail_path = /usr/sbin/sendmail
# FQDN from Froxlor
mydomain = <SERVERNAME>
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
# set myhostname to $mydomain because Froxlor already uses a FQDN
myhostname = $mydomain
mydestination = $myhostname,
@@ -3762,7 +3762,7 @@ aliases: files
</file>
<command><![CDATA[rc-update add nscd default]]></command>
<command><![CDATA[/etc/init.d/nscd restart]]></command>
<!-- clear group chache -->
<!-- clear group cache -->
<command><![CDATA[nscd --invalidate=group]]></command>
</daemon>
<!-- Logrotate -->
@@ -3772,7 +3772,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -1,7 +1,7 @@
<?xml version="1.0" encoding="UTF-8"?>
<froxlor>
<distribution name="Debian" codename="Stretch"
version="9.x" defaulteditor="/bin/nano">
version="9.x" defaulteditor="/bin/nano" deprecated="true">
<services>
<!-- HTTP -->
<service type="http" title="{{lng.admin.configfiles.http}}">
@@ -377,7 +377,7 @@ exit "$RETVAL"
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -920,7 +920,7 @@ gmysql-password=
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -2217,7 +2217,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2631,7 +2631,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2734,7 +2734,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3696,7 +3696,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3954,7 +3954,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3979,7 +3979,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4226,7 +4226,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4284,7 +4284,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4584,7 +4584,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -388,7 +388,7 @@ exit "$RETVAL"
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -931,7 +931,7 @@ gmysql-password=
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
# add these entries to the list if any specified: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -2228,7 +2228,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2642,7 +2642,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2745,7 +2745,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3707,7 +3707,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3965,7 +3965,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3990,7 +3990,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4237,7 +4237,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4295,7 +4295,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4595,7 +4595,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -37,7 +37,7 @@ return array(
)
),
'value' => array(
'1'
\Froxlor\Settings::Get('system.createstdsubdom_default')
)
),
'store_defaultindex' => array(

View File

@@ -1,5 +1,7 @@
<?php
use Froxlor\Settings;
/**
* This file is part of the Froxlor project.
* Copyright (c) 2010 the Froxlor Team (see authors).
@@ -22,6 +24,11 @@ return array(
'title' => $lng['mysql']['database_create'],
'image' => 'icons/mysql_add.png',
'fields' => array(
'custom_suffix' => array(
'visible' => (strtoupper(Settings::Get('customer.mysqlprefix')) == 'DBNAME') ? true : false,
'label' => $lng['mysql']['databasename'],
'type' => 'text'
),
'description' => array(
'label' => $lng['mysql']['databasedescription'],
'type' => 'text'

View File

@@ -265,7 +265,7 @@ if (isset($s) && $s != "" && $nosession != 1) {
}
/**
* Language Managament
* Language Management
*/
$langs = array();
$languages = array();
@@ -279,7 +279,7 @@ while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
$langs[$row['language']][] = $row;
// check for row[iso] cause older froxlor
// versions didn't have that and it will
// lead to a lot of undfined variables
// lead to a lot of undefined variables
// before the admin can even update
if (isset($row['iso'])) {
$iso[$row['iso']] = $row['language'];
@@ -380,10 +380,23 @@ if (! array_key_exists('variants', $_themeoptions) || ! array_key_exists($themev
// check for custom header-graphic
$hl_path = 'templates/' . $theme . '/assets/img';
$header_logo = $hl_path . '/logo.png';
if (file_exists($hl_path . '/logo_custom.png')) {
// default is theme-image
$header_logo = $hl_path . '/logo.png';
$header_logo_login = $hl_path . '/logo.png';
if (Settings::Get('panel.logo_overridetheme') == 1 || Settings::Get('panel.logo_overridecustom') == 1) {
// logo settings shall overwrite theme logo and possible custom logo
$header_logo = Settings::Get('panel.logo_image_header') ?: $header_logo;
$header_logo_login = Settings::Get('panel.logo_image_login') ?: $header_logo_login;
}
if (Settings::Get('panel.logo_overridecustom') == 0 && file_exists($hl_path . '/logo_custom.png')) {
// custom theme image (logo_custom.png) is not being overwritten by logo_image_* setting
$header_logo = $hl_path . '/logo_custom.png';
$header_logo_login = $hl_path . '/logo_custom.png';
if (file_exists($hl_path . '/logo_custom_login.png')) {
$header_logo_login = $hl_path . '/logo_custom_login.png';
}
}
/**
@@ -480,6 +493,18 @@ if (array_key_exists('css', $_themeoptions['variants'][$themevariant]) && is_arr
eval("\$header = \"" . \Froxlor\UI\Template::getTemplate('header', '1') . "\";");
$current_year = date('Y', time());
$panel_imprint_url = Settings::Get('panel.imprint_url');
if (!empty($panel_imprint_url) && strtolower(substr($panel_imprint_url, 0, 4)) != 'http') {
$panel_imprint_url = 'https://'.$panel_imprint_url;
}
$panel_terms_url = Settings::Get('panel.terms_url');
if (!empty($panel_terms_url) && strtolower(substr($panel_terms_url, 0, 4)) != 'http') {
$panel_terms_url = 'https://'.$panel_terms_url;
}
$panel_privacy_url = Settings::Get('panel.privacy_url');
if (!empty($panel_privacy_url) && strtolower(substr($panel_privacy_url, 0, 4)) != 'http') {
$panel_privacy_url = 'https://'.$panel_privacy_url;
}
eval("\$footer = \"" . \Froxlor\UI\Template::getTemplate('footer', '1') . "\";");
unset($js);

2096
lng/czech.lng.php Normal file

File diff suppressed because it is too large Load Diff

View File

@@ -558,10 +558,6 @@ $lng['traffic']['sumhttp'] = 'Samenvatting HTTP-verkeer in';
$lng['traffic']['sumftp'] = 'Samenvatting FTP-verkeer in';
$lng['traffic']['summail'] = 'Samenvatting Mail-verkeer in';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Zoekmachines toestaan uw Froxlor-installatie te indexeren';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Instellingen voor logs';
@@ -591,7 +587,7 @@ $lng['panel']['reseller'] = 'wederverkoper';
$lng['panel']['admin'] = 'beheerder';
$lng['panel']['customer'] = 'klant(en)';
$lng['error']['nomessagetosend'] = 'U hebt geen bericht opgegeven.';
$lng['error']['noreceipientsgiven'] = 'U hebt geen ontvanger opgegeven';
$lng['error']['norecipientsgiven'] = 'U hebt geen ontvanger opgegeven';
$lng['admin']['emaildomain'] = 'Emaildomein';
$lng['admin']['email_only'] = 'Alleen email?';
$lng['admin']['wwwserveralias'] = 'Voeg een "www." ServerAlias toe';
@@ -599,14 +595,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Is dit een SSL-poort?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Pad naar SSL-certificaat';
$lng['panel']['send'] = 'verzenden';
$lng['admin']['subject'] = 'Onderwerp';
$lng['admin']['receipient'] = 'Ontvanger';
$lng['admin']['recipient'] = 'Ontvanger';
$lng['admin']['message'] = 'Bericht schrijven';
$lng['admin']['text'] = 'Bericht';
$lng['menu']['message'] = 'Berichten';
$lng['error']['errorsendingmail'] = 'Het versturen van het bericht naar "%s" is mislukt';
$lng['error']['cannotreaddir'] = 'De map "%s" kan niet gelezen worden';
$lng['message']['success'] = 'Bericht verzonden naar ontvangers %s';
$lng['message']['noreceipients'] = 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn';
$lng['message']['norecipients'] = 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn';
$lng['admin']['sslsettings'] = 'Instellingen voor SSL';
$lng['cronjobs']['notyetrun'] = 'Nog niet uitgevoerd';
$lng['serversettings']['default_vhostconf']['title'] = 'Standaard vhost-instellingen';

View File

@@ -332,7 +332,7 @@ $lng['serversettings']['session_timeout']['description'] = 'How long does a user
$lng['serversettings']['accountprefix']['title'] = 'Customer prefix';
$lng['serversettings']['accountprefix']['description'] = 'Which prefix should customer accounts have?';
$lng['serversettings']['mysqlprefix']['title'] = 'SQL Prefix';
$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix';
$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix</br>Use "DBNAME" as the value, a database name field is used together with the customer name as a prefix.';
$lng['serversettings']['ftpprefix']['title'] = 'FTP Prefix';
$lng['serversettings']['ftpprefix']['description'] = 'Which prefix should ftp accounts have?<br/><b>If you change this you also have to change the Quota SQL Query in your FTP Server config file in case you use it!</b> ';
$lng['serversettings']['documentroot_prefix']['title'] = 'Home directory';
@@ -626,10 +626,6 @@ $lng['traffic']['sumhttp'] = 'Total HTTP-Traffic';
$lng['traffic']['sumftp'] = 'Total FTP-Traffic';
$lng['traffic']['summail'] = 'Total Mail-Traffic';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Allow searchengine-robots to index your Froxlor installation';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Log settings';
@@ -664,7 +660,7 @@ $lng['panel']['reseller'] = 'reseller';
$lng['panel']['admin'] = 'admin';
$lng['panel']['customer'] = 'customer/s';
$lng['error']['nomessagetosend'] = 'You did not enter a message.';
$lng['error']['noreceipientsgiven'] = 'You did not specify any recipient';
$lng['error']['norecipientsgiven'] = 'You did not specify any recipient';
$lng['admin']['emaildomain'] = 'Emaildomain';
$lng['admin']['email_only'] = 'Only email?';
$lng['admin']['wwwserveralias'] = 'Add a "www." ServerAlias';
@@ -672,18 +668,18 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Is this an SSL Port?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Path to the SSL Certificate';
$lng['panel']['send'] = 'send';
$lng['admin']['subject'] = 'Subject';
$lng['admin']['receipient'] = 'Recipient';
$lng['admin']['recipient'] = 'Recipient';
$lng['admin']['message'] = 'Write a Message';
$lng['admin']['text'] = 'Message';
$lng['menu']['message'] = 'Messages';
$lng['error']['errorsendingmail'] = 'The message to "%s" failed';
$lng['error']['cannotreaddir'] = 'Unable to read directory "%s"';
$lng['message']['success'] = 'Successfully sent message to %s recipients';
$lng['message']['noreceipients'] = 'No e-mail has been sent because there are no recipients in the database';
$lng['message']['norecipients'] = 'No e-mail has been sent because there are no recipients in the database';
$lng['admin']['sslsettings'] = 'SSL settings';
$lng['cronjobs']['notyetrun'] = 'Not yet run';
$lng['serversettings']['default_vhostconf']['title'] = 'Default vHost-settings';
$lng['admin']['specialsettings_replacements'] = "You can use the following variables:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code><br/>";
$lng['admin']['specialsettings_replacements'] = "You can use the following variables:<br/><code>{DOMAIN}</code>, <code>{DOCROOT}</code>, <code>{CUSTOMER}</code>, <code>{IP}</code>, <code>{PORT}</code>, <code>{SCHEME}</code>, <code>{FPMSOCKET}</code> (if applicable)<br/>";
$lng['serversettings']['default_vhostconf']['description'] = 'The content of this field will be included into this ip/port vHost container directly. ' . $lng['admin']['specialsettings_replacements'] . ' Attention: The code won\'t be checked for any errors. If it contains errors, webserver might not start again!';
$lng['serversettings']['apache_globaldiropt']['title'] = 'Directory options for customer-prefix';
$lng['serversettings']['apache_globaldiropt']['description'] = 'The content of this field will be included into the 05_froxlor_dirfix_nofcgid.conf apache config. If empty, the default value is used:<br><br>apache >=2.4<br><code>Require all granted<br>AllowOverride All</code><br><br>apache <=2.2<br><code>Order allow,deny<br>allow from all</code>';
@@ -930,7 +926,7 @@ $lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Default vHost-settin
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentification, set this only if you know what it is.';
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentication, set this only if you know what it is.';
$lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
@@ -1600,12 +1596,14 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Allow admins to chan
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Allow customers to change the theme';
$lng['serversettings']['axfrservers']['title'] = 'AXFR servers';
$lng['serversettings']['axfrservers']['description'] = 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.';
$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode';
$lng['serversettings']['powerdns_mode']['description'] = 'Select the PoweDNS mode: Native for no replication (Default) / Master if DNS replication is needed.';
$lng['panel']['ssleditor'] = 'SSL settings for this domain';
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete certificate content in the textbox';
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentification, set this only if you know what it is.';
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentication, set this only if you know what it is.';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
@@ -1615,7 +1613,7 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regulary so avoid storing data in there manually.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
// Added in Froxlor 0.9.30
@@ -1832,15 +1830,15 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
// Added for let's encrypt
$lng['admin']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> This feature is still in beta.';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely';
$lng['panel']['letsencrypt'] = 'Using Let\'s encrypt';
$lng['crondesc']['cron_letsencrypt'] = 'updating Let\'s Encrypt certificates';
$lng['serversettings']['letsencryptca']['title'] = "Let's Encrypt environment";
$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt certificates.";
$lng['serversettings']['letsencryptca']['title'] = "ACME environment";
$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt / ZeroSSL certificates.";
$lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt country code";
$lng['serversettings']['letsencryptcountrycode']['description'] = "2 letter country code used to generate Let's Encrypt certificates.";
$lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt state";
@@ -1908,6 +1906,7 @@ $lng['error']['dns_mx_needdom'] = 'The MX content value must be a valid domain-n
$lng['error']['dns_mx_noalias'] = 'The MX-content value cannot be an CNAME entry.';
$lng['error']['dns_cname_invaliddom'] = 'Invalid domain-name for CNAME record';
$lng['error']['dns_cname_nomorerr'] = 'There already exists a resource-record with the same record-name. It can not be used as CNAME.';
$lng['error']['dns_other_nomorerr'] = 'There already exists a CNAME record with the same record-name. It can not be used for another type.';
$lng['error']['dns_ns_invaliddom'] = 'Invalid domain-name for NS record';
$lng['error']['dns_srv_prioempty'] = 'Invalid SRV priority given';
$lng['error']['dns_srv_invalidcontent'] = 'Invalid SRV content, must contain of fields weight, port and target, e.g.: 5 5060 sipserver.example.com.';
@@ -1921,7 +1920,7 @@ $lng['dnseditor']['records'] = 'records';
$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are prefered, only missing entries will be automatically generated.';
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.';
$lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
@@ -1996,7 +1995,7 @@ $lng['serversettings']['leapiversion']['title'] = "Choose Let's Encrypt ACME imp
$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protcol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protocol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
$lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
@@ -2104,3 +2103,31 @@ $lng['serversettings']['awstats']['logformat']['description'] = 'If you use cust
$lng['error']['cannotdeletesuperadmin'] = 'The first admin cannot be deleted.';
$lng['error']['no_wwwcnamae_ifwwwalias'] = 'Cannot set CNAME record for "www" as domain is set to generate a www-alias. Please change settings to either "No alias" or "Wildcard alias"';
$lng['serversettings']['hide_incompatible_settings'] = 'Hide incompatible settings';
$lng['serversettings']['soaemail'] = 'Mail address to use in SOA records (defaults to sender address from panel settings if empty)';
$lng['imprint'] = 'Legal notes';
$lng['serversettings']['imprint_url']['title'] = 'URL to legal notes / imprint';
$lng['serversettings']['imprint_url']['description'] = 'Specify an URL to your legal notes / imprint site. The link will be visible on the login screen and on the footer when logged in.';
$lng['terms'] = 'Terms of use';
$lng['serversettings']['terms_url']['title'] = 'URL to terms of use';
$lng['serversettings']['terms_url']['description'] = 'Specify an URL to your terms of use site. The link will be visible on the login screen and on the footer when logged in.';
$lng['privacy'] = 'Privacy policy';
$lng['serversettings']['privacy_url']['title'] = 'URL to privacy policy';
$lng['serversettings']['privacy_url']['description'] = 'Specify an URL to your privacy policy site / imprint site. The link will be visible on the login screen and on the footer when logged in.';
$lng['admin']['domaindefaultalias'] = 'Default ServerAlias value for new domains';
$lng['serversettings']['logo_image_header']['title'] = 'Logo Image (Header)';
$lng['serversettings']['logo_image_header']['description'] = 'Upload your own logo image to be shown in the header after login (recommended height 30px)';
$lng['serversettings']['logo_image_login']['title'] = 'Logo Image (Login)';
$lng['serversettings']['logo_image_login']['description'] = 'Upload your own logo image to be shown during login';
$lng['panel']['image_field_delete'] = 'Delete the existing current image';
$lng['serversettings']['logo_overridetheme']['title'] = 'Overwrites logo defined in theme by "Logo Image" (Header and Login, see below)';
$lng['serversettings']['logo_overridetheme']['description'] = 'This needs to be set to "true" if you intend to use your uploaded logo; alternatively you can still use the theme-based "logo_custom.png" and "logo_custom_login.png" possibility.';
$lng['serversettings']['logo_overridecustom']['title'] = 'Overwrite custom logo (logo_custom.png and logo_custom_login.png) defined in theme by "Logo Image" (Header and Login, see below)';
$lng['serversettings']['logo_overridecustom']['description'] = 'Set this to "true" if you want to ignore theme-specific custom logos for header and login and use "Logo Image"';
$lng['serversettings']['createstdsubdom_default']['title'] = 'Preselected value for "'.$lng['admin']['stdsubdomain_add'].'" when creating a customer';
$lng['serversettings']['froxlorusergroup']['title'] = 'Custom system group for all customer users';
$lng['serversettings']['froxlorusergroup']['description'] = 'Usage of libnss-extrausers (system-settings) is required for this to take effect. An empty value skips creation or removes existing group.';
$lng['error']['local_group_exists'] = 'The given group already exists on the system.';
$lng['error']['local_group_invalid'] = 'The given group name is invalid';
$lng['error']['invaliddnsforletsencrypt'] = 'The domains DNS does not include any of the chosen IP addresses. Let\'s Encrypt certificate generation not possible.';

View File

@@ -598,10 +598,6 @@ $lng['traffic']['sumhttp'] = 'Trafic HTTP total entrant';
$lng['traffic']['sumftp'] = 'Trafic FTP total entrant';
$lng['traffic']['summail'] = 'Trafic E-mail total entrant';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Permettre aux robots des moteurs de recherche d\'indexer l\'installation de Froxlor';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Paramètres des logs';
@@ -631,7 +627,7 @@ $lng['panel']['reseller'] = 'revendeur';
$lng['panel']['admin'] = 'administrateur';
$lng['panel']['customer'] = 'client(s)';
$lng['error']['nomessagetosend'] = 'Vous n\'avez pas entré de message.';
$lng['error']['noreceipientsgiven'] = 'Vous n\'avez pas spécifier de destinataire';
$lng['error']['norecipientsgiven'] = 'Vous n\'avez pas spécifier de destinataire';
$lng['admin']['emaildomain'] = 'Domaine e-mail';
$lng['admin']['email_only'] = 'Seulement des e-mails ?';
$lng['admin']['wwwserveralias'] = 'Ajouter un "www." à l\'alias du serveur "ServerAlias"';
@@ -639,14 +635,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Est-ce un port SSL ?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Emplacement du certificat SSL';
$lng['panel']['send'] = 'envoyé';
$lng['admin']['subject'] = 'Sujet';
$lng['admin']['receipient'] = 'Destinataire';
$lng['admin']['recipient'] = 'Destinataire';
$lng['admin']['message'] = 'Ecrire un message';
$lng['admin']['text'] = 'Message';
$lng['menu']['message'] = 'Messages';
$lng['error']['errorsendingmail'] = 'Echec d\'envoi du message à "%s"';
$lng['error']['cannotreaddir'] = 'Impossible de lire dossier "%s"';
$lng['message']['success'] = 'Le message a été envoyé aux destinataires "%s"';
$lng['message']['noreceipients'] = 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données';
$lng['message']['norecipients'] = 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données';
$lng['admin']['sslsettings'] = 'Paramètres SSL';
$lng['cronjobs']['notyetrun'] = 'Pas encore lancé';
$lng['serversettings']['default_vhostconf']['title'] = 'Paramètres par défaut pour les vHosts';

Some files were not shown because too many files have changed in this diff Show More