Compare commits

..

105 Commits

Author SHA1 Message Date
Michael Kaufmann
46df429909 set version to 0.10.30 for upcoming release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-11-05 09:27:58 +01:00
Michael Kaufmann
eb841da007 avoid possible DivisionByZeroError in APCu info page, fixes #995
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-11-04 07:44:03 +01:00
Michael Kaufmann
c4a2db03be enable bind for testing-scenarios explicitly
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-11-03 14:16:21 +01:00
Michael Kaufmann
e5838f00cf add quota-plugin parameters to dovecot-config-templates; update standardcustomer index.html; set nameserver disabled by default
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-11-03 14:08:57 +01:00
Michael Kaufmann
bcde7e93df check whether the domain to clean from pdns actually still exists there; fixes #992
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-21 12:00:36 +02:00
Michael Kaufmann
bd8327afbe soften/correct permissions on pdns configs; fixes #991
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-21 11:56:34 +02:00
Michael Kaufmann
b961eba382 fix api documentation for Domains.add() and Domains.update(); fixes #987
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-20 16:51:16 +02:00
Michael Kaufmann
a552ea878e avoid undefined index of 'wwwserveralias' field if issueing/renewing lets encrypt certificate for froxlor-hostname
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-17 11:48:40 +02:00
Michael Kaufmann
4ad2a1da1c add complete list of nameserver-ips and given axfr-servers to allow-axfr-ips list for PowerDNS; fixes #985
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-14 19:07:05 +02:00
Michael Kaufmann
37ae69f07a correct language strings in phpconfig formfield for new setting; refs #980
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-14 17:13:55 +02:00
Michael Kaufmann
9870db2560 add possibility to assign new/edited php-config to all customer accounts; fixes #980
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-14 17:09:29 +02:00
Michael Kaufmann
724a5e172a don't remove 0-value parameter values from bulk-actions
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-12 16:29:04 +02:00
Michael Kaufmann
8e166cb842 adjust debian 11 config templates, fixes #982
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-12 14:25:42 +02:00
Michael Kaufmann
5e281cf486 fix allowed-phpconfigs check in SubDomains.add() and SubDomains.update()
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-11 19:26:13 +02:00
Michael Kaufmann
5d2f44ecd8 only validate custom database name if used at all
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-11 18:59:26 +02:00
Michael Kaufmann
5009c625d8 prep.statement cannot be used for create database query; regex-validate database_name
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-11 18:55:15 +02:00
Michael Kaufmann
eb592340b0 use prepared statement for creating databases to avoid sql injections in custom db-names
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-11 18:33:48 +02:00
Michael Kaufmann
c6f556c8d9 set version to 0.10.29.1 for bugfix release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-10 14:45:17 +02:00
Michael Kaufmann
db1df84ef1 correct db-exists check in installation-process
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-10 14:32:02 +02:00
Michael Kaufmann
52135a1d3a set version to 0.10.29 for upcoming release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-08 08:46:58 +02:00
Michael Kaufmann
7f13bd09da add optional ssl parameters to powerdns-config-template
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-08 08:39:22 +02:00
Nick Ufer
7ccbb37c4e feat: adds mysql tls support (#979) 2021-10-08 08:28:32 +02:00
Michael Kaufmann
7feddf0aec generate unpredictable unique session ids
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-10-02 12:38:17 +02:00
Michael Kaufmann
e73523531a let user decide whether an existing database should be backup'ed and removed when installing froxlor; dont rely on parse_ini_file for OS check; enhance mysqldump so there is no issues with complex passwords and bash-escaping
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-09-24 10:49:57 +02:00
Michael Kaufmann
a47b790e19 actually integrate the new czech language file; refs #976
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-09-04 09:30:44 +02:00
Michael Kaufmann
319eec6124 fix session for 2fa enabled logins
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-27 13:17:05 +02:00
Michael Kaufmann
21983f27b6 secure commonly used filename-variable against url manipulation
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-25 16:36:09 +02:00
Michael Kaufmann
5d375b784d login action always goes to index.php
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-25 16:30:56 +02:00
Michael Kaufmann
4b22470872 set php session security related settings (correctly in every case)
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-25 16:21:33 +02:00
Michael Kaufmann
ec1c37aa06 set version to 0.10.28 for upcoming release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-20 09:23:23 +02:00
Nicolas
67351ec3c2 Adding support for PowerDNS-Replication (#974)
Adding support for powerdns-replication
2021-08-19 12:00:09 +02:00
Michael Kaufmann
f1887aaaf2 enable iterate_query in dovecot by default
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-13 09:28:10 +02:00
Michael Kaufmann
afd2d7b5e9 fix dns-validation in Domains.add() and Domains.update() when using Let's Encrypt DNS-check
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-08 11:14:57 +02:00
Michael Kaufmann
c967e585b5 avoid duplicate entries in mysql-access-host setting
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-06 08:11:06 +02:00
Michael Kaufmann
73e364d4ba fix compare of old/new value of aliasdomain when editing a domain as customer to avoid unnecessary regeneration of configfiles
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-04 14:55:22 +02:00
Michael Kaufmann
eb49331b21 remove superfluous inserttask when editing domain as it will be called when there are actually changes to the domain earlier
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-04 14:06:32 +02:00
Michael Kaufmann
0a1a3e023f check dns for lets encrypt when adding/editing domains and via cron; fixes #971
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-04 13:44:13 +02:00
Michael Kaufmann
bef5cedcd0 only add link to customername when editing domain when panel.allow_domain_change_customer is false
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-08-02 16:58:34 +02:00
Stefan Weil
f8e2bc7bff Fix some typos in code (found by codespell) (#970)
Signed-off-by: Stefan Weil <sw@weilnetz.de>
2021-08-01 19:00:33 +02:00
Stefan Weil
09038ac7aa Fix some typos (found by codespell) (#969)
Signed-off-by: Stefan Weil <sw@weilnetz.de>
2021-07-31 09:51:54 +02:00
Michael Kaufmann
4c507232c7 add setting for a custom system group for all customer-users (required libnss-extrausers); fixes #953
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-30 12:16:37 +02:00
Michael Kaufmann
86939a64da add buypass testing/staging ACME endpoint; create CAA entries accordingly if activated; refs #968
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-29 21:24:43 +02:00
Jens Meißner
926ce427fc Add Buypass to the list of ACME providers. (#968) 2021-07-29 21:15:49 +02:00
Michael Kaufmann
53401eebfb integrity check should allow utf8_* charachter sets and not only 'utf8', thx to lod
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-29 21:04:46 +02:00
Michael Kaufmann
bef580929e Update README.md 2021-07-27 08:14:08 +02:00
Michael Kaufmann
c7b7c67ff4 normalize ipv6 addresses to avoid possible comparison problems; fixes #965
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-26 17:53:44 +02:00
Michael Kaufmann
ed42d4e3df try to fix github action...
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-24 20:31:34 +02:00
Michael Kaufmann
69a2ebce36 create user as froxlor would create it for mysql-8.0
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-24 20:29:56 +02:00
Michael Kaufmann
15f08739fa add github action workflow for mysql
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-24 20:17:42 +02:00
nachtgeist
571690c8c5 admin_customers/edit domain: make customer login name a link (#962) 2021-07-23 16:35:31 +02:00
rex2630
b2005d7f29 [WIP] Czech language (#870)
* Update czech.lng.php
2021-07-21 20:41:07 +02:00
Michael Kaufmann
4354598c64 fix unittests
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 10:21:58 +02:00
Michael Kaufmann
05d4bdc499 restore behaviour for unittests as 'create stdsubdomain' default was yes in the settings but no for direct API usage
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 10:10:18 +02:00
Michael Kaufmann
25c6a37df2 fix wrong variable-name in Customers.delete()
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 10:03:20 +02:00
Michael Kaufmann
41a470fe36 added option to disable creation of default subdomain; fixes #960
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-21 09:53:54 +02:00
Michael Kaufmann
8a4aa2a721 fix lng strings
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-20 23:45:57 +02:00
Michael Kaufmann
1d903770fc have more power over theme logo, custom theme logo and uploaded logo; refs #958
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-20 20:35:54 +02:00
Nicolas
934be5a238 Fix SOA-Record (#959) 2021-07-20 19:29:06 +02:00
Michael Kaufmann
5608f0407f correct heredoc indentation in AcmeSh for php-7.1; fixes #957
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-20 08:11:32 +02:00
Kai
ce9d8dad7f Feature-request #672 - database name prefixes + custom name (#956)
* Fix makeoption function call

* Update formfield.mysql_add.php

Added database name

* Update formfield.mysql_add.php

* Update formfield.mysql_add.php

* Update Mysqls.php

* Update DbManager.php

* Update formfield.mysql_add.php

* Update german.lng.php

* Update formfield.mysql_add.php

* Update Mysqls.php

* Added field database_name (Feature #672)

* Added Testfunction for customer choosed database name

* Fixed test for customer choosed database name
Added docs for param $name

* Fixed mysql api command add
Removed doubled code

* Set settings for customer choosed db name

* Fixed wrong excepted for database name

* Renamed parameter database_name to custom_suffix

* Changed testCustomerMysqlsList
Added testCustomerMysqlsDBNameDelete
2021-07-19 19:10:12 +02:00
Michael Kaufmann
d6fe263e68 Update issue templates 2021-07-19 07:20:46 +02:00
Michael Kaufmann
156846a845 set version to 0.10.27 for upcoming release
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-18 10:57:38 +02:00
Michael Kaufmann
abe00b79a7 Update README.md
add github actions build badge
2021-07-17 14:16:29 +02:00
Michael Kaufmann
26ab659c6a Ga testing (#955)
* switch from travis-ci to github actions

Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-17 14:14:35 +02:00
Michael Kaufmann
b0273c68d2 remove debian jessie config-templates (outdated); set debian stretch as deprecated; add debian bullseye config templates
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-16 12:15:03 +02:00
Michael Kaufmann
720cf9d74f Merge branch 'master' of github.com:Froxlor/Froxlor 2021-07-13 09:01:25 +02:00
Michael Kaufmann
35cd567c48 check whether there was an image upload at all
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-13 09:01:22 +02:00
Michael Kaufmann
2332d5be7b Merge pull request #949 from bashgeek/custom-css
Custom CSS File in default theme
2021-07-13 08:38:23 +02:00
Daniel
14cdc3801a Merge branch 'Froxlor-master' into custom-css 2021-07-13 10:31:35 +08:00
Daniel
d85efe480e conflict 2021-07-13 10:31:24 +08:00
Daniel
4f2ceaa3ab wip 2021-07-13 10:29:36 +08:00
Michael Kaufmann
3b6792d548 Merge branch 'master' of github.com:Froxlor/Froxlor 2021-07-12 17:29:25 +02:00
Michael Kaufmann
36de6e09d4 remove beta notice from let's encrypt settings
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-12 17:29:21 +02:00
Michael Kaufmann
300c410b18 Merge pull request #948 from bashgeek/logo-custom-login
Custom Logo(s) via Image-Upload in Panel Settings
2021-07-12 17:28:42 +02:00
Daniel Schmitz
282d7d9101 migrate old image + fix versioning 2021-07-09 17:07:50 +08:00
Daniel Schmitz
48f6601003 check mime types 2021-07-09 16:42:21 +08:00
Daniel
c4c4279171 Merge branch 'Froxlor:master' into logo-custom-login 2021-07-09 16:32:59 +08:00
Michael Kaufmann
b88f9c1f18 allow defining php_value/php_admin_value for session.save_path when using php-fpm; fixes #954
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-07-09 08:23:46 +02:00
Daniel Schmitz
0dac045dc9 wip 2021-07-07 14:11:54 +08:00
Daniel Schmitz
80b5f97367 wip 2021-07-07 14:10:21 +08:00
Daniel Schmitz
7a8b39fad0 wip 2021-07-07 14:00:55 +08:00
Daniel Schmitz
9f5978e875 german translations 2021-07-07 13:33:33 +08:00
Daniel
155fd757bf Merge branch 'Froxlor:master' into logo-custom-login 2021-07-07 13:30:22 +08:00
Daniel Schmitz
518ec202ab wip 2021-07-07 13:26:15 +08:00
Michael Kaufmann
871083d613 Merge pull request #952 from bashgeek/install-warnings
Installer Cleanup & Bug Fixes
2021-06-28 08:06:59 +02:00
Daniel Schmitz
79f0c8d28f wip 2021-06-28 11:01:22 +08:00
Daniel
dfbb4127e2 Merge branch 'Froxlor:master' into logo-custom-login 2021-06-28 10:39:02 +08:00
Daniel Schmitz
b9b2f00f30 wip 2021-06-28 10:37:23 +08:00
Daniel Schmitz
6923f9d926 Revert "wip"
This reverts commit cacbf7fec7.
2021-06-28 10:35:15 +08:00
Daniel Schmitz
cacbf7fec7 wip 2021-06-28 10:34:21 +08:00
Michael Kaufmann
73991e855c Support ZeroSSL via acme.sh (v3); refs #946
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-27 09:00:44 +02:00
Michael Kaufmann
0208812013 prefer custom zone entries over automatically created ones when system.dns_createmailentry is enabled, fixes #944
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-27 08:41:16 +02:00
Michael Kaufmann
48bd2561f7 Merge pull request #947 from Froxlor/dependabot/composer/phpmailer/phpmailer-6.5.0
Bump phpmailer/phpmailer from 6.4.1 to 6.5.0
2021-06-27 08:37:38 +02:00
Michael Kaufmann
af12c4102b Merge pull request #950 from kruegerj/patch-1
Update focal.xml
2021-06-24 07:57:00 +02:00
kruegerj
d2efa3ecc4 Update focal.xml 2021-06-24 03:16:12 +02:00
Daniel Schmitz
acb04566f5 wip 2021-06-23 11:28:07 +08:00
Daniel Schmitz
abb98ae960 wip 2021-06-23 11:21:33 +08:00
Daniel Schmitz
0d202a7e4d wip 2021-06-23 11:20:18 +08:00
Daniel Schmitz
c69ef20b17 wip 2021-06-23 10:58:52 +08:00
dependabot[bot]
5872d0682a Bump phpmailer/phpmailer from 6.4.1 to 6.5.0
Bumps [phpmailer/phpmailer](https://github.com/PHPMailer/PHPMailer) from 6.4.1 to 6.5.0.
- [Release notes](https://github.com/PHPMailer/PHPMailer/releases)
- [Changelog](https://github.com/PHPMailer/PHPMailer/blob/master/changelog.md)
- [Commits](https://github.com/PHPMailer/PHPMailer/compare/v6.4.1...v6.5.0)

---
updated-dependencies:
- dependency-name: phpmailer/phpmailer
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>
2021-06-22 15:20:44 +00:00
Michael Kaufmann
c4fa8feb8c update dev tools
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-17 08:25:43 +02:00
Michael Kaufmann
61a50cc657 add setting for default serveralias value for new domains, refs #944
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-16 15:10:52 +02:00
Michael Kaufmann
3df3261ac0 switch from freenode irc network to libera.chat irc network as freenode is dead
Signed-off-by: Michael Kaufmann <d00p@froxlor.org>
2021-06-16 11:57:38 +02:00
Michael Kaufmann
f2636e14f0 Merge pull request #945 from MisterDuval/patch-1
Deny all robots
2021-06-01 15:06:31 +02:00
MisterDuval
a23f22f561 Deny all robots
Search engine and all Robots should be denied to the whole Froxlor directory. This file will help!
2021-06-01 14:45:47 +02:00
125 changed files with 5196 additions and 1819 deletions

View File

@@ -1,6 +1,6 @@
# Bug report vs. support request
If you're unsure of whether your problem is a bug or a configuration error
* contact us via IRC in #froxlor on freenode
* contact us via IRC in #froxlor on irc.libera.chat
* or post a thread in our forum at https://forum.froxlor.org
As a rule of thumb: before reporting an issue

40
.github/ISSUE_TEMPLATE/bug_report.md vendored Normal file
View File

@@ -0,0 +1,40 @@
---
name: Bug report
about: Create a report to help us improve
title: ''
labels: ''
assignees: ''
---
**As a rule of thumb: before reporting an issue**
* see if it hasn't been [reported](https://github.com/Froxlor/froxlor/issues) (and possibly already been [fixed](https://github.com/Froxlor/froxlor/issues?utf8=✓&q=is:issue%20is:closed)) first
* try with the git master
**Describe the bug**
A clear and concise description of what the bug is.
**System information**
* Froxlor version: $version/$gitSHA1
* Web server: apache2/nginx/lighttpd
* DNS server: Bind/PowerDNS (standalone)/PowerDNS (Bind-backend)
* POP/IMAP server: Courier/Dovecot
* SMTP server: postfix/exim
* FTP server: proftpd/pureftpd
* OS/Version: ...
**To Reproduce**
Steps to reproduce the behavior:
1. Go to '...'
2. Click on '....'
3. Scroll down to '....'
4. See error
**Expected behavior**
A clear and concise description of what you expected to happen.
**Logfiles**
If applicable, add log-entries to help explain your problem.
**Additional context**
Add any other context about the problem here.

View File

@@ -0,0 +1,20 @@
---
name: Feature request
about: Suggest an idea for this project
title: ''
labels: ''
assignees: ''
---
**Is your feature request related to a problem? Please describe.**
A clear and concise description of what the problem is. Ex. I'm always frustrated when [...]
**Describe the solution you'd like**
A clear and concise description of what you want to happen.
**Describe alternatives you've considered**
A clear and concise description of any alternative solutions or features you've considered.
**Additional context**
Add any other context or screenshots about the feature request here.

80
.github/workflows/build-mariadb.yml vendored Normal file
View File

@@ -0,0 +1,80 @@
name: Froxlor-CI-MariaDB
on: ['push', 'pull_request', 'create']
jobs:
froxlor:
name: Froxlor (PHP ${{ matrix.php-versions }}, MariaDB ${{ matrix.mariadb-version }})
runs-on: ubuntu-latest
strategy:
fail-fast: false
matrix:
php-versions: ['7.4', '8.0']
mariadb-version: [10.5, 10.4]
steps:
- name: Checkout
uses: actions/checkout@v2
- name: Setup PHP, with composer and extensions
uses: shivammathur/setup-php@v2
with:
php-version: ${{ matrix.php-versions }}
tools: composer:v2
extensions: mbstring, xml, ctype, pdo_mysql, mysql, curl, json, zip, session, filter, posix, openssl, fileinfo, bcmath
- name: Install tools
run: sudo apt-get install -y ant
- name: Adjust firewall
run: |
sudo ufw allow out 3306/tcp
sudo ufw allow in 3306/tcp
- name: Setup MariaDB
uses: getong/mariadb-action@v1.1
with:
mariadb version: ${{ matrix.mariadb-version }}
mysql database: 'froxlor010'
mysql root password: 'fr0xl0r.TravisCI'
- name: Wait for database
run: sleep 15
- name: Setup databases
run: |
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "CREATE USER 'froxlor010'@'%' IDENTIFIED BY 'fr0xl0r.TravisCI';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "GRANT ALL ON froxlor010.* TO 'froxlor010'@'%';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI froxlor010 < install/froxlor.sql
- name: Run testing
run: ant quick-build
# - name: irc push
# uses: rectalogic/notify-irc@v1
# if: github.event_name == 'push'
# with:
# channel: "#froxlor"
# server: "irc.libera.chat"
# nickname: froxlor-ci
# message: |
# ${{ github.actor }} pushed ${{ github.event.ref }} ${{ github.event.compare }}
# ${{ join(github.event.commits.*.message) }}
# - name: irc pull request
# uses: rectalogic/notify-irc@v1
# if: github.event_name == 'pull_request'
# with:
# channel: "#froxlor"
# server: "irc.libera.chat"
# nickname: froxlor-ci
# message: |
# ${{ github.actor }} opened PR ${{ github.event.pull_request.html_url }}
# - name: irc tag created
# uses: rectalogic/notify-irc@v1
# if: github.event_name == 'create' && github.event.ref_type == 'tag'
# with:
# channel: "#froxlor"
# server: "irc.libera.chat"
# nickname: froxlor-ci
# message: |
# ${{ github.actor }} tagged ${{ github.repository }} ${{ github.event.ref }}

57
.github/workflows/build-mysql.yml vendored Normal file
View File

@@ -0,0 +1,57 @@
name: Froxlor-CI-MySQL
on: ['push', 'pull_request', 'create']
jobs:
froxlor:
name: Froxlor (PHP ${{ matrix.php-versions }}, MySQL ${{ matrix.mysql-version }})
runs-on: ubuntu-latest
strategy:
fail-fast: false
matrix:
php-versions: ['7.4', '8.0']
mysql-version: [8.0, 5.7]
steps:
- name: Checkout
uses: actions/checkout@v2
- name: Setup PHP, with composer and extensions
uses: shivammathur/setup-php@v2
with:
php-version: ${{ matrix.php-versions }}
tools: composer:v2
extensions: mbstring, xml, ctype, pdo_mysql, mysql, curl, json, zip, session, filter, posix, openssl, fileinfo, bcmath
- name: Install tools
run: sudo apt-get install -y ant
- name: Adjust firewall
run: |
sudo ufw allow out 3306/tcp
sudo ufw allow in 3306/tcp
- name: Setup MySQL
uses: samin/mysql-action@v1.3
with:
mysql version: ${{ matrix.mysql-version }}
mysql database: 'froxlor010'
mysql root password: 'fr0xl0r.TravisCI'
- name: Wait for database
run: sleep 15
- name: Setup database (8.0)
if: matrix.mysql-version == '8.0'
run: |
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "CREATE USER 'froxlor010'@'%' IDENTIFIED WITH mysql_native_password BY 'fr0xl0r.TravisCI';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "GRANT ALL ON froxlor010.* TO 'froxlor010'@'%';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI froxlor010 < install/froxlor.sql
- name: Setup database (5.7)
if: matrix.mysql-version == '5.7'
run: |
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "CREATE USER 'froxlor010'@'%' IDENTIFIED BY 'fr0xl0r.TravisCI';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI -e "GRANT ALL ON froxlor010.* TO 'froxlor010'@'%';"
mysql -h 127.0.0.1 --protocol=TCP -u root -pfr0xl0r.TravisCI froxlor010 < install/froxlor.sql
- name: Run testing
run: ant quick-build

3
.gitignore vendored
View File

@@ -12,9 +12,10 @@ logs/*
.well-known
.idea
*.iml
img/
!templates/Froxlor/
!templates/Sparkle/
!templates/misc/
templates/Froxlor/assets/img/logo_custom.png
templates/Sparkle/assets/css/custom.css
vendor/

View File

@@ -55,7 +55,7 @@ script:
- ant phpunit-no-coverage
notifications:
irc: "chat.freenode.net#froxlor"
irc: "irc.libera.chat#froxlor"
webhooks:
urls:
- https://webhooks.gitter.im/e/bdf91d1c3f745e51f796

View File

@@ -1,4 +1,5 @@
[![Build Status](https://travis-ci.com/Froxlor/Froxlor.svg?branch=master)](https://travis-ci.com/Froxlor/Froxlor)
[![Froxlor-CI](https://github.com/Froxlor/Froxlor/actions/workflows/build-mariadb.yml/badge.svg?branch=master)](https://github.com/Froxlor/Froxlor/actions/workflows/build-mariadb.yml)
[![Froxlor-CI](https://github.com/Froxlor/Froxlor/actions/workflows/build-mysql.yml/badge.svg?branch=master)](https://github.com/Froxlor/Froxlor/actions/workflows/build-mysql.yml)
[![Gitter](https://badges.gitter.im/Froxlor/community.svg)](https://gitter.im/Froxlor/community?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge)
# Froxlor
@@ -28,8 +29,8 @@ You may find help in the following places:
### IRC
froxlor may be found on freenode.net, channel #froxlor:
irc://chat.freenode.net/froxlor
froxlor may be found on libera.chat, channel #froxlor:
irc://irc.libera.chat/froxlor
### Forum

View File

@@ -77,14 +77,6 @@ return array(
'default' => false,
'save_method' => 'storeSettingField'
),
'panel_no_robots' => array(
'label' => $lng['serversettings']['no_robots'],
'settinggroup' => 'panel',
'varname' => 'no_robots',
'type' => 'bool',
'default' => true,
'save_method' => 'storeSettingField'
),
'panel_paging' => array(
'label' => $lng['serversettings']['paging'],
'settinggroup' => 'panel',
@@ -296,6 +288,40 @@ return array(
'default' => '',
'save_method' => 'storeSettingField'
),
'panel_logo_overridetheme' => array(
'label' => $lng['serversettings']['logo_overridetheme'],
'settinggroup' => 'panel',
'varname' => 'logo_overridetheme',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField'
),
'panel_logo_overridecustom' => array(
'label' => $lng['serversettings']['logo_overridecustom'],
'settinggroup' => 'panel',
'varname' => 'logo_overridecustom',
'type' => 'bool',
'default' => false,
'save_method' => 'storeSettingField'
),
'panel_logo_image_header' => array(
'label' => $lng['serversettings']['logo_image_header'],
'settinggroup' => 'panel',
'varname' => 'logo_image_header',
'type' => 'image',
'image_name' => 'logo_header',
'default' => '',
'save_method' => 'storeSettingImage'
),
'panel_logo_image_login' => array(
'label' => $lng['serversettings']['logo_image_login'],
'settinggroup' => 'panel',
'varname' => 'logo_image_login',
'type' => 'image',
'image_name' => 'logo_login',
'default' => '',
'save_method' => 'storeSettingImage'
),
)
)
)

View File

@@ -205,9 +205,21 @@ return array(
'default' => false,
'cronmodule' => 'froxlor/backup',
'save_method' => 'storeSettingField'
)
),
'system_createstdsubdom_default' => array(
'label' => $lng['serversettings']['createstdsubdom_default'],
'settinggroup' => 'system',
'varname' => 'createstdsubdom_default',
'type' => 'option',
'default' => '1',
'option_mode' => 'one',
'option_options' => array(
'0' => $lng['panel']['no'],
'1' => $lng['panel']['yes']
),
'save_method' => 'storeSettingField'
),
)
)
)
);

View File

@@ -270,6 +270,20 @@ return array(
'default' => true,
'save_method' => 'storeSettingField'
),
'system_domaindefaultalias' => array(
'label' => $lng['admin']['domaindefaultalias'],
'settinggroup' => 'system',
'varname' => 'domaindefaultalias',
'type' => 'option',
'default' => '0',
'option_mode' => 'one',
'option_options' => array(
'0' => $lng['domains']['serveraliasoption_wildcard'],
'1' => $lng['domains']['serveraliasoption_www'],
'2' => $lng['domains']['serveraliasoption_none']
),
'save_method' => 'storeSettingField'
),
'hide_incompatible_settings' => array(
'label' => $lng['serversettings']['hide_incompatible_settings'],
'settinggroup' => 'system',

View File

@@ -142,6 +142,9 @@ return array(
'default' => '/etc/apache2/conf-enabled/acme.conf',
'save_method' => 'storeSettingField'
),
/**
* currently the only option anyway
*
'system_leapiversion' => array(
'label' => $lng['serversettings']['leapiversion'],
'settinggroup' => 'system',
@@ -154,16 +157,20 @@ return array(
),
'save_method' => 'storeSettingField'
),
*/
'system_letsencryptca' => array(
'label' => $lng['serversettings']['letsencryptca'],
'settinggroup' => 'system',
'varname' => 'letsencryptca',
'type' => 'option',
'default' => 'production',
'default' => 'letsencrypt',
'option_mode' => 'one',
'option_options' => array(
'testing' => 'https://acme-staging-v0' . \Froxlor\Settings::Get('system.leapiversion') . '.api.letsencrypt.org (Test)',
'production' => 'https://acme-v0' . \Froxlor\Settings::Get('system.leapiversion') . '.api.letsencrypt.org (Live)'
'letsencrypt_test' => 'Let\'s Encrypt (Test / Staging)',
'letsencrypt' => 'Let\'s Encrypt (Live)',
'buypass_test' => 'Buypass (Test / Staging)',
'buypass' => 'Buypass (Live)',
'zerossl' => 'ZeroSSL (Live)'
),
'save_method' => 'storeSettingField'
),

View File

@@ -99,6 +99,19 @@ return array(
'default' => '',
'save_method' => 'storeSettingField'
),
'system_powerdns_mode' => array(
'label' => $lng['serversettings']['powerdns_mode'],
'settinggroup' => 'system',
'varname' => 'powerdns_mode',
'type' => 'option',
'default' => 'Native',
'option_mode' => 'one',
'option_options' => array(
'Native' => 'Native',
'Master' => 'Master'
),
'save_method' => 'storeSettingField'
),
'system_dns_createmailentry' => array(
'label' => $lng['serversettings']['mail_also_with_mxservers'],
'settinggroup' => 'system',

View File

@@ -82,7 +82,20 @@ return array(
'string_emptyallowed' => true,
'default' => '',
'save_method' => 'storeSettingField'
)
),
'system_froxlorusergroup' => array(
'label' => $lng['serversettings']['froxlorusergroup'],
'settinggroup' => 'system',
'varname' => 'froxlorusergroup',
'type' => 'string',
'default' => '',
'save_method' => 'storeSettingField',
'plausibility_check_method' => array(
'\\Froxlor\\Validate\\Check',
'checkLocalGroup'
),
'visible' => \Froxlor\Settings::Get('system.nssextrausers')
),
)
)
)

View File

@@ -129,7 +129,7 @@ if ($page == 'admins' && $userinfo['change_serversettings'] == '1') {
'userid' => $userinfo['userid']
));
$s = md5(uniqid(microtime(), 1));
$s = \Froxlor\Froxlor::genSessionId();
$ins_stmt = Database::prepare("
INSERT INTO `" . TABLE_PANEL_SESSIONS . "` SET
`hash` = :hash, `userid` = :userid, `ipaddress` = :ip,

View File

@@ -67,6 +67,9 @@ if ($page == 'showinfo') {
$uptime_duration = duration($cache['start_time']);
$size_vars = bsize($cache['mem_size']);
$num_hits_and_misses = $cache['num_hits'] + $cache['num_misses'];
$num_hits_and_misses = 0 >= $num_hits_and_misses ? 1 : $num_hits_and_misses;
// check for possible empty values that are used in the templates
if (! isset($cache['file_upload_progress'])) {
$cache['file_upload_progress'] = $lng['logger']['unknown'];
@@ -84,10 +87,10 @@ if ($page == 'showinfo') {
$freemem = bsize($mem_avail) . sprintf(" (%.1f%%)", $mem_avail * 100 / $mem_size);
$usedmem = bsize($mem_used) . sprintf(" (%.1f%%)", $mem_used * 100 / $mem_size);
$hits = $cache['num_hits'] . @sprintf(" (%.1f%%)", $cache['num_hits'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
$misses = $cache['num_misses'] . @sprintf(" (%.1f%%)", $cache['num_misses'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
$hits = $cache['num_hits'] . @sprintf(" (%.1f%%)", $cache['num_hits'] * 100 / $num_hits_and_misses);
$misses = $cache['num_misses'] . @sprintf(" (%.1f%%)", $cache['num_misses'] * 100 / $num_hits_and_misses);
// Fragementation: (freeseg - 1) / total_seg
// Fragmentation: (freeseg - 1) / total_seg
$nseg = $freeseg = $fragsize = $freetotal = 0;
for ($i = 0; $i < $mem['num_seg']; $i ++) {
$ptr = 0;

View File

@@ -38,13 +38,43 @@ if ($userinfo['change_serversettings'] == '1') {
// try to convert namserver hosts to ip's
$ns_ips = "";
$known_ns_ips = [];
if (Settings::Get('system.nameservers') != '') {
$nameservers = explode(',', Settings::Get('system.nameservers'));
foreach ($nameservers as $nameserver) {
$nameserver = trim($nameserver);
// DNS servers might be multi homed; allow transfer from all ip
// addresses of the DNS server
$nameserver_ips = \Froxlor\PhpHelper::gethostbynamel6($nameserver);
if (is_array($nameserver_ips) && count($nameserver_ips) > 0) {
$ns_ips .= implode(",", $nameserver_ips);
// append dot to hostname
if (substr($nameserver, - 1, 1) != '.') {
$nameserver .= '.';
}
// ignore invalid responses
if (! is_array($nameserver_ips)) {
// act like \Froxlor\PhpHelper::gethostbynamel6() and return unmodified hostname on error
$nameserver_ips = array(
$nameserver
);
} else {
$known_ns_ips = array_merge($known_ns_ips, $nameserver_ips);
}
if (!empty($ns_ips)) {
$ns_ips .= ',';
}
$ns_ips .= implode(",", $nameserver_ips);
}
}
// AXFR server
if (Settings::Get('system.axfrservers') != '') {
$axfrservers = explode(',', Settings::Get('system.axfrservers'));
foreach ($axfrservers as $axfrserver) {
if (!in_array(trim($axfrserver), $known_ns_ips)) {
if (!empty($ns_ips)) {
$ns_ips .= ',';
}
$ns_ips .= trim($axfrserver);
}
}
}
@@ -59,7 +89,6 @@ if ($userinfo['change_serversettings'] == '1') {
'<SERVERIP>' => Settings::Get('system.ipaddress'),
'<NAMESERVERS>' => Settings::Get('system.nameservers'),
'<NAMESERVERS_IP>' => $ns_ips,
'<AXFRSERVERS>' => Settings::Get('system.axfrservers'),
'<VIRTUAL_MAILBOX_BASE>' => Settings::Get('system.vmail_homedir'),
'<VIRTUAL_UID_MAPS>' => Settings::Get('system.vmail_uid'),
'<VIRTUAL_GID_MAPS>' => Settings::Get('system.vmail_gid'),

View File

@@ -178,7 +178,7 @@ if ($page == 'customers' && $userinfo['customers'] != '0') {
'hash' => $s
));
$s = md5(uniqid(microtime(), 1));
$s = \Froxlor\Froxlor::genSessionId();
$insert = Database::prepare("
INSERT INTO `" . TABLE_PANEL_SESSIONS . "` SET
`hash` = :hash,

View File

@@ -290,9 +290,9 @@ if ($page == 'domains' || $page == 'overview') {
// create serveralias options
$serveraliasoptions = "";
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_wildcard'], '0', '0', true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_www'], '1', '0', true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_none'], '2', '0', true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_wildcard'], '0', Settings::Get('system.domaindefaultalias'), true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_www'], '1', Settings::Get('system.domaindefaultalias'), true, true);
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_none'], '2', Settings::Get('system.domaindefaultalias'), true, true);
$subcanemaildomain = \Froxlor\UI\HTML::makeoption($lng['admin']['subcanemaildomain']['never'], '0', '0', true, true);
$subcanemaildomain .= \Froxlor\UI\HTML::makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', '0', true, true);
@@ -428,7 +428,7 @@ if ($page == 'domains' || $page == 'overview') {
$customer = Database::pexecute_first($customer_stmt, array(
'customerid' => $result['customerid']
));
$result['customername'] = \Froxlor\User::getCorrectFullUserDetails($customer) . ' (' . $customer['loginname'] . ')';
$result['customername'] = \Froxlor\User::getCorrectFullUserDetails($customer);
}
if ($userinfo['customers_see_all'] == '1') {
@@ -594,6 +594,10 @@ if ($page == 'domains' || $page == 'overview') {
}
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
if (Settings::Get('panel.allow_domain_change_customer') != '1') {
$result['customername'] .= ' (<a href="' . $linker->getLink(array('section' => 'customers', 'page' => 'customers',
'action' => 'su', 'id' => $customer['customerid'])) . '" rel="external">' . $customer['loginname'] . '</a>)';
}
$domain_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/domains/formfield.domains_edit.php';
$domain_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($domain_edit_data);

View File

@@ -32,10 +32,10 @@ if ($page == 'message') {
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'viewed panel_message');
if (isset($_POST['send']) && $_POST['send'] == 'send') {
if ($_POST['receipient'] == 0 && $userinfo['customers_see_all'] == '1') {
if ($_POST['recipient'] == 0 && $userinfo['customers_see_all'] == '1') {
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'sending messages to admins');
$result = Database::query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`");
} elseif ($_POST['receipient'] == 1) {
} elseif ($_POST['recipient'] == 1) {
if ($userinfo['customers_see_all'] == '1') {
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers');
$result = Database::query('SELECT `firstname`, `name`, `company`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`");
@@ -49,7 +49,7 @@ if ($page == 'message') {
));
}
} else {
\Froxlor\UI\Response::standard_error('noreceipientsgiven');
\Froxlor\UI\Response::standard_error('norecipientsgiven');
}
$subject = $_POST['subject'];
@@ -105,7 +105,7 @@ if ($page == 'message') {
$sentitems = isset($_GET['sentitems']) ? (int) $_GET['sentitems'] : 0;
if ($sentitems == 0) {
$successmessage = $lng['message']['noreceipients'];
$successmessage = $lng['message']['norecipients'];
} else {
$successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
}
@@ -116,12 +116,12 @@ if ($page == 'message') {
}
$action = '';
$receipients = '';
$recipients = '';
if ($userinfo['customers_see_all'] == '1') {
$receipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['reseller'], 0);
$recipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['reseller'], 0);
}
$receipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['customer'], 1);
$recipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['customer'], 1);
eval("echo \"" . \Froxlor\UI\Template::getTemplate('message/message') . "\";");
}

View File

@@ -22,7 +22,7 @@ require './lib/init.php';
if ($action == 'reset' && function_exists('opcache_reset') && $userinfo['change_serversettings'] == '1') {
opcache_reset();
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "reseted OPcache");
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "reset OPcache");
header('Location: ' . $linker->getLink(array(
'section' => 'opcacheinfo',
'page' => 'showinfo'

View File

@@ -127,7 +127,7 @@ if ($action == 'delete') {
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed api::api_keys");
// select all my (accessable) certificates
// select all my (accessible) certificates
$keys_stmt_query = "SELECT ak.*, c.loginname, a.loginname as adminname
FROM `" . TABLE_API_KEYS . "` ak
LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `ak`.`customerid`

View File

@@ -6,21 +6,20 @@
<property name="pdepend" value="${basedir}/vendor/bin/pdepend" />
<property name="phpcpd" value="${basedir}/vendor/bin/phpcpd" />
<property name="phpcs" value="${basedir}/vendor/bin/phpcs" />
<property name="phpdox" value="${basedir}/vendor/bin/phpdox" />
<property name="phploc" value="${basedir}/vendor/bin/phploc" />
<property name="phpmd" value="${basedir}/vendor/bin/phpmd" />
<property name="phpunit" value="${basedir}/vendor/bin/phpunit" />
<target name="full-build"
depends="prepare,composer,static-analysis,phpunit,phpdox,-check-failure"
depends="prepare,composer,static-analysis,phpunit,-check-failure"
description="Performs static analysis, runs the tests, and generates project documentation" />
<target name="full-build-parallel"
depends="prepare,composer,static-analysis-parallel,phpunit,phpdox,-check-failure"
depends="prepare,composer,static-analysis-parallel,phpunit,-check-failure"
description="Performs static analysis (executing the tools in parallel), runs the tests, and generates project documentation" />
<target name="quick-build"
depends="prepare,composer,lint,phpunit-no-coverage"
depends="prepare,composer,lint,phpunit-no-coverage,-check-failure"
description="Performs a lint check and runs the tests (without generating code coverage reports)" />
<target name="static-analysis"
@@ -49,7 +48,6 @@
<delete dir="${basedir}/build/coverage" />
<delete dir="${basedir}/build/logs" />
<delete dir="${basedir}/build/pdepend" />
<delete dir="${basedir}/build/phpdox" />
<property name="clean.done" value="true" />
</target>
@@ -59,7 +57,6 @@
<mkdir dir="${basedir}/build/coverage" />
<mkdir dir="${basedir}/build/logs" />
<mkdir dir="${basedir}/build/pdepend" />
<mkdir dir="${basedir}/build/phpdox" />
<property name="prepare.done" value="true" />
</target>
@@ -257,7 +254,7 @@
<target name="phpunit-no-coverage" unless="phpunit.done"
depends="composer"
description="Run unit tests with PHPUnit (without generating code coverage reports)">
<exec executable="${phpunit}" failonerror="true"
<exec executable="${phpunit}" failonerror="true" resultproperty="result.phpunit"
taskname="phpunit">
<arg value="--configuration" />
<arg path="${basedir}/phpunit.xml" />
@@ -269,18 +266,6 @@
<property name="phpunit.done" value="true" />
</target>
<target name="phpdox" unless="phpdox.done"
depends="phploc-ci,phpcs-ci,phpcompat-ci,phpmd-ci"
description="Generate project documentation using phpDox">
<exec executable="${phpdox}" dir="${basedir}/build"
taskname="phpdox">
<arg value="--file" />
<arg path="${basedir}/phpdox.xml" />
</exec>
<property name="phpdox.done" value="true" />
</target>
<target name="-check-failure">
<fail message="PHPUnit did not finish successfully">
<condition>

View File

@@ -25,7 +25,7 @@
"issues": "https://github.com/Froxlor/Froxlor/issues",
"forum": "https://forum.froxlor.org/",
"wiki": "https://github.com/Froxlor/Froxlor/wiki",
"irc": "irc://chat.freenode.net/froxlor",
"irc": "irc://irc.libera.chat/froxlor",
"source": "https://github.com/Froxlor/Froxlor",
"docs": "https://github.com/Froxlor/Froxlor/wiki"
},
@@ -43,23 +43,24 @@
"ext-curl": "*",
"ext-json": "*",
"ext-openssl": "*",
"ext-fileinfo": "*",
"phpmailer/phpmailer": "~6.0",
"monolog/monolog": "^1.24",
"robthree/twofactorauth": "^1.6",
"froxlor/idna-convert-legacy": "^2.1",
"voku/anti-xss": "^4.1"
},
},
"require-dev": {
"phpunit/phpunit": "8.4.1",
"phpunit/phpunit": "^9",
"php": ">=7.3",
"ext-pcntl": "*",
"phpcompatibility/php-compatibility": "*",
"squizlabs/php_codesniffer": "*",
"pdepend/pdepend": "^2.5",
"sebastian/phpcpd": "^4.1",
"theseer/phpdox": "^0.12.0",
"phploc/phploc": "^5.0",
"phpmd/phpmd": "^2.6"
"pdepend/pdepend": "^2.9",
"sebastian/phpcpd": "^6.0",
"phploc/phploc": "^7.0",
"phpmd/phpmd": "^2.10",
"phpunit/php-timer" : "^5"
},
"suggest": {
"ext-bcmath": "*",

1687
composer.lock generated

File diff suppressed because it is too large Load Diff

View File

@@ -28,6 +28,12 @@ if ($action == '') {
}
if (session_status() == PHP_SESSION_NONE) {
ini_set("session.name", "s");
ini_set("url_rewriter.tags", "");
ini_set("session.use_cookies", false);
ini_set("session.cookie_httponly", true);
ini_set("session.cookie_secure", $is_ssl);
session_id('login');
session_start();
}
@@ -669,7 +675,7 @@ function finishLogin($userinfo)
global $version, $dbversion, $remote_addr, $http_user_agent, $languages;
if (isset($userinfo['userid']) && $userinfo['userid'] != '') {
$s = md5(uniqid(microtime(), 1));
$s = \Froxlor\Froxlor::genSessionId();
if (isset($_POST['language'])) {
$language = \Froxlor\Validate\Validate::validate($_POST['language'], 'language');

View File

@@ -532,7 +532,7 @@ opcache.interned_strings_buffer'),
('system', 'vmail_gid', '2000'),
('system', 'vmail_homedir', '/var/customers/mail/'),
('system', 'vmail_maildirname', 'Maildir'),
('system', 'bind_enable', '1'),
('system', 'bind_enable', '0'),
('system', 'bindconf_directory', '/etc/bind/'),
('system', 'bindreload_command', '/etc/init.d/bind9 reload'),
('system', 'hostname', 'SERVERNAME'),
@@ -611,6 +611,7 @@ opcache.interned_strings_buffer'),
('system', 'documentroot_use_default_value', '0'),
('system', 'passwordcryptfunc', '3'),
('system', 'axfrservers', ''),
('system', 'powerdns_mode', 'Native'),
('system', 'customer_ssl_path', '/etc/ssl/froxlor-custom/'),
('system', 'allow_error_report_admin', '1'),
('system', 'allow_error_report_customer', '0'),
@@ -628,7 +629,7 @@ opcache.interned_strings_buffer'),
('system', 'apacheitksupport', '0'),
('system', 'leprivatekey', 'unset'),
('system', 'lepublickey', 'unset'),
('system', 'letsencryptca', 'production'),
('system', 'letsencryptca', 'letsencrypt'),
('system', 'letsencryptcountrycode', 'DE'),
('system', 'letsencryptstate', 'Hessen'),
('system', 'letsencryptchallengepath', '/var/www/froxlor'),
@@ -677,6 +678,10 @@ opcache.interned_strings_buffer'),
('system', 'hide_incompatible_settings', '0'),
('system', 'include_default_vhostconf', '0'),
('system', 'soaemail', ''),
('system', 'domaindefaultalias', '0'),
('system', 'createstdsubdom_default', '1'),
('system', 'froxlorusergroup', ''),
('system', 'froxlorusergroup_gid', ''),
('api', 'enabled', '0'),
('2fa', 'enabled', '1'),
('panel', 'decimal_places', '4'),
@@ -689,7 +694,6 @@ opcache.interned_strings_buffer'),
('panel', 'paging', '20'),
('panel', 'natsorting', '1'),
('panel', 'sendalternativemail', '0'),
('panel', 'no_robots', '1'),
('panel', 'allow_domain_change_admin', '0'),
('panel', 'allow_domain_change_customer', '0'),
('panel', 'frontend', 'froxlor'),
@@ -714,8 +718,12 @@ opcache.interned_strings_buffer'),
('panel', 'imprint_url', ''),
('panel', 'terms_url', ''),
('panel', 'privacy_url', ''),
('panel', 'version', '0.10.26'),
('panel', 'db_version', '202103240');
('panel', 'logo_image_header', ''),
('panel', 'logo_image_login', ''),
('panel', 'logo_overridetheme', '0'),
('panel', 'logo_overridecustom', '0'),
('panel', 'version', '0.10.30'),
('panel', 'db_version', '202109040');
DROP TABLE IF EXISTS `panel_tasks`;
@@ -814,7 +822,8 @@ INSERT INTO `panel_languages` (`id`, `language`, `iso`, `file`) VALUES
(4, 'Portugu&ecirc;s', 'pt', 'lng/portugues.lng.php'),
(5, 'Italiano', 'it', 'lng/italian.lng.php'),
(6, 'Nederlands', 'nl', 'lng/dutch.lng.php'),
(7, 'Svenska', 'sv', 'lng/swedish.lng.php');
(7, 'Svenska', 'sv', 'lng/swedish.lng.php'),
(8, '&#268;esk&aacute; republika', 'cs', 'lng/czech.lng.php');
DROP TABLE IF EXISTS `panel_syslog`;
@@ -932,7 +941,7 @@ CREATE TABLE IF NOT EXISTS `ftp_quotalimits` (
INSERT INTO `ftp_quotalimits` (`name`, `quota_type`, `per_session`, `limit_type`, `bytes_in_avail`, `bytes_out_avail`, `bytes_xfer_avail`, `files_in_avail`, `files_out_avail`, `files_xfer_avail`) VALUES
INSERT INTO `ftp_quotalimits` (`name`, `quota_type`, `per_session`, `limit_type`, `bytes_in_avail`, `bytes_out_avail`, `bytes_xfer_avail`, `files_in_avail`, `files_out_avail`, `files_xfer_avail`) VALUES
('froxlor', 'user', 'false', 'hard', 0, 0, 0, 0, 0, 0);

View File

@@ -28,7 +28,7 @@
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install
*
*
*/
class FroxlorInstall
{
@@ -123,7 +123,7 @@ class FroxlorInstall
if ((isset($_POST['installstep']) && $_POST['installstep'] == '1') || (isset($_GET['check']) && $_GET['check'] == '1')) {
$pagetitle = $this->_lng['install']['title'];
if ($this->_checkPostData()) {
// ceck data and create userdata etc.etc.etc.
// check data and create userdata etc.etc.etc.
$result = $this->_doInstall();
} elseif (isset($_GET['check']) && $_GET['check'] == '1') {
// gather data
@@ -163,10 +163,13 @@ class FroxlorInstall
$this->_getPostField('mysql_host', '127.0.0.1');
$this->_getPostField('mysql_database', 'froxlor');
$this->_getPostField('mysql_forcecreate', '0');
$this->_getPostField('mysql_unpriv_user', 'froxlor');
$this->_getPostField('mysql_unpriv_pass');
$this->_getPostField('mysql_root_user', 'root');
$this->_getPostField('mysql_root_pass');
$this->_getPostField('mysql_ssl_ca_file');
$this->_getPostField('mysql_ssl_verify_server_certificate', 0);
$this->_getPostField('admin_user', 'admin');
$this->_getPostField('admin_pass1');
$this->_getPostField('admin_pass2');
@@ -212,6 +215,12 @@ class FroxlorInstall
$options = array(
'PDO::MYSQL_ATTR_INIT_COMMAND' => 'SET names utf8'
);
if (!empty($this->_data['mysql_ssl_ca_file'])) {
$options[\PDO::MYSQL_ATTR_SSL_CA] = $this->_data['mysql_ssl_ca_file'];
$options[\PDO::MYSQL_ATTR_SSL_VERIFY_SERVER_CERT] = (bool) $this->_data['mysql_ssl_verify_server_certificate'];
}
$dsn = "mysql:host=" . $this->_data['mysql_host'] . ";";
$fatal_fail = false;
try {
@@ -246,15 +255,23 @@ class FroxlorInstall
$content .= $this->_status_message('green', "OK");
// check for existing db and create backup if so
$content .= $this->_backupExistingDatabase($db_root);
// create unprivileged user and the database itself
$content .= $this->_createDatabaseAndUser($db_root);
// importing data to new database
$content .= $this->_importDatabaseData();
if (!$this->_abort) {
// create unprivileged user and the database itself
$content .= $this->_createDatabaseAndUser($db_root);
// importing data to new database
$content .= $this->_importDatabaseData();
}
if (! $this->_abort) {
// create DB object for new database
$options = array(
'PDO::MYSQL_ATTR_INIT_COMMAND' => 'SET names utf8'
);
if (!empty($this->_data['mysql_ssl_ca_file'])) {
$options[\PDO::MYSQL_ATTR_SSL_CA] = $this->_data['mysql_ssl_ca_file'];
$options[\PDO::MYSQL_ATTR_SSL_VERIFY_SERVER_CERT] = (bool) $this->_data['mysql_ssl_verify_server_certificate'];
}
$dsn = "mysql:host=" . $this->_data['mysql_host'] . ";dbname=" . $this->_data['mysql_database'] . ";";
$another_fail = false;
try {
@@ -324,10 +341,14 @@ class FroxlorInstall
$userdata .= "\$sql['user']='" . addcslashes($this->_data['mysql_unpriv_user'], "'\\") . "';\n";
$userdata .= "\$sql['password']='" . addcslashes($this->_data['mysql_unpriv_pass'], "'\\") . "';\n";
$userdata .= "\$sql['db']='" . addcslashes($this->_data['mysql_database'], "'\\") . "';\n";
$userdata .= "\$sql['ssl']['caFile']='" . addcslashes($this->_data['mysql_ssl_ca_file'], "'\\") . "';\n";
$userdata .= "\$sql['ssl']['verifyServerCertificate']='" . addcslashes($this->_data['mysql_ssl_verify_server_certificate'], "'\\") . "';\n";
$userdata .= "\$sql_root[0]['caption']='Default';\n";
$userdata .= "\$sql_root[0]['host']='" . addcslashes($this->_data['mysql_host'], "'\\") . "';\n";
$userdata .= "\$sql_root[0]['user']='" . addcslashes($this->_data['mysql_root_user'], "'\\") . "';\n";
$userdata .= "\$sql_root[0]['password']='" . addcslashes($this->_data['mysql_root_pass'], "'\\") . "';\n";
$userdata .= "\$sql_root[0]['ssl']['caFile']='" . addcslashes($this->_data['mysql_ssl_ca_file'], "'\\") . "';\n";
$userdata .= "\$sql_root[0]['ssl']['verifyServerCertificate']='" . addcslashes($this->_data['mysql_ssl_verify_server_certificate'], "'\\") . "';\n";
$userdata .= "// enable debugging to browser in case of SQL errors\n";
$userdata .= "\$sql['debug'] = false;\n";
$userdata .= "?>";
@@ -360,6 +381,30 @@ class FroxlorInstall
return $content;
}
/**
* generate safe unique token
*
* @param int $length
* @return string
*/
private function genUniqueToken(int $length = 16)
{
if(!isset($length) || intval($length) <= 8 ){
$length = 16;
}
if (function_exists('random_bytes')) {
return bin2hex(random_bytes($length));
}
if (function_exists('mcrypt_create_iv')) {
return bin2hex(mcrypt_create_iv($length, MCRYPT_DEV_URANDOM));
}
if (function_exists('openssl_random_pseudo_bytes')) {
return bin2hex(openssl_random_pseudo_bytes($length));
}
// if everything else fails, use unsafe fallback
return md5(uniqid(microtime(), 1));
}
/**
* create corresponding entries in froxlor database
*
@@ -403,8 +448,8 @@ class FroxlorInstall
$content .= $this->_status_message('begin', $this->_lng['install']['adding_admin_user']);
$ins_data = array(
'loginname' => $this->_data['admin_user'],
/* use SHA256 default crypt */
'password' => crypt($this->_data['admin_pass1'], '$5$' . md5(uniqid(microtime(), 1)) . md5(uniqid(microtime(), 1))),
/* use SHA256 default crypt */
'password' => crypt($this->_data['admin_pass1'], '$5$' . $this->genUniqueToken() . $this->genUniqueToken()),
'email' => 'admin@' . $this->_data['servername'],
'deflang' => $this->_languages[$this->_activelng]
);
@@ -555,6 +600,12 @@ class FroxlorInstall
$options = array(
'PDO::MYSQL_ATTR_INIT_COMMAND' => 'SET names utf8'
);
if (!empty($this->_data['mysql_ssl_ca_file'])) {
$options[\PDO::MYSQL_ATTR_SSL_CA] = $this->_data['mysql_ssl_ca_file'];
$options[\PDO::MYSQL_ATTR_SSL_VERIFY_SERVER_CERT] = (bool) $this->_data['mysql_ssl_verify_server_certificate'];
}
$dsn = "mysql:host=" . $this->_data['mysql_host'] . ";dbname=" . $this->_data['mysql_database'] . ";";
$fatal_fail = false;
try {
@@ -687,7 +738,7 @@ class FroxlorInstall
if (version_compare($db_root->getAttribute(\PDO::ATTR_SERVER_VERSION), '8.0.11', '>=')) {
// create user
$stmt = $db_root->prepare("
CREATE USER '" . $username . "'@'" . $access_host . "' IDENTIFIED BY :password
CREATE USER '" . $username . "'@'" . $access_host . "' IDENTIFIED WITH mysql_native_password BY :password
");
$stmt->execute(array(
"password" => $password
@@ -733,39 +784,59 @@ class FroxlorInstall
));
$rows = $db_root->query("SELECT FOUND_ROWS()")->fetchColumn();
$content .= $this->_status_message('begin', $this->_lng['install']['check_db_exists']);
// check result
if ($result_stmt !== false && $rows > 0) {
$tables_exist = true;
}
if ($tables_exist) {
// tell whats going on
$content .= $this->_status_message('begin', $this->_lng['install']['backup_old_db']);
if ((int)$this->_data['mysql_forcecreate'] > 0) {
// set status
$content .= $this->_status_message('orange', 'exists (' . $this->_data['mysql_database'] . ')');
// tell what's going on
$content .= $this->_status_message('begin', $this->_lng['install']['backup_old_db']);
// create temporary backup-filename
$filename = "/tmp/froxlor_backup_" . date('YmdHi') . ".sql";
// create temporary backup-filename
$filename = "/tmp/froxlor_backup_" . date('YmdHi') . ".sql";
// look for mysqldump
$do_backup = false;
if (file_exists("/usr/bin/mysqldump")) {
$do_backup = true;
$mysql_dump = '/usr/bin/mysqldump';
} elseif (file_exists("/usr/local/bin/mysqldump")) {
$do_backup = true;
$mysql_dump = '/usr/local/bin/mysqldump';
}
// look for mysqldump
$do_backup = false;
if (file_exists("/usr/bin/mysqldump")) {
$do_backup = true;
$mysql_dump = '/usr/bin/mysqldump';
} elseif (file_exists("/usr/local/bin/mysqldump")) {
$do_backup = true;
$mysql_dump = '/usr/local/bin/mysqldump';
}
if ($do_backup) {
$command = $mysql_dump . " " . escapeshellarg($this->_data['mysql_database']) . " -u " . escapeshellarg($this->_data['mysql_root_user']) . " --password='" . escapeshellarg($this->_data['mysql_root_pass']) . "' --result-file=" . $filename;
$output = exec($command);
if (stristr($output, "error")) {
$content .= $this->_status_message('red', $this->_lng['install']['backup_failed']);
// create temporary .cnf file
$cnffilename = "/tmp/froxlor_dump.cnf";
$dumpcnf = "[mysqldump]" . PHP_EOL . "password=\"" . $this->_data['mysql_root_pass'] . "\"" . PHP_EOL;
file_put_contents($cnffilename, $dumpcnf);
if ($do_backup) {
$command = $mysql_dump . " --defaults-extra-file=" . $cnffilename . " " . escapeshellarg($this->_data['mysql_database']) . " -u " . escapeshellarg($this->_data['mysql_root_user']) . " --result-file=" . $filename;
$output = [];
exec($command, $output);
@unlink($cnffilename);
if (stristr(implode(" ", $output), "error") || ! file_exists($filename)) {
$content .= $this->_status_message('red', $this->_lng['install']['backup_failed']);
$this->_abort = true;
} else {
$content .= $this->_status_message('green', 'OK (' . $filename . ')');
}
} else {
$content .= $this->_status_message('green', 'OK (' . $filename . ')');
$content .= $this->_status_message('red', $this->_lng['install']['backup_binary_missing']);
$this->_abort = true;
}
} else {
$content .= $this->_status_message('red', $this->_lng['install']['backup_binary_missing']);
$content .= $this->_status_message('red', $this->_lng['install']['db_exists']);
$this->_abort = true;
}
} else {
$content .= $content .= $this->_status_message('green', 'OK');
}
return $content;
@@ -784,7 +855,7 @@ class FroxlorInstall
}
// language selection
$language_options = '';
foreach ($this->_languages as $language_name => $language_file) {
foreach ($this->_languages as $language_file => $language_name) {
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, $this->_activelng, true, true);
}
// get language-form-template
@@ -801,6 +872,8 @@ class FroxlorInstall
$formdata .= $this->_getSectionItemString('mysql_host', true);
// database
$formdata .= $this->_getSectionItemString('mysql_database', true);
// database overwrite if exists?
$formdata .= $this->_getSectionItemYesNo('mysql_forcecreate', false);
// unpriv-user has to be different from root
if ($this->_data['mysql_unpriv_user'] == $this->_data['mysql_root_user']) {
$style = 'blue';
@@ -830,6 +903,9 @@ class FroxlorInstall
}
$formdata .= $this->_getSectionItemString('mysql_root_pass', true, $style, 'password');
$formdata .= $this->_getSectionItemString('mysql_ssl_ca_file', false, $style);
$formdata .= $this->_getSectionItemYesNo('mysql_ssl_verify_server_certificate', false, $style);
/**
* admin data
*/
@@ -867,19 +943,24 @@ class FroxlorInstall
}
// show list of available distro's
$distributions_select_data = [];
$distros = glob(\Froxlor\FileDir::makeCorrectDir(\Froxlor\Froxlor::getInstallDir() . '/lib/configfiles/') . '*.xml');
foreach ($distros as $_distribution) {
$dist = new \Froxlor\Config\ConfigParser($_distribution);
$dist_display = $dist->distributionName . " " . $dist->distributionCodename . " (" . $dist->distributionVersion . ")";
if (!array_key_exists($dist_display, $distributions_select_data)) {
$distributions_select_data[$dist_display] = '';
}
$distributions_select_data[$dist_display] .= str_replace(".xml", "", strtolower(basename($_distribution)));
}
// sort by distribution name
ksort($distributions_select_data);
$distributions_select = '';
foreach ($distributions_select_data as $dist_display => $dist_index) {
// create select-box-option
$distributions_select .= \Froxlor\UI\HTML::makeoption($dist_display, $dist_index, $this->_data['distribution']);
$distributions_select .= \Froxlor\UI\HTML::makeoption($dist_display, $dist_index, $this->_data['distribution'] ?? '');
// $this->_data['distribution']
}
@@ -947,7 +1028,7 @@ class FroxlorInstall
* optional css
* @param string $type
* optional type of input-box (default: text)
*
*
* @return string
*/
private function _getSectionItemString($fieldname = null, $required = false, $style = "", $type = 'text')
@@ -994,7 +1075,6 @@ class FroxlorInstall
*/
private function _getSectionItemSelectbox($fieldname = null, $options = null, $style = "")
{
$groupname = $this->_lng['install'][$groupname];
$fieldlabel = $this->_lng['install'][$fieldname];
$sectionitem = "";
@@ -1239,7 +1319,7 @@ class FroxlorInstall
*
* @param string $template
* name of the template including subdirectory
*
*
* @return string
*/
private function _getTemplate($template = null)
@@ -1306,10 +1386,12 @@ class FroxlorInstall
// from form
if (! empty($_POST['serverip'])) {
$this->_data['serverip'] = $_POST['serverip'];
$this->_data['serverip'] = inet_ntop(inet_pton($this->_data['serverip']));
return;
// from $_SERVER
} elseif (! empty($_SERVER['SERVER_ADDR'])) {
$this->_data['serverip'] = $_SERVER['SERVER_ADDR'];
$this->_data['serverip'] = inet_ntop(inet_pton($this->_data['serverip']));
return;
}
// empty
@@ -1357,7 +1439,14 @@ class FroxlorInstall
// read os-release
if (file_exists('/etc/os-release')) {
$os_dist = parse_ini_file('/etc/os-release', false);
$os_dist_content = file_get_contents('/etc/os-release');
$os_dist_arr = explode("\n", $os_dist_content);
$os_dist = [];
foreach ($os_dist_arr as $os_dist_line) {
if (empty(trim($os_dist_line))) continue;
$tmp = explode("=", $os_dist_line);
$os_dist[$tmp[0]] = str_replace('"', "", trim($tmp[1]));
}
if (is_array($os_dist) && array_key_exists('ID', $os_dist) && array_key_exists('VERSION_ID', $os_dist)) {
$os_version = explode('.', $os_dist['VERSION_ID'])[0];
}

View File

@@ -23,7 +23,7 @@ $lng['requirements']['notfound'] = 'not found';
$lng['requirements']['notinstalled'] = 'not installed';
$lng['requirements']['activated'] = 'enabled';
$lng['requirements']['phpversion'] = 'PHP version >= 7.0';
$lng['requirements']['newerphpprefered'] = 'Good, but php-7.1 is prefered.';
$lng['requirements']['newerphpprefered'] = 'Good, but php-7.1 is preferred.';
$lng['requirements']['phppdo'] = 'PHP PDO extension and PDO-MySQL driver...';
$lng['requirements']['phpsession'] = 'PHP session-extension...';
$lng['requirements']['phpctype'] = 'PHP ctype-extension...';
@@ -39,7 +39,7 @@ $lng['requirements']['phpjson'] = 'PHP json-extension...';
$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
$lng['requirements']['zipdescription'] = 'The auto-update feature requires the zip extension.';
$lng['requirements']['openbasedir'] = 'open_basedir...';
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the coresponding php.ini';
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the corresponding php.ini';
$lng['requirements']['mysqldump'] = 'MySQL dump tool';
$lng['requirements']['mysqldumpmissing'] = 'Automatic backup of possible existing database is not possible. Please install mysql-client tools';
$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';
@@ -53,10 +53,13 @@ $lng['install']['welcometext'] = 'Thank you for choosing Froxlor. Please fill ou
$lng['install']['database'] = 'Database connection';
$lng['install']['mysql_host'] = 'MySQL-Hostname';
$lng['install']['mysql_database'] = 'Database name';
$lng['install']['mysql_forcecreate'] = 'Backup and overwrite database if exists?';
$lng['install']['mysql_unpriv_user'] = 'Username for the unprivileged MySQL-account';
$lng['install']['mysql_unpriv_pass'] = 'Password for the unprivileged MySQL-account';
$lng['install']['mysql_root_user'] = 'Username for the MySQL-root-account';
$lng['install']['mysql_root_pass'] = 'Password for the MySQL-root-account';
$lng['install']['mysql_ssl_ca_file'] = 'MySQL server certificate file path';
$lng['install']['mysql_ssl_verify_server_certificate'] = 'Verify MySQL TLS certificate';
$lng['install']['admin_account'] = 'Administrator Account';
$lng['install']['admin_user'] = 'Administrator Username';
$lng['install']['admin_pass1'] = 'Administrator Password';
@@ -79,6 +82,8 @@ $lng['install']['testing_mysql_fail'] = 'There seems to be a problem with the da
$lng['install']['backup_old_db'] = 'Creating backup of old database...';
$lng['install']['backup_binary_missing'] = 'Could not find mysqldump';
$lng['install']['backup_failed'] = 'Could not backup database';
$lng['install']['check_db_exists'] = 'Checking database...';
$lng['install']['db_exists'] = 'Unable to create database. A database with the same name exists and should not be overwritten';
$lng['install']['prepare_db'] = 'Preparing database...';
$lng['install']['create_mysqluser_and_db'] = 'Creating database and username...';
$lng['install']['testing_new_db'] = 'Testing if database and user have been created correctly...';

View File

@@ -53,10 +53,13 @@ $lng['install']['welcometext'] = 'Vielen Dank dass Sie sich für Froxlor entschi
$lng['install']['database'] = 'Datenbankverbindung';
$lng['install']['mysql_host'] = 'MySQL-Hostname';
$lng['install']['mysql_database'] = 'Datenbank Name';
$lng['install']['mysql_forcecreate'] = 'Datenbank sichern und überschreiben wenn vorhanden?';
$lng['install']['mysql_unpriv_user'] = 'Benutzername für den unprivilegierten MySQL-Account';
$lng['install']['mysql_unpriv_pass'] = 'Passwort für den unprivilegierten MySQL-Account';
$lng['install']['mysql_root_user'] = 'Benutzername für den MySQL-Root-Account';
$lng['install']['mysql_root_pass'] = 'Passwort für den MySQL-Root-Account';
$lng['install']['mysql_ssl_ca_file'] = 'MySQL-Server Zertifikatspfad';
$lng['install']['mysql_ssl_verify_server_certificate'] = 'Validieren des MySQL-Server Zertifikats';
$lng['install']['admin_account'] = 'Admin-Zugang';
$lng['install']['admin_user'] = 'Administrator-Benutzername';
$lng['install']['admin_pass1'] = 'Administrator-Passwort';
@@ -79,6 +82,8 @@ $lng['install']['testing_mysql_fail'] = 'Bei der Verwendung der Datenbank gibt e
$lng['install']['backup_old_db'] = 'Sicherung vorheriger Datenbank...';
$lng['install']['backup_binary_missing'] = 'Konnte mysqldump nicht finden';
$lng['install']['backup_failed'] = 'Sicherung fehlgeschlagen';
$lng['install']['check_db_exists'] = 'Databenbank wird geprüft...';
$lng['install']['db_exists'] = 'Datenbank kann nicht erstellt werden. Eine Datenbank mit dem selben Namen existiert bereits und soll nicht überschrieben werden.';
$lng['install']['prepare_db'] = 'Datenbank wird vorbereitet...';
$lng['install']['create_mysqluser_and_db'] = 'Erstelle Datenbank und Benutzer...';
$lng['install']['testing_new_db'] = 'Teste, ob Datenbank und Benutzer korrekt angelegt wurden...';

View File

@@ -1,6 +1,7 @@
<?php
use Froxlor\Database\Database;
use Froxlor\Settings;
use Froxlor\Validate\Validate;
/**
* This file is part of the Froxlor project.
@@ -14,7 +15,7 @@ use Froxlor\Settings;
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Install
*
*
*/
if (! defined('_CRON_UPDATE')) {
if (! defined('AREA') || (defined('AREA') && AREA != 'admin') || ! isset($userinfo['loginname']) || (isset($userinfo['loginname']) && $userinfo['loginname'] == '')) {
@@ -803,3 +804,147 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.10.25')) {
showUpdateStep("Updating from 0.10.25 to 0.10.26", false);
\Froxlor\Froxlor::updateToVersion('0.10.26');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202103240')) {
showUpdateStep("Adding setting for default serveralias value for new domains", true);
Settings::AddNew("system.domaindefaultalias", '0');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202106160');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202106160')) {
showUpdateStep("Adjusting Let's Encrypt endpoint configuration to support ZeroSSL", true);
if (Settings::Get('system.letsencryptca') == 'testing') {
Settings::Set("system.letsencryptca", 'letsencrypt_test');
} else {
Settings::Set("system.letsencryptca", 'letsencrypt');
}
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202106270');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202106270')) {
showUpdateStep("Adding custom logo image settings", true);
Settings::AddNew("panel.logo_image_header", '');
Settings::AddNew("panel.logo_image_login", '');
lastStepStatus(0);
// Migrating old custom logo over, if exists
$custom_logo_file_old = \Froxlor\Froxlor::getInstallDir() . '/templates/Sparkle/assets/img/logo_custom.png';
if (file_exists($custom_logo_file_old)) {
showUpdateStep("Migrating existing custom logo to new settings", true);
$path = \Froxlor\Froxlor::getInstallDir().'/img/';
if (!is_dir($path) && !mkdir($path, 0775)) {
throw new \Exception("img directory does not exist and cannot be created");
}
if (!is_writable($path)) {
if (!chmod($path, '0775')) {
throw new \Exception("Cannot write to img directory");
}
}
// Save as new custom logo header
$save_to = 'logo_header.png';
copy($custom_logo_file_old, $path.$save_to);
Settings::Set("panel.logo_image_header", "img/{$save_to}?v=".time());
// Save as new custom logo login
$save_to = 'logo_login.png';
copy($custom_logo_file_old, $path.$save_to);
Settings::Set("panel.logo_image_login", "img/{$save_to}?v=".time());
lastStepStatus(0);
}
\Froxlor\Froxlor::updateToDbVersion('202107070');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.26')) {
showUpdateStep("Updating from 0.10.26 to 0.10.27", false);
\Froxlor\Froxlor::updateToVersion('0.10.27');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107070')) {
showUpdateStep("Adding settings to overwrite theme- or custom theme-logo with the new logo settings", true);
Settings::AddNew("panel.logo_overridetheme", '0');
Settings::AddNew("panel.logo_overridecustom", '0');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107200');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107200')) {
showUpdateStep("Adding settings to define default value of 'create std-subdomain' when creating a customer", true);
Settings::AddNew("system.createstdsubdom_default", '1');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107210');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107210')) {
showUpdateStep("Normalizing ipv6 for correct comparison", true);
$result_stmt = Database::prepare("
SELECT `id`, `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "`"
);
Database::pexecute($result_stmt);
$upd_stmt = Database::prepare("UPDATE `" . TABLE_PANEL_IPSANDPORTS . "` SET `ip` = :ip WHERE `id` = :id");
while ($iprow = $result_stmt->fetch(\PDO::FETCH_ASSOC)) {
if (Validate::is_ipv6($iprow['ip'])) {
$ip = inet_ntop(inet_pton($iprow['ip']));
Database::pexecute($upd_stmt, [
'ip' => $ip,
'id' => $iprow['id']
]);
}
}
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107260');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107260')) {
showUpdateStep("Removing setting for search-engine allow yes/no", true);
Database::query("DELETE FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `settinggroup` = 'panel' AND `varname` = 'no_robots'");
lastStepStatus(0);
showUpdateStep("Adding setting to have all froxlor customers in a local group", true);
Settings::AddNew("system.froxlorusergroup", '');
Settings::AddNew("system.froxlorusergroup_gid", '');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202107300');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202107300')) {
showUpdateStep("Adds the possibility to select the PowerDNS Operation Mode", true);
Settings::AddNew("system.powerdns_mode", 'Native');
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202108180');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.27')) {
showUpdateStep("Updating from 0.10.27 to 0.10.28", false);
\Froxlor\Froxlor::updateToVersion('0.10.28');
}
if (\Froxlor\Froxlor::isDatabaseVersion('202108180')) {
showUpdateStep("Adding czech language file", true);
Database::query("INSERT INTO `" . TABLE_PANEL_LANGUAGE . "` SET `language` = '&#268;esk&aacute; republika', `iso` = 'cs', `file` = 'lng/czech.lng.php'");
lastStepStatus(0);
\Froxlor\Froxlor::updateToDbVersion('202109040');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.28')) {
showUpdateStep("Updating from 0.10.28 to 0.10.29", false);
\Froxlor\Froxlor::updateToVersion('0.10.29');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.29')) {
showUpdateStep("Updating from 0.10.29 to 0.10.29.1", false);
\Froxlor\Froxlor::updateToVersion('0.10.29.1');
}
if (\Froxlor\Froxlor::isFroxlorVersion('0.10.29.1')) {
showUpdateStep("Updating from 0.10.29.1 to 0.10.30", false);
\Froxlor\Froxlor::updateToVersion('0.10.30');
}

View File

@@ -2505,7 +2505,7 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.9.30')) {
showUpdateStep("Updating from 0.9.30 to 0.9.31-dev1", true);
lastStepStatus(0);
showUpdateStep("Removing unsused tables");
showUpdateStep("Removing unused tables");
Database::query("DROP TABLE IF EXISTS `ipsandports_docrootsettings`;");
Database::query("DROP TABLE IF EXISTS `domain_docrootsettings`;");
lastStepStatus(0);
@@ -2856,7 +2856,7 @@ if (\Froxlor\Froxlor::isFroxlorVersion('0.9.32-rc1')) {
Settings::AddNew("system.croncmdline", $croncmdline);
// add task to generate cron.d-file
\Froxlor\System\Cronjob::inserttask('99');
// silenty add the auto-update setting - we do not want everybody to know and use this
// silently add the auto-update setting - we do not want everybody to know and use this
// as it is a very dangerous setting
Settings::AddNew("system.cron_allowautoupdate", 0);
lastStepStatus(0);
@@ -3872,7 +3872,7 @@ opcache.interned_strings_buffer');
if (\Froxlor\Froxlor::isDatabaseVersion('201801110')) {
showUpdateStep("Adding php-fpm php PATH setting for envrironment");
showUpdateStep("Adding php-fpm php PATH setting for environment");
Settings::AddNew("phpfpm.envpath", '/usr/local/bin:/usr/bin:/bin');
lastStepStatus(0);

View File

@@ -19,7 +19,7 @@
* Function getPreConfig
*
* outputs various content before the update process
* can be continued (askes for agreement whatever is being asked)
* can be continued (asks for agreement whatever is being asked)
*
* @param string $current_version
* @param int $current_db_version

View File

@@ -414,7 +414,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version, $c
if (Settings::Get('system.webserver') == 'apache2') {
$has_preconfig = true;
$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in ordner to use it.<br />';
$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in order to use it.<br />';
$description .= '<pre>LoadModule authz_core_module modules/mod_authz_core.so
LoadModule authz_host_module modules/mod_authz_host.so</pre><br />';
$question = '<strong>Do you want to enable the Apache-2.4 modification?:</strong>&nbsp;';

View File

@@ -189,7 +189,7 @@ class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
*/
public function listing()
{
// select all my (accessable) certificates
// select all my (accessible) certificates
$certs_stmt_query = "SELECT s.*, d.domain, d.letsencrypt, c.customerid, c.loginname
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`
@@ -237,7 +237,7 @@ class Certificates extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
*/
public function listingCount()
{
// select all my (accessable) certificates
// select all my (accessible) certificates
$certs_stmt_query = "SELECT COUNT(*) as num_certs
FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` s
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` d ON `d`.`id` = `s`.`domainid`

View File

@@ -23,7 +23,7 @@ class CustomerBackups extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Re
{
/**
* check whether backup is enabled systemwide and if accessable for customer (hide_options)
* check whether backup is enabled systemwide and if accessible for customer (hide_options)
*
* @throws \Exception
*/

View File

@@ -308,7 +308,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* @param bool $mysqls_ul
* optional, whether customer should have unlimited mysql-databases, default 0 (false)
* @param bool $createstdsubdomain
* optional, whether to create a standard-subdomain ([loginname].froxlor-hostname.tld), default 0 (false)
* optional, whether to create a standard-subdomain ([loginname].froxlor-hostname.tld), default [system.createstdsubdom_default]
* @param bool $phpenabled
* optional, whether to allow usage of PHP, default 0 (false)
* @param array $allowed_phpconfigs
@@ -316,9 +316,9 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, wether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, wether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
* @param bool $store_defaultindex
* optional, whether to store the default index file to customers homedir
* @param int $hosting_plan_id
@@ -352,7 +352,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
$gender = (int) $this->getParam('gender', true, 0);
$custom_notes = $this->getParam('custom_notes', true, '');
$custom_notes_show = $this->getBoolParam('custom_notes_show', true, 0);
$createstdsubdomain = $this->getBoolParam('createstdsubdomain', true, 0);
$createstdsubdomain = $this->getBoolParam('createstdsubdomain', true, Settings::Get('system.createstdsubdom_default'));
$password = $this->getParam('new_customer_password', true, '');
$sendpassword = $this->getBoolParam('sendpassword', true, 0);
$store_defaultindex = $this->getBoolParam('store_defaultindex', true, 0);
@@ -923,9 +923,9 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
* @param string $theme
* optional, change theme
*
@@ -1512,7 +1512,7 @@ class Customers extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resource
'did' => $row['id']
), true, true);
// remove domains DNS from powerDNS if used, #581
\Froxlor\System\Cronjob::inserttask('11', $result['domain']);
\Froxlor\System\Cronjob::inserttask('11', $row['domain']);
// remove domain from acme.sh / lets encrypt if used
\Froxlor\System\Cronjob::inserttask('12', $row['domain']);
}

View File

@@ -322,7 +322,7 @@ class DirOptions extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
/**
* returns the total number of accessable directory options
* returns the total number of accessible directory options
*
* @param int $customerid
* optional, admin-only, select directory-protections of a specific customer by id

View File

@@ -305,7 +305,7 @@ class DirProtections extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Res
}
/**
* returns the total number of accessable directory protections
* returns the total number of accessible directory protections
*
* @param int $customerid
* optional, admin-only, select directory-protections of a specific customer by id

View File

@@ -77,7 +77,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
}
/**
* returns the total number of accessable domains
* returns the total number of accessible domains
*
* @access admin
* @throws \Exception
@@ -193,6 +193,27 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
return $ipandports;
}
/**
* get ips from array of id's
*
* @param array $ips
* @return array
*/
private function getIpsFromIdArray(array $ids)
{
$resultips_stmt = Database::prepare("
SELECT `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE id = :id
");
$result = [];
foreach ($ids as $id) {
$entry = Database::pexecute_first($resultips_stmt, array(
'id' => $id
));
$result[] = $entry['ip'];
}
return $result;
}
/**
* add new domain entry
*
@@ -213,12 +234,12 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
* @param bool $email_only
* optional, restrict domain to email usage, default 0 (false)
* @param int $selectserveralias
* optional, 0 = wildcard, 1 = www-alias, 2 = none, default 0
* optional, 0 = wildcard, 1 = www-alias, 2 = none, default [system.domaindefaultalias]
* @param bool $speciallogfile
* optional, whether to create an exclusive web-logfile for this domain, default 0 (false)
* @param int $alias
* optional, domain-id of a domain that the new domain should be an alias of, default 0 (none)
* @param bool $issubof
* @param int $issubof
* optional, domain-id of a domain this domain is a subdomain of (required for webserver-cronjob to generate the correct order), default 0 (none)
* @param string $registration_date
* optional, date of domain registration in form of YYYY-MM-DD, default empty (none)
@@ -309,7 +330,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$subcanemaildomain = $this->getParam('subcanemaildomain', true, 0);
$isemaildomain = $this->getBoolParam('isemaildomain', true, 0);
$email_only = $this->getBoolParam('email_only', true, 0);
$serveraliasoption = $this->getParam('selectserveralias', true, 0);
$serveraliasoption = $this->getParam('selectserveralias', true, Settings::Get('system.domaindefaultalias'));
$speciallogfile = $this->getBoolParam('speciallogfile', true, 0);
$aliasdomain = intval($this->getParam('alias', true, 0));
$issubof = $this->getParam('issubof', true, 0);
@@ -574,6 +595,15 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$include_specialsettings = 0;
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($domain);
$selected_ips = $this->getIpsFromIdArray($ssl_ipandports);
if ($domain_ips == false || count(array_intersect($selected_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// We can't enable let's encrypt for wildcard-domains
if ($serveraliasoption == '0' && $letsencrypt == '1') {
\Froxlor\UI\Response::standard_error('nowildcardwithletsencrypt', '', true);
@@ -871,7 +901,7 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
* optional, when setting $speciallogfile to false, this needs to be set to true to confirm the action, default 0 (false)
* @param int $alias
* optional, domain-id of a domain that the new domain should be an alias of, default 0 (none)
* @param bool $issubof
* @param int $issubof
* optional, domain-id of a domain this domain is a subdomain of (required for webserver-cronjob to generate the correct order), default 0 (none)
* @param string $registration_date
* optional, date of domain registration in form of YYYY-MM-DD, default empty (none)
@@ -1326,6 +1356,15 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
$include_specialsettings = 0;
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($result['domain']);
$selected_ips = $this->getIpsFromIdArray($ssl_ipandports);
if ($domain_ips == false || count(array_intersect($selected_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// We can't enable let's encrypt for wildcard-domains
if ($serveraliasoption == '0' && $letsencrypt == '1') {
\Froxlor\UI\Response::standard_error('nowildcardwithletsencrypt', '', true);
@@ -1702,9 +1741,6 @@ class Domains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEn
");
Database::pexecute($_update_stmt, $_update_data, true, true);
// insert a rebuild-task
\Froxlor\System\Cronjob::inserttask('1');
// Cleanup domain <-> ip mapping
$del_stmt = Database::prepare("
DELETE FROM `" . TABLE_DOMAINTOIP . "` WHERE `id_domain` = :id

View File

@@ -326,7 +326,7 @@ class Emails extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
}
/**
* returns the total number of accessable email addresses
* returns the total number of accessible email addresses
*
* @param int $customerid
* optional, admin-only, select email addresses of a specific customer by id

View File

@@ -79,7 +79,7 @@ class FpmDaemons extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
/**
* returns the total number of accessable fpm daemons
* returns the total number of accessible fpm daemons
*
* @access admin
* @throws \Exception

View File

@@ -62,7 +62,7 @@ class Ftps extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntit
if (($this->getUserDetail('ftps_used') < $this->getUserDetail('ftps') || $this->getUserDetail('ftps') == '-1') || $this->isAdmin() && $is_defaultuser == 1) {
// required paramters
// required parameters
$path = $this->getParam('path');
$password = $this->getParam('ftp_password');
@@ -512,7 +512,7 @@ class Ftps extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntit
}
/**
* returns the total number of accessable ftp accounts
* returns the total number of accessible ftp accounts
*
* @param int $customerid
* optional, admin-only, select ftp-users of a specific customer by id

View File

@@ -66,7 +66,7 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
}
/**
* returns the total number of accessable hosting plans
* returns the total number of accessible hosting plans
*
* @access admin
* @throws \Exception
@@ -182,9 +182,9 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, whether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, whether to allow access to webserver access/error-logs, default 0 (false)
*
* @access admin
* @throws \Exception
@@ -309,9 +309,9 @@ class HostingPlans extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resou
* @param bool $perlenabled
* optional, whether to allow usage of Perl/CGI, default 0 (false)
* @param bool $dnsenabled
* optional, ether to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* optional, either to allow usage of the DNS editor (requires activated nameserver in settings), default 0 (false)
* @param bool $logviewenabled
* optional, ether to allow acccess to webserver access/error-logs, default 0 (false)
* optional, either to allow access to webserver access/error-logs, default 0 (false)
*
* @access admin
* @throws \Exception

View File

@@ -65,7 +65,7 @@ class IpsAndPorts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
}
/**
* returns the total number of accessable ip/port entries
* returns the total number of accessible ip/port entries
*
* @access admin
* @throws \Exception
@@ -247,6 +247,9 @@ class IpsAndPorts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$docroot = '';
}
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($ip));
$result_checkfordouble_stmt = Database::prepare("
SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "`
WHERE `ip` = :ip AND `port` = :port");
@@ -462,6 +465,9 @@ class IpsAndPorts extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$docroot = '';
}
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($ip));
if ($result['ip'] != $ip && $result['ip'] == Settings::Get('system.ipaddress') && $result_sameipotherport == false) {
\Froxlor\UI\Response::standard_error('cantchangesystemip', '', true);
} elseif ($result_checkfordouble && $result_checkfordouble['id'] != '' && $result_checkfordouble['id'] != $id) {

View File

@@ -17,7 +17,7 @@ use Froxlor\Settings;
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package API
* @since 0.10.0
*
*
*/
class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEntity
{
@@ -31,25 +31,28 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, default is 0
* @param string $description
* optional, description for database
* @param string $custom_suffix
* optional, name for database
* @param bool $sendinfomail
* optional, send created resource-information to customer, default: false
* @param int $customerid
* optional, required when called as admin (if $loginname is not specified)
* @param string $loginname
* optional, required when called as admin (if $customerid is not specified)
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
*/
public function add()
{
// required paramters
// required parameters
$password = $this->getParam('mysql_password');
// parameters
$dbserver = $this->getParam('mysql_server', true, 0);
$databasedescription = $this->getParam('description', true, '');
$databasename = $this->getParam('custom_suffix', true, '');
$sendinfomail = $this->getBoolParam('sendinfomail', true, 0);
// get needed customer info to reduce the mysql-usage-counter by one
$customer = $this->getCustomerData('mysqls');
@@ -58,6 +61,9 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
$password = \Froxlor\Validate\Validate::validate($password, 'password', '', '', array(), true);
$password = \Froxlor\System\Crypt::validatePassword($password, true);
$databasedescription = \Froxlor\Validate\Validate::validate(trim($databasedescription), 'description', '', '', array(), true);
if (!empty($databasename)) {
$databasename = \Froxlor\Validate\Validate::validate(trim($databasename), 'database_name', '/^[A-Za-z0-9][A-Za-z0-9\-_]+$/i', '', array(), true);
}
// validate whether the dbserver exists
$dbserver = \Froxlor\Validate\Validate::validate($dbserver, html_entity_decode($this->lng['mysql']['mysql_server']), '', '', 0, true);
@@ -79,7 +85,12 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
);
// create database, user, set permissions, etc.pp.
$dbm = new \Froxlor\Database\DbManager($this->logger());
$username = $dbm->createDatabase($newdb_params['loginname'], $password, $newdb_params['mysql_lastaccountnumber']);
if(strtoupper(Settings::Get('customer.mysqlprefix')) == 'DBNAME' && !empty($databasename)) {
$username = $dbm->createDatabase($newdb_params['loginname'].'_'.$databasename, $password);
} else {
$username = $dbm->createDatabase($newdb_params['loginname'], $password, $newdb_params['mysql_lastaccountnumber']);
}
// we've checked against the password in dbm->createDatabase
if ($username == false) {
@@ -181,7 +192,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, the databasename
* @param int $mysql_server
* optional, specify database-server, default is none
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
@@ -281,7 +292,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, required when called as admin (if $loginname is not specified)
* @param string $loginname
* optional, required when called as admin (if $customerid is not specified)
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
@@ -305,7 +316,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
));
$id = $result['id'];
// paramters
// parameters
$password = $this->getParam('mysql_password', true, '');
$databasedescription = $this->getParam('description', true, $result['description']);
@@ -370,7 +381,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional specify offset for resultset
* @param array $sql_orderby
* optional array with index = fieldname and value = ASC|DESC to order the resultset by one or more fields
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array count|list
@@ -428,13 +439,13 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
}
/**
* returns the total number of accessable databases
* returns the total number of accessible databases
*
* @param int $customerid
* optional, admin-only, select dbs of a specific customer by id
* @param string $loginname
* optional, admin-only, select dbs of a specific customer by loginname
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array
@@ -465,7 +476,7 @@ class Mysqls extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\ResourceEnt
* optional, required when called as admin (if $loginname is not specified)
* @param string $loginname
* optional, required when called as admin (if $customerid is not specified)
*
*
* @access admin, customer
* @throws \Exception
* @return string json-encoded array

View File

@@ -122,7 +122,7 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
}
/**
* returns the total number of accessable php-setting entries
* returns the total number of accessible php-setting entries
*
* @access admin
* @throws \Exception
@@ -217,7 +217,9 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
* optional number of seconds for idle-timeout if FPM is used, default is fpm-daemon-value
* @param string $limit_extensions
* optional limitation of php-file-extensions if FPM is used, default is fpm-daemon-value
*
* @param bool $allow_all_customers
* optional add this configuration to the list of every existing customer's allowed-fpm-config list, default is false (no)
*
* @access admin
* @throws \Exception
* @return string json-encoded array
@@ -261,6 +263,7 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$max_requests = $this->getParam('max_requests', true, $def_fpmconfig['max_requests']);
$idle_timeout = $this->getParam('idle_timeout', true, $def_fpmconfig['idle_timeout']);
$limit_extensions = $this->getParam('limit_extensions', true, $def_fpmconfig['limit_extensions']);
$allow_all_customers = $this->getBoolParam('allow_all_customers', true, 0);
// validation
$description = \Froxlor\Validate\Validate::validate($description, 'description', '', '', array(), true);
@@ -367,6 +370,8 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$result = $this->apiCall('PhpSettings.get', array(
'id' => $ins_data['id']
));
$this->addForAllCustomers($allow_all_customers, $ins_data['id']);
return $this->response(200, "successful", $result);
}
throw new \Exception("Not allowed to execute given command.", 403);
@@ -418,6 +423,8 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
* optional number of seconds for idle-timeout if FPM is used, default is fpm-daemon-value
* @param string $limit_extensions
* optional limitation of php-file-extensions if FPM is used, default is fpm-daemon-value
* @param bool $allow_all_customers
* optional add this configuration to the list of every existing customer's allowed-fpm-config list, default is false (no)
*
* @access admin
* @throws \Exception
@@ -456,6 +463,7 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$max_requests = $this->getParam('max_requests', true, $result['max_requests']);
$idle_timeout = $this->getParam('idle_timeout', true, $result['idle_timeout']);
$limit_extensions = $this->getParam('limit_extensions', true, $result['limit_extensions']);
$allow_all_customers = $this->getBoolParam('allow_all_customers', true, 0);
// validation
$description = \Froxlor\Validate\Validate::validate($description, 'description', '', '', array(), true);
@@ -563,6 +571,8 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
$result = $this->apiCall('PhpSettings.get', array(
'id' => $id
));
$this->addForAllCustomers($allow_all_customers, $id);
return $this->response(200, "successful", $result);
}
throw new \Exception("Not allowed to execute given command.", 403);
@@ -618,4 +628,38 @@ class PhpSettings extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resour
}
throw new \Exception("Not allowed to execute given command.", 403);
}
/**
* add given php-config id to the list of allowed php-config to all currently existing customers
* if allow_all_customers parameter is true in PhpSettings::add() or PhpSettings::update()
*
* @param bool $allow_all_customers
* @param int $config_id
*/
private function addForAllCustomers(bool $allow_all_customers, int $config_id)
{
// should this config be added to the allowed list of all existing customers?
if ($allow_all_customers) {
$sel_stmt = Database::prepare("SELECT customerid, allowed_phpconfigs FROM `" . TABLE_PANEL_CUSTOMERS . "`");
$upd_stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET allowed_phpconfigs = :ap WHERE customerid = :cid");
Database::pexecute($sel_stmt);
while ($cust = $sel_stmt->fetch(\PDO::FETCH_ASSOC)) {
// get existing entries of customer
$ap = json_decode($cust['allowed_phpconfigs'], true);
// initialize array if it's empty
if (empty($ap)) {
$ap = [];
}
// add this config
$ap[] = $config_id;
// check for duplicates and force value-type to be int
$ap = array_map('intval', array_unique($ap));
// update customer-entry
Database::pexecute($upd_stmt, [
'ap' => json_encode($ap),
'cid' => $cust['customerid']
]);
}
}
}
}

View File

@@ -2,6 +2,7 @@
namespace Froxlor\Api\Commands;
use Froxlor\Database\Database;
use Froxlor\Domain\Domain;
use Froxlor\Settings;
/**
@@ -230,6 +231,15 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$our_ips = Domain::getIpsOfDomain($domain_check['id']);
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($completedomain);
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// Temporarily deactivate ssl_redirect until Let's Encrypt certificate was generated
if ($ssl_redirect > 0 && $letsencrypt == 1) {
$ssl_redirect = 2;
@@ -252,6 +262,16 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
$phpsid_result['phpsettingid'] = intval($phpsettingid);
}
$allowed_phpconfigs = $customer['allowed_phpconfigs'];
if (! empty($allowed_phpconfigs)) {
$allowed_phpconfigs = json_decode($allowed_phpconfigs, true);
} else {
$allowed_phpconfigs = [];
}
if (! in_array($phpsid_result['phpsettingid'], $allowed_phpconfigs)) {
\Froxlor\UI\Response::standard_error('notallowedphpconfigused', '', true);
}
// actually insert domain
$stmt = Database::prepare("
INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET
@@ -595,9 +615,18 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
}
// validate dns if lets encrypt is enabled to check whether we can use it at all
if ($result['letsencrypt'] != $letsencrypt && $letsencrypt == '1' && Settings::Get('system.le_domain_dnscheck') == '1') {
$our_ips = Domain::getIpsOfDomain($result['parentdomainid']);
$domain_ips = \Froxlor\PhpHelper::gethostbynamel6($result['domain']);
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
\Froxlor\UI\Response::standard_error('invaliddnsforletsencrypt', '', true);
}
}
// We can't enable let's encrypt for wildcard-domains
if ($iswildcarddomain == '1' && $letsencrypt == '1') {
\Froxlor\UI\Response::standard_error('nowildcardwithletsencrypt');
\Froxlor\UI\Response::standard_error('nowildcardwithletsencrypt', '', true);
}
// Temporarily deactivate ssl_redirect until Let's Encrypt certificate was generated
@@ -619,12 +648,22 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
$this->logger()->logAction($this->isAdmin() ? \Froxlor\FroxlorLogger::ADM_ACTION : \Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "[API] automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'");
}
$allowed_phpconfigs = $customer['allowed_phpconfigs'];
if (! empty($allowed_phpconfigs)) {
$allowed_phpconfigs = json_decode($allowed_phpconfigs, true);
} else {
$allowed_phpconfigs = [];
}
if (! in_array($phpsettingid, $allowed_phpconfigs)) {
\Froxlor\UI\Response::standard_error('notallowedphpconfigused', '', true);
}
// handle redirect
if ($_doredirect) {
\Froxlor\Domain\Domain::updateRedirectOfDomain($id, $redirectcode);
}
if ($path != $result['documentroot'] || $isemaildomain != $result['isemaildomain'] || $wwwserveralias != $result['wwwserveralias'] || $iswildcarddomain != $result['iswildcarddomain'] || $aliasdomain != $result['aliasdomain'] || $openbasedir_path != $result['openbasedir_path'] || $ssl_redirect != $result['ssl_redirect'] || $letsencrypt != $result['letsencrypt'] || $hsts_maxage != $result['hsts'] || $hsts_sub != $result['hsts_sub'] || $hsts_preload != $result['hsts_preload'] || $phpsettingid != $result['phpsettingid']) {
if ($path != $result['documentroot'] || $isemaildomain != $result['isemaildomain'] || $wwwserveralias != $result['wwwserveralias'] || $iswildcarddomain != $result['iswildcarddomain'] || $aliasdomain != (int)$result['aliasdomain'] || $openbasedir_path != $result['openbasedir_path'] || $ssl_redirect != $result['ssl_redirect'] || $letsencrypt != $result['letsencrypt'] || $hsts_maxage != $result['hsts'] || $hsts_sub != $result['hsts_sub'] || $hsts_preload != $result['hsts_preload'] || $phpsettingid != $result['phpsettingid']) {
$stmt = Database::prepare("
UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
`documentroot` = :documentroot,
@@ -810,7 +849,7 @@ class SubDomains extends \Froxlor\Api\ApiCommand implements \Froxlor\Api\Resourc
}
/**
* returns the total number of accessable subdomain entries
* returns the total number of accessible subdomain entries
*
* @param int $customerid
* optional, admin-only, select (sub)domains of a specific customer by id

View File

@@ -133,7 +133,7 @@ abstract class BulkAction
$new_data = array();
foreach ($this->api_params as $idx => $param) {
if (isset($data_array[$idx]) && ! empty($data_array[$idx])) {
if (isset($data_array[$idx])) {
$new_data[$param] = $data_array[$idx];
}
}
@@ -150,7 +150,7 @@ abstract class BulkAction
/**
* reads in the csv import file and returns an array with
* all the entites to be imported
* all the entities to be imported
*
* @param string $separator
*

View File

@@ -341,13 +341,43 @@ class ConfigServicesAction extends \Froxlor\Cli\Action
// try to convert namserver hosts to ip's
$ns_ips = "";
$known_ns_ips = [];
if (Settings::Get('system.nameservers') != '') {
$nameservers = explode(',', Settings::Get('system.nameservers'));
foreach ($nameservers as $nameserver) {
$nameserver = trim($nameserver);
// DNS servers might be multi homed; allow transfer from all ip
// addresses of the DNS server
$nameserver_ips = \Froxlor\PhpHelper::gethostbynamel6($nameserver);
if (is_array($nameserver_ips) && count($nameserver_ips) > 0) {
$ns_ips .= implode(",", $nameserver_ips);
// append dot to hostname
if (substr($nameserver, - 1, 1) != '.') {
$nameserver .= '.';
}
// ignore invalid responses
if (! is_array($nameserver_ips)) {
// act like \Froxlor\PhpHelper::gethostbynamel6() and return unmodified hostname on error
$nameserver_ips = array(
$nameserver
);
} else {
$known_ns_ips = array_merge($known_ns_ips, $nameserver_ips);
}
if (!empty($ns_ips)) {
$ns_ips .= ',';
}
$ns_ips .= implode(",", $nameserver_ips);
}
}
// AXFR server
if (Settings::Get('system.axfrservers') != '') {
$axfrservers = explode(',', Settings::Get('system.axfrservers'));
foreach ($axfrservers as $axfrserver) {
if (!in_array(trim($axfrserver), $known_ns_ips)) {
if (!empty($ns_ips)) {
$ns_ips .= ',';
}
$ns_ips .= trim($axfrserver);
}
}
}
@@ -365,7 +395,6 @@ class ConfigServicesAction extends \Froxlor\Cli\Action
'<SERVERIP>' => Settings::Get('system.ipaddress'),
'<NAMESERVERS>' => Settings::Get('system.nameservers'),
'<NAMESERVERS_IP>' => $ns_ips,
'<AXFRSERVERS>' => Settings::Get('system.axfrservers'),
'<VIRTUAL_MAILBOX_BASE>' => Settings::Get('system.vmail_homedir'),
'<VIRTUAL_UID_MAPS>' => Settings::Get('system.vmail_uid'),
'<VIRTUAL_GID_MAPS>' => Settings::Get('system.vmail_gid'),
@@ -402,7 +431,7 @@ class ConfigServicesAction extends \Froxlor\Cli\Action
} elseif (! file_exists($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
} elseif (! is_readable($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor direcotry cannot be read ('" . $this->_args["froxlor-dir"] . "')");
throw new \Exception("Given froxlor directory cannot be read ('" . $this->_args["froxlor-dir"] . "')");
}
}
}

View File

@@ -62,7 +62,7 @@ class SwitchServerIpAction extends \Froxlor\Cli\Action
$ip_list = $this->_args['switch'];
if (empty($ip_list) || is_bool($ip_list)) {
throw new \Exception("No paramters given for --switch action.");
throw new \Exception("No parameters given for --switch action.");
}
$ips_to_switch = array();
@@ -179,7 +179,7 @@ class SwitchServerIpAction extends \Froxlor\Cli\Action
} elseif (! file_exists($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor directory cannot be found ('" . $this->_args["froxlor-dir"] . "')");
} elseif (! is_readable($this->_args["froxlor-dir"])) {
throw new \Exception("Given froxlor direcotry cannot be read ('" . $this->_args["froxlor-dir"] . "')");
throw new \Exception("Given froxlor directory cannot be read ('" . $this->_args["froxlor-dir"] . "')");
}
}
}

View File

@@ -55,7 +55,7 @@ class ConfigDaemon
private $isparsed = false;
/**
* Sub - area of the full - XML only holding the daemon - data we are interessted in
* Sub - area of the full - XML only holding the daemon - data we are interested in
*
* @var \SimpleXMLElement
*/

View File

@@ -1,6 +1,8 @@
<?php
namespace Froxlor\Cron\Dns;
use Froxlor\Settings;
/**
* This file is part of the Froxlor project.
* Copyright (c) 2016 the Froxlor Team (see authors).
@@ -97,26 +99,29 @@ class PowerDNS extends DnsBase
));
$pdns_domain = $pdns_domains_stmt->fetch(\PDO::FETCH_ASSOC);
$del_rec_stmt->execute(array(
'did' => $pdns_domain['id']
));
$del_meta_stmt->execute(array(
'did' => $pdns_domain['id']
));
$del_dom_stmt->execute(array(
'did' => $pdns_domain['id']
));
if ($pdns_domain && ! empty($pdns_domain['id'])) {
$del_rec_stmt->execute(array(
'did' => $pdns_domain['id']
));
$del_meta_stmt->execute(array(
'did' => $pdns_domain['id']
));
$del_dom_stmt->execute(array(
'did' => $pdns_domain['id']
));
}
}
}
private function insertZone($domainname, $serial = 0)
{
$ins_stmt = \Froxlor\Dns\PowerDNS::getDB()->prepare("
INSERT INTO domains set `name` = :domainname, `notified_serial` = :serial, `type` = 'NATIVE'
INSERT INTO domains set `name` = :domainname, `notified_serial` = :serial, `type` = :type
");
$ins_stmt->execute(array(
'domainname' => $domainname,
'serial' => $serial
'serial' => $serial,
'type' => strtoupper(Settings::Get('system.powerdns_mode'))
));
$lastid = \Froxlor\Dns\PowerDNS::getDB()->lastInsertId();
return $lastid;

View File

@@ -826,7 +826,7 @@ class Apache extends HttpConfigBase
// After inserting the AWStats information,
// be sure to build the awstats conf file as well
// and chown it using $awstats_params, #258
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
}
}

View File

@@ -287,7 +287,7 @@ class ConfigIO
}
/**
* returns a file/direcotry from the settings and checks whether it exists
* returns a file/directory from the settings and checks whether it exists
*
* @param string $group
* settings-group

View File

@@ -21,13 +21,21 @@ use Froxlor\FileDir;
* @author Froxlor team <team@froxlor.org> (2016-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Cron
*
*
* @since 0.9.35
*
*
*/
class AcmeSh extends \Froxlor\Cron\FroxlorCron
{
const ACME_PROVIDER = [
'letsencrypt' => "https://acme-v02.api.letsencrypt.org/directory",
'letsencrypt_test' => "https://acme-staging-v02.api.letsencrypt.org/directory",
'buypass' => "https://api.buypass.com/acme/directory",
'buypass_test' => "https://api.test4.buypass.no/acme/directory",
'zerossl' => "https://acme.zerossl.com/v2/DV90"
];
private static $apiserver = "";
private static $acmesh = "/root/.acme.sh/acme.sh";
@@ -63,7 +71,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
$issue_domains = self::issueDomains();
$renew_froxlor = self::renewFroxlorVhost();
$renew_domains = self::renewDomains(true);
if ($issue_froxlor || !empty($issue_domains) || !empty($renew_froxlor) || $renew_domains) {
if ($issue_froxlor || ! empty($issue_domains) || ! empty($renew_froxlor) || $renew_domains) {
// insert task to generate certificates and vhost-configs
\Froxlor\System\Cronjob::inserttask(1);
}
@@ -71,7 +79,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
}
// set server according to settings
self::$apiserver = 'https://acme-' . (Settings::Get('system.letsencryptca') == 'testing' ? 'staging-' : '') . 'v0' . \Froxlor\Settings::Get('system.leapiversion') . '.api.letsencrypt.org/directory';
self::$apiserver = self::ACME_PROVIDER[Settings::Get('system.letsencryptca')];
// validate acme.sh installation
if (! self::checkInstall()) {
@@ -123,7 +131,8 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
'ssl_key_file' => null,
'ssl_ca_file' => null,
'ssl_csr_file' => null,
'id' => null
'id' => null,
'wwwserveralias' => 0
);
// add to queue
@@ -157,7 +166,8 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
'ssl_key_file' => is_array($renew_froxlor) ? $renew_froxlor['ssl_key_file'] : null,
'ssl_ca_file' => is_array($renew_froxlor) ? $renew_froxlor['ssl_ca_file'] : null,
'ssl_csr_file' => is_array($renew_froxlor) ? $renew_froxlor['ssl_csr_file'] : null,
'id' => is_array($renew_froxlor) ? $renew_froxlor['id'] : null
'id' => is_array($renew_froxlor) ? $renew_froxlor['id'] : null,
'wwwserveralias' => 0
);
$renew_domains[] = $certrow;
}
@@ -279,12 +289,18 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
$our_ips = Domain::getIpsOfDomain($domain_id);
foreach ($loop_domains as $idx => $domain) {
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_INFO, "Validating DNS of " . $domain);
// ips accordint to NS
// ips according to NS
$domain_ips = PhpHelper::gethostbynamel6($domain);
if ($domain_ips == false || count(array_intersect($our_ips, $domain_ips)) <= 0) {
// no common ips...
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_WARNING, "Skipping Let's Encrypt generation for " . $domain . " due to no system known IP address via DNS check");
unset($domains[$idx]);
// in order to avoid a cron-loop that tries to get a certificate every 5 minutes, we disable let's encrypt for this domain
$upd_stmt = Database::prepare("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `letsencrypt` = '0' WHERE `id` = :did");
Database::pexecute($upd_stmt, [
'did' => $domain_id
]);
$cronlog->logAction(FroxlorLogger::CRON_ACTION, LOG_WARNING, "Let's Encrypt deactivated for domain " . $domain);
}
}
}
@@ -306,7 +322,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
if (Settings::Get('system.letsencryptreuseold') != '1') {
$acmesh_cmd .= " --always-force-new-domain-key";
}
if (Settings::Get('system.letsencryptca') == 'testing') {
if (Settings::Get('system.letsencryptca') == 'letsencrypt_test') {
$acmesh_cmd .= " --staging";
}
if ($force) {
@@ -517,7 +533,7 @@ class AcmeSh extends \Froxlor\Cron\FroxlorCron
$env_file = FileDir::makeCorrectFile(dirname(self::$acmesh) . '/acme.sh.env');
if (file_exists($env_file)) {
$output = [];
$cut = <<<EOC
$cut = <<<EOC
cut -d'"' -f2
EOC;
exec('grep "LE_WORKING_DIR" ' . escapeshellarg($env_file) . ' | ' . $cut, $output);

View File

@@ -678,7 +678,7 @@ class Lighttpd extends HttpConfigBase
// After inserting the AWStats information,
// be sure to build the awstats conf file as well
// and chown it using $awstats_params, #258
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
}
}

View File

@@ -1153,7 +1153,7 @@ class Nginx extends HttpConfigBase
// After inserting the AWStats information,
// be sure to build the awstats conf file as well
// and chown it using $awstats_params, #258
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the informations
// Bug 960 + Bug 970 : Use full $domain instead of custom $awstats_params as following classes depend on the information
\Froxlor\Http\Statistics::createAWStatsConf(Settings::Get('system.logfiles_directory') . $domain['loginname'] . $speciallogfile . '-access.log', $domain['domain'], $alias . $server_alias, $domain['customerroot'], $domain);
}
}

View File

@@ -94,7 +94,7 @@ class Fcgid
// Set Binary
$starter_file .= "exec " . $phpconfig['binary'] . " -c " . escapeshellarg($this->getConfigDir()) . "\n";
// remove +i attibute, so starter can be overwritten
// remove +i attribute, so starter can be overwritten
if (file_exists($this->getStarterFile())) {
\Froxlor\FileDir::removeImmutable($this->getStarterFile());
}

View File

@@ -218,7 +218,7 @@ class Fpm
$openbasedir .= $_phpappendopenbasedir;
}
}
$fpm_config .= 'php_admin_value[session.save_path] = ' . \Froxlor\FileDir::makeCorrectDir(Settings::Get('phpfpm.tmpdir') . '/' . $this->domain['loginname'] . '/') . "\n";
$fpm_config .= 'php_admin_value[upload_tmp_dir] = ' . \Froxlor\FileDir::makeCorrectDir(Settings::Get('phpfpm.tmpdir') . '/' . $this->domain['loginname'] . '/') . "\n";
$admin = $this->getAdminData($this->domain['adminid']);
@@ -261,6 +261,11 @@ class Fpm
$fpm_config .= 'php_admin_value[sendmail_path] = /usr/sbin/sendmail -t -i -f ' . $this->domain['email'] . "\n";
}
// check for session.save_path, whether it has been specified by the user, if not, set a default
if (strpos($fpm_config, 'php_value[session.save_path]') === false && strpos($fpm_config, 'php_admin_value[session.save_path]') === false) {
$fpm_config .= 'php_admin_value[session.save_path] = ' . $this->getTempDir() . "\n";
}
// append custom phpfpm configuration
if (! empty($fpm_custom_config)) {
$fpm_config .= "\n; Custom Configuration\n";

View File

@@ -2,6 +2,7 @@
namespace Froxlor\Cron\System;
use Froxlor\Database\Database;
use Froxlor\Settings;
/**
* This file is part of the Froxlor project.
@@ -25,12 +26,13 @@ class Extrausers
// passwd
$passwd = '/var/lib/extrausers/passwd';
$sql = "SELECT customerid,username,'x' as password,uid,gid,'Froxlor User' as comment,homedir,shell, login_enabled FROM ftp_users ORDER BY uid, LENGTH(username) ASC";
self::generateFile($passwd, $sql, $cronlog);
$users_list = [];
self::generateFile($passwd, $sql, $cronlog, $users_list);
// group
$group = '/var/lib/extrausers/group';
$sql = "SELECT groupname,'x' as password,gid,members FROM ftp_groups ORDER BY gid ASC";
self::generateFile($group, $sql, $cronlog);
self::generateFile($group, $sql, $cronlog, $users_list);
// shadow
$shadow = '/var/lib/extrausers/shadow';
@@ -44,7 +46,7 @@ class Extrausers
@chmod('/var/lib/extrausers/shadow', 0640);
}
private static function generateFile($file, $query, &$cronlog)
private static function generateFile($file, $query, &$cronlog, &$result_list = null)
{
$type = basename($file);
$cronlog->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, 'Creating ' . $type . ' file');
@@ -74,6 +76,9 @@ class Extrausers
$u['comment'] = 'Locked Froxlor User';
}
$line = $u['username'] . ':' . $u['password'] . ':' . $u['uid'] . ':' . $u['gid'] . ':' . $u['comment'] . ':' . $u['homedir'] . ':' . $u['shell'] . PHP_EOL;
if (is_array($result_list)) {
$result_list[] = $u['username'];
}
break;
case 'group':
$line = $u['groupname'] . ':' . $u['password'] . ':' . $u['gid'] . ':' . $u['members'] . PHP_EOL;
@@ -84,6 +89,19 @@ class Extrausers
}
$data_content .= $line;
}
// check for local group to generate
if ($type == 'group' && Settings::Get('system.froxlorusergroup') != '') {
$guid = intval(Settings::Get('system.froxlorusergroup_gid'));
if (empty($guid)) {
$guid = intval(Settings::Get('system.lastguid')) + 1;
Settings::Set('system.lastguid', $guid, true);
Settings::Set('system.froxlorusergroup_gid', $guid, true);
}
$line = Settings::Get('system.froxlorusergroup') . ':x:' . $guid . ':' . implode(',', $result_list) . PHP_EOL;
$data_content .= $line;
}
if (file_put_contents($file, $data_content) !== false) {
$cronlog->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_NOTICE, 'Succesfully wrote ' . $type . ' file');
} else {

View File

@@ -69,7 +69,7 @@ class TrafficCron extends \Froxlor\Cron\FroxlorCron
}
/**
* TRAFFIC AND DISKUSAGE MESSURE
* TRAFFIC AND DISKUSAGE MEASURE
*/
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::CRON_ACTION, LOG_INFO, 'Traffic run started...');
$admin_traffic = array();

View File

@@ -165,7 +165,7 @@ class Database
}
/**
* returns the sql-access data as array using indeces
* returns the sql-access data as array using indices
* 'user', 'passwd' and 'host'.
* Returns false if not enabled
*
@@ -279,6 +279,8 @@ class Database
$host = $sql_root[self::$dbserver]['host'];
$socket = isset($sql_root[self::$dbserver]['socket']) ? $sql_root[self::$dbserver]['socket'] : null;
$port = isset($sql_root[self::$dbserver]['port']) ? $sql_root[self::$dbserver]['port'] : '3306';
$sslCAFile = $sql_root[self::$dbserver]['ssl']['caFile'] ?? "";
$sslVerifyServerCertificate = $sql_root[self::$dbserver]['ssl']['verifyServerCertificate'] ?? false;
} else {
$caption = 'localhost';
$user = $sql["user"];
@@ -286,6 +288,8 @@ class Database
$host = $sql["host"];
$socket = isset($sql['socket']) ? $sql['socket'] : null;
$port = isset($sql['port']) ? $sql['port'] : '3306';
$sslCAFile = $sql['ssl']['caFile'] ?? "";
$sslVerifyServerCertificate = $sql['ssl']['verifyServerCertificate'] ?? false;
}
// save sql-access-data if needed
@@ -297,7 +301,9 @@ class Database
'port' => $port,
'socket' => $socket,
'db' => $sql["db"],
'caption' => $caption
'caption' => $caption,
'ssl_ca_file' => $sslCAFile,
'ssl_verify_server_certificate' => $sslVerifyServerCertificate
);
}
@@ -321,6 +327,11 @@ class Database
} else {
$dbconf["dsn"]['host'] = $host;
$dbconf["dsn"]['port'] = $port;
if (!empty(self::$sqldata['ssl_ca_file'])) {
$options[\PDO::MYSQL_ATTR_SSL_CA] = self::$sqldata['ssl_ca_file'];
$options[\PDO::MYSQL_ATTR_SSL_VERIFY_SERVER_CERT] = (bool) self::$sqldata['ssl_verify_server_certificate'];
}
}
self::$dbname = $sql["db"];

View File

@@ -16,9 +16,9 @@ use Froxlor\Settings;
* @author Froxlor team <team@froxlor.org> (2010-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Classes
*
*
* @since 0.9.31
*
*
*/
/**
@@ -82,11 +82,13 @@ class DbManager
// get all usernames from db-manager
$allsqlusers = $this->getManager()->getAllSqlUsers();
// generate random username
$username = $loginname . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
$username = $loginname . '-' . substr(\Froxlor\Froxlor::genSessionId(), 20, 3);
// check whether it exists on the DBMS
while (in_array($username, $allsqlusers)) {
$username = $loginname . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
$username = $loginname . '-' . substr(\Froxlor\Froxlor::genSessionId(), 20, 3);
}
} elseif (strtoupper(Settings::Get('customer.mysqlprefix')) == 'DBNAME') {
$username = $loginname;
} else {
$username = $loginname . Settings::Get('customer.mysqlprefix') . (intval($last_accnumber) + 1);
}

View File

@@ -90,7 +90,7 @@ class IntegrityCheck
'dbname' => Database::getDbName()
));
$charset = isset($resp['default_character_set_name']) ? $resp['default_character_set_name'] : null;
if (! empty($charset) && strtolower($charset) != 'utf8') {
if (! empty($charset) && substr(strtolower($charset), 0, 4) != 'utf8') {
$this->log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "database charset seems to be different from UTF-8, integrity-check can fix that");
if ($fix) {
// fix database

View File

@@ -53,7 +53,7 @@ class Dns
$domain = $domain_id;
}
if ($domain['isbinddomain'] != '1') {
if (!isset($domain['isbinddomain']) || $domain['isbinddomain'] != '1') {
return;
}
@@ -190,12 +190,26 @@ class Dns
'@',
'www',
'*'
] as $crceord) {
if ($entry['type'] == 'CNAME' && $entry['record'] == '@' && (array_key_exists(md5($crceord), $required_entries['A']) || array_key_exists(md5($crceord), $required_entries['AAAA']))) {
unset($required_entries['A'][md5($crceord)]);
unset($required_entries['AAAA'][md5($crceord)]);
] as $crecord) {
if ($entry['type'] == 'CNAME' && $entry['record'] == '@' && (array_key_exists(md5($crecord), $required_entries['A']) || array_key_exists(md5($crecord), $required_entries['AAAA']))) {
unset($required_entries['A'][md5($crecord)]);
unset($required_entries['AAAA'][md5($crecord)]);
}
}
// also allow overriding of auto-generated values (imap,pop3,mail,smtp) if enabled in the settings
if (Settings::Get('system.dns_createmailentry')) {
foreach (array(
'imap',
'pop3',
'mail',
'smtp'
) as $crecord) {
if ($entry['type'] == 'CNAME' && $entry['record'] == $crecord && (array_key_exists(md5($crecord), $required_entries['A']) || array_key_exists(md5($crecord), $required_entries['AAAA']))) {
unset($required_entries['A'][md5($crecord)]);
unset($required_entries['AAAA'][md5($crecord)]);
}
}
}
$zonerecords[] = new DnsEntry($entry['record'], $entry['type'], $entry['content'], $entry['prio'], $entry['ttl']);
}
@@ -324,11 +338,28 @@ class Dns
foreach ($records as $record) {
if ($record == '@CAA@') {
$caa_entries = explode(PHP_EOL, Settings::Get('caa.caa_entry'));
if ($domain['letsencrypt'] == 1) {
$le_entry = $domain['iswildcarddomain'] == '1' ? '0 issuewild "letsencrypt.org"' : '0 issue "letsencrypt.org"';
array_push($caa_entries, $le_entry);
$caa_domain = "letsencrypt.org";
if (Settings::Get('system.letsencryptca') == 'buypass' || Settings::Get('system.letsencryptca') == 'buypass_test') {
$caa_domain = "buypass.com";
}
if ($domain['letsencrypt'] == 1) {
if (Settings::Get('system.letsencryptca') == 'zerossl') {
$caa_domains = [
"sectigo.com",
"trust-provider.com",
"usertrust.com",
"comodoca.com",
"comodo.com"
];
foreach ($caa_domains as $caa_domain) {
$le_entry = $domain['iswildcarddomain'] == '1' ? '0 issuewild "' . $caa_domain . '"' : '0 issue "' . $caa_domain . '"';
array_push($caa_entries, $le_entry);
}
} else {
$le_entry = $domain['iswildcarddomain'] == '1' ? '0 issuewild "' . $caa_domain . '"' : '0 issue "' . $caa_domain . '"';
array_push($caa_entries, $le_entry);
}
}
foreach ($caa_entries as $entry) {
if (empty($entry)) continue;
$zonerecords[] = new DnsEntry('@', 'CAA', $entry);
@@ -372,7 +403,7 @@ class Dns
$soa_content = $primary_ns . " " . self::escapeSoaAdminMail($soa_email) . " ";
$soa_content .= $domain['bindserial'] . " ";
// TODO for now, dummy time-periods
$soa_content .= "3600 900 604800 " . (int) Settings::Get('system.defaultttl');
$soa_content .= "3600 900 1209600 1200";
$soa_record = new DnsEntry('@', 'SOA', $soa_content);
array_unshift($zonerecords, $soa_record);

View File

@@ -62,6 +62,11 @@ class PowerDNS
} else {
$dbconf["dsn"]['host'] = $mysql_data['gmysql-host'];
$dbconf["dsn"]['port'] = $mysql_data['gmysql-port'];
if (!empty($mysql_data['gmysql-ssl-ca-file'])) {
$options[\PDO::MYSQL_ATTR_SSL_CA] = $mysql_data['gmysql-ssl-ca-file'];
$options[\PDO::MYSQL_ATTR_SSL_VERIFY_SERVER_CERT] = (bool) $mysql_data['gmysql-ssl-verify-server-certificate'];
}
}
// add options to dsn-string

View File

@@ -340,7 +340,7 @@ class Domain
// run remove command
\Froxlor\FileDir::safe_exec($acmesh . $params);
// remove certificates directory
@unlink($certificate_folder);
\Froxlor\FileDir::safe_exec('rm -rf ' . $certificate_folder);
}
}
return true;

View File

@@ -370,7 +370,7 @@ class FileDir
* @param
* integer uid The uid which must match the found directories
* @param
* integer gid The gid which must match the found direcotries
* integer gid The gid which must match the found directories
* @param
* string value the value for the input-field
*
@@ -461,7 +461,7 @@ class FileDir
* @param int $uid
* the uid which must match the found directories
* @param int $gid
* the gid which must match the found direcotries
* the gid which must match the found directories
*
* @return array Array of found valid paths
*/

View File

@@ -7,10 +7,10 @@ final class Froxlor
{
// Main version variable
const VERSION = '0.10.26';
const VERSION = '0.10.30';
// Database version (YYYYMMDDC where C is a daily counter)
const DBVERSION = '202103240';
const DBVERSION = '202109040';
// Distribution branding-tag (used for Debian etc.)
const BRANDING = '';
@@ -63,7 +63,7 @@ final class Froxlor
*
* @param string $to_check
* version to check, if empty current version is used
*
*
* @return bool true if version to check does not match, else false
*/
public static function hasUpdates($to_check = null)
@@ -84,7 +84,7 @@ final class Froxlor
*
* @param int $to_check
* version to check, if empty current dbversion is used
*
*
* @return bool true if version to check does not match, else false
*/
public static function hasDbUpdates($to_check = null)
@@ -105,7 +105,7 @@ final class Froxlor
*
* @param int $to_check
* version to check
*
*
* @return bool true if version to check matches, else false
*/
public static function isDatabaseVersion($to_check = null)
@@ -124,7 +124,7 @@ final class Froxlor
*
* @param string $new_version
* new-version
*
*
* @return bool true on success, else false
*/
public static function updateToDbVersion($new_version = null)
@@ -150,7 +150,7 @@ final class Froxlor
*
* @param string $new_version
* new-version
*
*
* @return bool true on success, else false
*/
public static function updateToVersion($new_version = null)
@@ -191,7 +191,7 @@ final class Froxlor
*
* @param string $to_check
* version to check
*
*
* @return bool true if version to check matches, else false
*/
public static function isFroxlorVersion($to_check = null)
@@ -202,6 +202,30 @@ final class Froxlor
return false;
}
/**
* generate safe unique session id
*
* @param int $length
* @return string
*/
public static function genSessionId(int $length = 16)
{
if(!isset($length) || intval($length) <= 8 ){
$length = 16;
}
if (function_exists('random_bytes')) {
return bin2hex(random_bytes($length));
}
if (function_exists('mcrypt_create_iv')) {
return bin2hex(mcrypt_create_iv($length, MCRYPT_DEV_URANDOM));
}
if (function_exists('openssl_random_pseudo_bytes')) {
return bin2hex(openssl_random_pseudo_bytes($length));
}
// if everything else fails, use unsafe fallback
return md5(uniqid(microtime(), 1));
}
/**
* compare of froxlor versions
*

View File

@@ -157,7 +157,7 @@ class FroxlorLogger
echo "[" . $this->getLogLevelDesc($type) . "] " . $text . PHP_EOL;
}
// warnings, errors and critical mesages WILL be logged
// warnings, errors and critical messages WILL be logged
if (Settings::Get('logger.log_cron') == '0' && $action == \Froxlor\FroxlorLogger::CRON_ACTION && $type > LOG_WARNING) {
return;
}

View File

@@ -241,10 +241,14 @@ class PhpHelper
$ips = array();
foreach ($dns as $record) {
if ($record["type"] == "A") {
$ips[] = $record["ip"];
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($record["ip"]));
$ips[] = $ip;
}
if ($record["type"] == "AAAA") {
$ips[] = $record["ipv6"];
// always use compressed ipv6 format
$ip = inet_ntop(inet_pton($record["ipv6"]));
$ips[] = $ip;
}
}
if (count($ips) < 1) {

View File

@@ -16,9 +16,9 @@ use Froxlor\Database\Database;
* @author Froxlor team <team@froxlor.org> (2018-)
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
* @package Classes
*
*
* @since 0.9.39
*
*
*/
/**
@@ -60,6 +60,13 @@ class SImExporter
public static function export()
{
$settings_definitions = [];
foreach (\Froxlor\PhpHelper::loadConfigArrayDir('./actions/admin/settings/')['groups'] AS $group) {
foreach ($group['fields'] AS $field) {
$settings_definitions[$field['settinggroup']][$field['varname']] = $field;
}
}
$result_stmt = Database::query("
SELECT * FROM `" . TABLE_PANEL_SETTINGS . "` ORDER BY `settingid` ASC
");
@@ -69,13 +76,26 @@ class SImExporter
if (! in_array($index, self::$no_export)) {
$_data[$index] = $row['value'];
}
if (array_key_exists($row['settinggroup'], $settings_definitions) && array_key_exists($row['varname'], $settings_definitions[$row['settinggroup']])) {
// Export image file
if ($settings_definitions[$row['settinggroup']][$row['varname']]['type'] === "image") {
if ($row['value'] === "") {
continue;
}
$_data[$index.'.image_data'] = base64_encode(file_get_contents(explode('?', $row['value'], 2)[0]));
}
}
}
// add checksum for validation
$_data['_sha'] = sha1(var_export($_data, true));
$_export = json_encode($_data, JSON_PRETTY_PRINT | JSON_UNESCAPED_SLASHES);
if (! $_export) {
throw new \Exception("Error exporting settings: " . json_last_error_msg());
}
return $_export;
}
@@ -98,7 +118,7 @@ class SImExporter
if ($_sha != sha1(var_export($_data, true))) {
throw new \Exception("SHA check of import data failed. Unable to import.");
}
// do not import version info - but we need that to possibily update settings
// do not import version info - but we need that to possibly update settings
// when there were changes in the variable-name or similar
unset($_data['panel.version']);
unset($_data['panel.db_version']);
@@ -120,6 +140,26 @@ class SImExporter
}
// store new data
foreach ($_data as $index => $value) {
$index_split = explode('.', $index, 3);
// Catch image_data and save it
if (isset($index_split[2]) && $index_split[2] === 'image_data' && !empty($_data[$index_split[0].'.'.$index_split[1]])) {
$path = \Froxlor\Froxlor::getInstallDir().'/img/';
if (!is_dir($path) && !mkdir($path, '0775')) {
throw new \Exception("img directory does not exist and cannot be created");
}
// Make sure we can write to the upload directory
if (!is_writable($path)) {
if (!chmod($path, '0775')) {
throw new \Exception("Cannot write to img directory");
}
}
file_put_contents(\Froxlor\Froxlor::getInstallDir() . '/' . explode('?', $_data[$index_split[0].'.'.$index_split[1]], 2)[0], base64_decode($value));
continue;
}
Settings::Set($index, $value);
}
// save to DB

View File

@@ -367,4 +367,67 @@ class Store
return $returnvalue;
}
public static function storeSettingImage($fieldname, $fielddata)
{
if (isset($fielddata['settinggroup'], $fielddata['varname']) && is_array($fielddata) && $fielddata['settinggroup'] !== '' && $fielddata['varname'] !== '') {
$save_to = null;
$path = \Froxlor\Froxlor::getInstallDir().'/img/';
// New file?
if (isset($_FILES[$fieldname]) && $_FILES[$fieldname]['tmp_name']) {
// Make sure upload directory exists
if (!is_dir($path) && !mkdir($path, '0775')) {
throw new \Exception("img directory does not exist and cannot be created");
}
// Make sure we can write to the upload directory
if (!is_writable($path)) {
if (!chmod($path, '0775')) {
throw new \Exception("Cannot write to img directory");
}
}
// Make sure mime-type matches an image
if (!in_array(mime_content_type($_FILES[$fieldname]['tmp_name']), ['image/jpeg','image/jpg','image/png','image/gif'])) {
throw new \Exception("Uploaded file not a valid image");
}
// Determine file extension
$spl = explode('.', $_FILES[$fieldname]['name']);
$file_extension = strtolower(array_pop($spl));
unset($spl);
// Move file
if (!move_uploaded_file($_FILES[$fieldname]['tmp_name'], $path.$fielddata['image_name'].'.'.$file_extension)) {
throw new \Exception("Unable to save image to img folder");
}
$save_to = 'img/'.$fielddata['image_name'].'.'.$file_extension.'?v='.time();
}
// Delete file?
if ($fielddata['value'] !== "" && array_key_exists($fieldname.'_delete', $_POST) && $_POST[$fieldname.'_delete']) {
@unlink(\Froxlor\Froxlor::getInstallDir() . '/' . explode('?', $fielddata['value'], 2)[0]);
$save_to = '';
}
// Nothing changed
if ($save_to === null) {
return array(
$fielddata['settinggroup'] . '.' . $fielddata['varname'] => $fielddata['value']
);
}
if (Settings::Set($fielddata['settinggroup'] . '.' . $fielddata['varname'], $save_to) === false) {
return false;
}
return array(
$fielddata['settinggroup'] . '.' . $fielddata['varname'] => $save_to
);
}
return false;
}
}

View File

@@ -59,20 +59,20 @@ class Crypt
}
/**
* Make crypted password from clear text password
* Make encrypted password from clear text password
*
* @author Michal Wojcik <m.wojcik@sonet3.pl>
* @author Michael Kaufmann <mkaufmann@nutime.de>
* @author Froxlor team <team@froxlor.org> (2010-)
*
* 0 - default crypt (depenend on system configuration)
* 0 - default crypt (depends on system configuration)
* 1 - MD5 $1$
* 2 - BLOWFISH $2y$07$
* 3 - SHA-256 $5$ (default)
* 4 - SHA-512 $6$
*
* @param string $password
* Password to be crypted
* Password to be encrypted
* @param bool $htpasswd
* optional whether to generate a SHA1 password for directory protection
*

View File

@@ -7,7 +7,7 @@ class Mailer extends \PHPMailer\PHPMailer\PHPMailer
{
/**
* class construtor
* class constructor
*
* @param string $exceptions
* whether to throw exceptions or not

View File

@@ -52,6 +52,12 @@ class Data
return $newfieldvalue;
}
public static function getFormFieldDataImage($fieldname, $fielddata, $input)
{
// We always make the system think we have new data to trigger the save function where we actually check everything
return time();
}
public static function manipulateFormFieldDataDate($fieldname, $fielddata, $newfieldvalue)
{
if (isset($fielddata['date_timestamp']) && $fielddata['date_timestamp'] === true) {

View File

@@ -89,6 +89,15 @@ class Fields
return $returnvalue;
}
public static function getFormFieldOutputImage($fieldname, $fielddata, $do_show = true)
{
global $lng;
$label = $fielddata['label'];
$value = htmlentities($fielddata['value']);
eval("\$returnvalue = \"" . \Froxlor\UI\Template::getTemplate("formfields/image", true) . "\";");
return $returnvalue;
}
public static function getFormFieldOutputDate($fieldname, $fielddata, $do_show = true)
{
if (isset($fielddata['date_timestamp']) && $fielddata['date_timestamp'] === true) {

View File

@@ -77,7 +77,7 @@ class User
}
/**
* Function which updates all counters of used ressources in panel_admins and panel_customers
* Function which updates all counters of used resources in panel_admins and panel_customers
*
* @param bool $returndebuginfo
* Set to true to get an array with debug information
@@ -237,7 +237,7 @@ class User
$admin_domains = Database::pexecute_first($admin_domains_stmt, array(
"aid" => $admin['adminid']
));
// substract the amount of domains that are std-subdomains later when we iterated through all customers and know for sure
// subtract the amount of domains that are std-subdomains later when we iterated through all customers and know for sure
$admin['domains_used_new'] = $admin_domains['number_domains'];
// set current admin
$cur_adm = $admin['adminid'];

View File

@@ -74,7 +74,7 @@ class Check
public static function checkMysqlAccessHost($fieldname, $fielddata, $newfieldvalue, $allnewfieldvalues)
{
$mysql_access_host_array = array_map('trim', explode(',', $newfieldvalue));
$mysql_access_host_array = array_unique(array_map('trim', explode(',', $newfieldvalue)));
foreach ($mysql_access_host_array as $host_entry) {
if (Validate::validate_ip2($host_entry, true, 'invalidip', true, true, true, true, false) == false && Validate::validateDomain($host_entry) == false && Validate::validateLocalHostname($host_entry) == false && $host_entry != '%') {
@@ -207,4 +207,30 @@ class Check
}
return $returnvalue;
}
public static function checkLocalGroup($fieldname, $fielddata, $newfieldvalue, $allnewfieldvalues)
{
if (empty($newfieldvalue) || $fielddata == $newfieldvalue) {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_OK
];
} elseif (function_exists('posix_getgrnam') && posix_getgrnam($newfieldvalue) == false) {
if (Validate::validateUsername($newfieldvalue, Settings::Get('panel.unix_names'), 32)) {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_OK
];
} else {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_ERROR,
'local_group_invalid'
];
}
} else {
$returnvalue = [
self::FORMFIELDS_PLAUSIBILITY_CHECK_ERROR,
'local_group_exists'
];
}
return $returnvalue;
}
}

View File

@@ -382,13 +382,12 @@ exit "$RETVAL"
</daemon>
<daemon name="powerdns" title="PowerDNS (standalone)">
<install><![CDATA[apt-get install pdns-server pdns-backend-mysql]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -907,7 +906,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# mysql-settings / you need to create the power-dns database for yourself!
launch=gmysql
@@ -917,6 +916,8 @@ gmysql-dbname=pdns
gmysql-user=powerdns
gmysql-group=client
gmysql-password=
#gmysql-ssl-ca-file=
#gmysql-ssl-verify-server-certificate=0
]]>
</content>
</file>
@@ -925,13 +926,12 @@ gmysql-password=
<daemon name="powerdns_bind"
title="PowerDNS via bind-backend">
<install><![CDATA[apt-get install pdns-server]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1451,7 +1451,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# Bind backend configuration
@@ -2228,7 +2228,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2642,7 +2642,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2745,7 +2745,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3707,7 +3707,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3877,6 +3877,15 @@ plugin {
# (Currently only relevant for ManageSieve)
#sieve_quota_max_storage = 0
}
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
@@ -3965,7 +3974,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3990,7 +3999,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4237,7 +4246,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4295,7 +4304,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4595,7 +4604,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

File diff suppressed because it is too large Load Diff

View File

@@ -371,13 +371,12 @@ exit "$RETVAL"
</daemon>
<daemon name="powerdns" title="PowerDNS (standalone)">
<install><![CDATA[apt-get install pdns-server pdns-backend-mysql]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -881,7 +880,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# mysql-settings / you need to create the power-dns database for yourself!
launch=gmysql
@@ -891,6 +890,8 @@ gmysql-dbname=pdns
gmysql-user=powerdns
gmysql-group=client
gmysql-password=
#gmysql-ssl-ca-file=
#gmysql-ssl-verify-server-certificate=0
]]>
</content>
</file>
@@ -899,13 +900,12 @@ gmysql-password=
<daemon name="powerdns_bind"
title="PowerDNS via bind-backend">
<install><![CDATA[apt-get install pdns-server]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1410,7 +1410,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# Bind backend configuration
@@ -2187,7 +2187,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2707,7 +2707,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM mail_users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -4079,6 +4079,15 @@ plugin {
# the source line numbers.
#sieve_trace_addresses = no
}
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
@@ -4167,7 +4176,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -4192,7 +4201,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4439,7 +4448,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4497,7 +4506,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4797,7 +4806,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -226,7 +226,7 @@ query = SELECT gid FROM mail_users WHERE email = '%s'
# FQDN from Froxlor
mydomain = <SERVERNAME>
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
# set myhostname to $mydomain because Froxlor already uses a FQDN
myhostname = $mydomain
mydestination = $myhostname,
@@ -1536,7 +1536,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -1712,6 +1712,15 @@ plugin {
# (Currently only relevant for ManageSieve)
#sieve_quota_max_storage = 0
}
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
@@ -1754,7 +1763,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -1857,8 +1866,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
# FROM users WHERE userid = '%u'
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = SELECT username AS user FROM mail_users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -2237,7 +2245,7 @@ ControlsLog /var/log/proftpd/controls.log
DefaultRoot ~
# Reject rootlogin (just for security)
RootLogin off
# Noo need to require valid shell, because user is virtual
# No need to require valid shell, because user is virtual
RequireValidShell off
</Global>
@@ -2447,7 +2455,7 @@ aliases: files nisplus
</content>
</file>
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
<!-- clear group chache -->
<!-- clear group cache -->
<command><![CDATA[nscd --invalidate=group]]></command>
</daemon>
<!-- Logrotate -->
@@ -2457,7 +2465,7 @@ aliases: files nisplus
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -227,7 +227,7 @@ query = SELECT gid FROM mail_users WHERE email = '%s'
# FQDN from Froxlor
mydomain = <SERVERNAME>
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
# set myhostname to $mydomain because Froxlor already uses a FQDN
myhostname = $mydomain
mydestination = $myhostname,
@@ -1537,7 +1537,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -1713,6 +1713,15 @@ plugin {
# (Currently only relevant for ManageSieve)
#sieve_quota_max_storage = 0
}
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
@@ -1755,7 +1764,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -1859,7 +1868,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = SELECT username AS user FROM mail_users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -2238,7 +2247,7 @@ ControlsLog /var/log/proftpd/controls.log
DefaultRoot ~
# Reject rootlogin (just for security)
RootLogin off
# Noo need to require valid shell, because user is virtual
# No need to require valid shell, because user is virtual
RequireValidShell off
</Global>
@@ -2449,7 +2458,7 @@ aliases: files nisplus
</content>
</file>
<command><![CDATA[systemctl reload-or-restart nscd.service]]></command>
<!-- clear group chache -->
<!-- clear group cache -->
<command><![CDATA[nscd --invalidate=group]]></command>
</daemon>
<!-- Logrotate -->
@@ -2459,7 +2468,7 @@ aliases: files nisplus
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -74,7 +74,7 @@ Alias "/.well-known/acme-challenge" "{{settings.system.letsencryptchallengepath}
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/apache2 restart]]></command>
<command><![CDATA[service apache2 restart]]></command>
</daemon>
<!-- HTTP Lighttpd -->
<daemon name="lighttpd" title="LigHTTPd">
@@ -138,7 +138,7 @@ include_shell "/usr/share/lighttpd/include-conf-enabled.pl"
</command>
<command><![CDATA[lighty-disable-mod cgi]]></command>
<command><![CDATA[lighty-disable-mod fastcgi]]></command>
<command><![CDATA[/etc/init.d/lighttpd restart]]></command>
<command><![CDATA[service lighttpd restart]]></command>
</daemon>
<!-- HTTP Nginx -->
<daemon name="nginx" title="nginx">
@@ -354,7 +354,6 @@ exit "$RETVAL"
</visibility>
<content><![CDATA[/etc/init.d/php-fcgi restart]]></content>
</command>
<command><![CDATA[/etc/init.d/nginx restart]]></command>
</daemon>
</service>
<!--DNS -->
@@ -366,17 +365,16 @@ exit "$RETVAL"
<command><![CDATA[touch {{settings.system.bindconf_directory}}froxlor_bind.conf]]></command>
<command><![CDATA[chown bind:0 {{settings.system.bindconf_directory}}froxlor_bind.conf]]></command>
<command><![CDATA[chmod 0644 {{settings.system.bindconf_directory}}froxlor_bind.conf]]></command>
<command><![CDATA[/etc/init.d/bind9 restart]]></command>
<command><![CDATA[service bind9 restart]]></command>
</daemon>
<daemon name="powerdns" title="PowerDNS (standalone)">
<install><![CDATA[apt-get install pdns-server pdns-backend-mysql]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -895,7 +893,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# mysql-settings / you need to create the power-dns database for yourself!
launch=gmysql
@@ -905,21 +903,22 @@ gmysql-dbname=pdns
gmysql-user=powerdns
gmysql-group=client
gmysql-password=
#gmysql-ssl-ca-file=
#gmysql-ssl-verify-server-certificate=0
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/pdns restart]]></command>
<command><![CDATA[service pdns restart]]></command>
</daemon>
<daemon name="powerdns_bind"
title="PowerDNS via bind-backend">
<install><![CDATA[apt-get install pdns-server]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1439,7 +1438,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# Bind backend configuration
@@ -1455,7 +1454,7 @@ bind-check-interval=180
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/pdns restart]]></command>
<command><![CDATA[service pdns restart]]></command>
</daemon>
</service>
<!-- SMTP services -->
@@ -1578,7 +1577,7 @@ root: root@<SERVERNAME>
</files>
<commands index="3">
<command><![CDATA[newaliases]]></command>
<command><![CDATA[/etc/init.d/postfix restart]]></command>
<command><![CDATA[service postfix restart]]></command>
</commands>
</general>
<!-- postfix with dovecot -->
@@ -2059,7 +2058,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2162,7 +2161,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3124,7 +3123,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3294,12 +3293,21 @@ plugin {
# (Currently only relevant for ManageSieve)
#sieve_quota_max_storage = 0
}
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
</files>
<commands index="1">
<command><![CDATA[/etc/init.d/dovecot restart]]></command>
<command><![CDATA[service dovecot restart]]></command>
</commands>
</general>
<!-- Dovecot with postfix -->
@@ -3382,7 +3390,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3407,7 +3415,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -3654,7 +3662,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -3712,7 +3720,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -3722,7 +3730,7 @@ TLSVerifyClient off
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/proftpd restart]]></command>
<command><![CDATA[service proftpd restart]]></command>
</daemon>
<!-- Pureftpd -->
<daemon name="pureftpd" title="PureFTPd">
@@ -3948,7 +3956,7 @@ UPLOADGID=
]]>
</content>
</file>
<command><![CDATA[/etc/init.d/pure-ftpd-mysql restart]]></command>
<command><![CDATA[service pure-ftpd-mysql restart]]></command>
</daemon>
</service>
<!-- System tools/services -->
@@ -4020,7 +4028,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok
@@ -4088,7 +4096,7 @@ aliases: files
<commands index="5">
<visibility mode="equals" value="apache2">{{settings.system.webserver}}
</visibility>
<command><![CDATA[/etc/init.d/apache2 restart]]></command>
<command><![CDATA[service apache2 restart]]></command>
</commands>
<!-- instead of just restarting apache, we let the cronjob do all the
dirty work -->

View File

@@ -391,14 +391,13 @@ mail IN A <SERVERIP>
</daemon>
<daemon name="powerdns" title="PowerDNS (standalone)">
<install><![CDATA[emerge net-dns/pdns]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
# Autogenerated configuration file template
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -902,7 +901,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# mysql-settings / you need to create the power-dns database for yourself!
launch=gmysql
@@ -912,6 +911,8 @@ gmysql-dbname=pdns
gmysql-user=powerdns
gmysql-group=client
gmysql-password=
#gmysql-ssl-ca-file=
#gmysql-ssl-verify-server-certificate=0
]]>
</content>
</file>
@@ -920,14 +921,13 @@ gmysql-password=
<daemon name="powerdns_bind"
title="PowerDNS via bind-backend">
<install><![CDATA[emerge net-dns/pdns]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
# Autogenerated configuration file template
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1431,7 +1431,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
#local-ipv6=YOUR_IPv6_(if_any)
bind-config=<BIND_CONFIG_PATH>named.conf
@@ -1587,7 +1587,7 @@ sendmail_path = /usr/sbin/sendmail
# FQDN from Froxlor
mydomain = <SERVERNAME>
# set myhostname to $mydomain because Froxlor alrady uses a FQDN
# set myhostname to $mydomain because Froxlor already uses a FQDN
myhostname = $mydomain
mydestination = $myhostname,
@@ -2345,6 +2345,15 @@ plugin {
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
<command><![CDATA[rc-update add dovecot default]]></command>
<command><![CDATA[/etc/init.d/dovecot restart]]></command>
</daemon>
@@ -3762,7 +3771,7 @@ aliases: files
</file>
<command><![CDATA[rc-update add nscd default]]></command>
<command><![CDATA[/etc/init.d/nscd restart]]></command>
<!-- clear group chache -->
<!-- clear group cache -->
<command><![CDATA[nscd --invalidate=group]]></command>
</daemon>
<!-- Logrotate -->
@@ -3772,7 +3781,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -1,7 +1,7 @@
<?xml version="1.0" encoding="UTF-8"?>
<froxlor>
<distribution name="Debian" codename="Stretch"
version="9.x" defaulteditor="/bin/nano">
version="9.x" defaulteditor="/bin/nano" deprecated="true">
<services>
<!-- HTTP -->
<service type="http" title="{{lng.admin.configfiles.http}}">
@@ -371,13 +371,12 @@ exit "$RETVAL"
</daemon>
<daemon name="powerdns" title="PowerDNS (standalone)">
<install><![CDATA[apt-get install pdns-server pdns-backend-mysql]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -896,7 +895,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# mysql-settings / you need to create the power-dns database for yourself!
launch=gmysql
@@ -906,6 +905,8 @@ gmysql-dbname=pdns
gmysql-user=powerdns
gmysql-group=client
gmysql-password=
#gmysql-ssl-ca-file=
#gmysql-ssl-verify-server-certificate=0
]]>
</content>
</file>
@@ -914,13 +915,12 @@ gmysql-password=
<daemon name="powerdns_bind"
title="PowerDNS via bind-backend">
<install><![CDATA[apt-get install pdns-server]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1440,7 +1440,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# Bind backend configuration
@@ -2217,7 +2217,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2631,7 +2631,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2734,7 +2734,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3696,7 +3696,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3866,6 +3866,15 @@ plugin {
# (Currently only relevant for ManageSieve)
#sieve_quota_max_storage = 0
}
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
@@ -3954,7 +3963,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3979,7 +3988,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4226,7 +4235,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4284,7 +4293,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4584,7 +4593,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -382,13 +382,12 @@ exit "$RETVAL"
</daemon>
<daemon name="powerdns" title="PowerDNS (standalone)">
<install><![CDATA[apt-get install pdns-server pdns-backend-mysql]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -907,7 +906,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# mysql-settings / you need to create the power-dns database for yourself!
launch=gmysql
@@ -917,6 +916,8 @@ gmysql-dbname=pdns
gmysql-user=powerdns
gmysql-group=client
gmysql-password=
#gmysql-ssl-ca-file=
#gmysql-ssl-verify-server-certificate=0
]]>
</content>
</file>
@@ -925,13 +926,12 @@ gmysql-password=
<daemon name="powerdns_bind"
title="PowerDNS via bind-backend">
<install><![CDATA[apt-get install pdns-server]]></install>
<file name="/etc/powerdns/pdns.conf" backup="true" chmod="600">
<file name="/etc/powerdns/pdns.conf" backup="true" chown="root:pdns" chmod="640">
<content><![CDATA[
#################################
# allow-axfr-ips Allow zonetransfers only to these subnets
#
# allow-axfr-ips=127.0.0.0/8,::1,<NAMESERVERS_IP>
# add these entries to the list if any speficied: <AXFRSERVERS>
#################################
# allow-dnsupdate-from A global setting to allow DNS updates from these IP ranges.
@@ -1451,7 +1451,7 @@ include-dir=/etc/powerdns/froxlor/
</file>
<command><![CDATA[mkdir -p /etc/powerdns/froxlor/]]></command>
<file name="/etc/powerdns/froxlor/pdns_froxlor.conf"
chown="root:root" chmod="600">
chown="root:pdns" chmod="640">
<content><![CDATA[
# Bind backend configuration
@@ -2228,7 +2228,7 @@ debugger_command =
# >$config_directory/$process_name.$process_id.log & sleep 5
#
# Another possibility is to run gdb under a detached screen session.
# To attach to the screen sesssion, su root and run "screen -r
# To attach to the screen session, su root and run "screen -r
# <id_string>" where <id_string> uniquely matches one of the detached
# sessions (from "screen -list").
#
@@ -2642,7 +2642,7 @@ driver = mysql
# settings, like: host=sql1.host.org host=sql2.host.org
#
# pgsql:
# For available options, see the PostgreSQL documention for the
# For available options, see the PostgreSQL documentation for the
# PQconnectdb function of libpq.
# Use maxconns=n (default 5) to change how many connections Dovecot can
# create to pgsql.
@@ -2745,7 +2745,7 @@ user_query = SELECT CONCAT(homedir, maildir) AS home, CONCAT('maildir:', homedir
password_query = SELECT username AS user, password_enc AS password, CONCAT(homedir, maildir) AS userdb_home, uid AS userdb_uid, gid AS userdb_gid, CONCAT('maildir:', homedir, maildir) AS userdb_mail, CONCAT('*:storage=', quota, 'M') as userdb_quota_rule FROM mail_users WHERE (username = '%u' OR email = '%u') AND ((imap = 1 AND '%Ls' = 'imap') OR (pop3 = 1 AND '%Ls' = 'pop3') OR ((postfix = 'Y' AND '%Ls' = 'smtp') OR (postfix = 'Y' AND '%Ls' = 'sieve')))
# Query to get a list of all usernames.
#iterate_query = SELECT username AS user FROM users
iterate_query = "SELECT username AS user FROM mail_users WHERE (imap = 1 OR pop3 = 1)"
]]>
</content>
</file>
@@ -3707,7 +3707,7 @@ protocol sieve {
#
# If you want UIDL compatibility with other POP3 servers, use:
# UW's ipop3d : %08Xv%08Xu
# Courier : %f or %v-%u (both might be used simultaneosly)
# Courier : %f or %v-%u (both might be used simultaneously)
# Cyrus (<= 2.1.3) : %u
# Cyrus (>= 2.1.4) : %v.%u
# Dovecot v0.99.x : %v.%u
@@ -3877,6 +3877,15 @@ plugin {
# (Currently only relevant for ManageSieve)
#sieve_quota_max_storage = 0
}
]]>
</content>
</file>
<file name="/etc/dovecot/conf.d/90-quota.conf" chown="root:0"
chmod="0644" backup="true">
<content><![CDATA[
plugin {
quota = maildir:User quota
}
]]>
</content>
</file>
@@ -3965,7 +3974,7 @@ Port 21
# PassivePorts 49152 65534
# If your host was NATted, this option is useful in order to
# allow passive tranfers to work. You have to use your public
# allow passive transfers to work. You have to use your public
# address and opening the passive ports used on your firewall as well.
# MasqueradeAddress 1.2.3.4
@@ -3990,7 +3999,7 @@ Group nogroup
# Umask 022 is a good standard umask to prevent new files and dirs
# (second parm) from being group and world writable.
Umask 022 022
# Normally, we want files to be overwriteable.
# Normally, we want files to be overwritable.
AllowOverwrite on
# Uncomment this if you are using NIS or LDAP via NSS to retrieve passwords:
@@ -4237,7 +4246,7 @@ SQLBackend mysql
SQLEngine on
SQLAuthenticate on
#
# Use both a crypted or plaintext password
# Use both an encrypted or plaintext password
SQLAuthTypes Crypt
SQLAuthenticate users* groups*
@@ -4295,7 +4304,7 @@ TLSVerifyClient off
#TLSRequired on
# Allow SSL/TLS renegotiations when the client requests them, but
# do not force the renegotations. Some clients do not support
# do not force the renegotiations. Some clients do not support
# SSL/TLS renegotiations; when mod_tls forces a renegotiation, these
# clients will close the data connection, or there will be a timeout
# on an idle data connection.
@@ -4595,7 +4604,7 @@ aliases: files
chmod="0644">
<content><![CDATA[
#
# Froxlor logrotate snipet
# Froxlor logrotate snippet
#
<CUSTOMER_LOGS>*.log {
missingok

View File

@@ -37,7 +37,7 @@ return array(
)
),
'value' => array(
'1'
\Froxlor\Settings::Get('system.createstdsubdom_default')
)
),
'store_defaultindex' => array(

View File

@@ -179,6 +179,18 @@ return array(
'cols' => 80,
'rows' => 20,
'value' => $result['phpsettings']
),
'allow_all_customers' => array(
'label' => $lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'],
'desc' => $lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'],
'type' => 'checkbox',
'values' => array(
array(
'label' => $lng['panel']['yes'],
'value' => '1'
)
),
'value' => array()
)
)
)

View File

@@ -187,6 +187,18 @@ return array(
'cols' => 80,
'rows' => 20,
'value' => $result['phpsettings']
),
'allow_all_customers' => array(
'label' => $lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'],
'desc' => $lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'],
'type' => 'checkbox',
'values' => array(
array(
'label' => $lng['panel']['yes'],
'value' => '1'
)
),
'value' => array()
)
)
)

View File

@@ -1,5 +1,7 @@
<?php
use Froxlor\Settings;
/**
* This file is part of the Froxlor project.
* Copyright (c) 2010 the Froxlor Team (see authors).
@@ -22,6 +24,11 @@ return array(
'title' => $lng['mysql']['database_create'],
'image' => 'icons/mysql_add.png',
'fields' => array(
'custom_suffix' => array(
'visible' => (strtoupper(Settings::Get('customer.mysqlprefix')) == 'DBNAME') ? true : false,
'label' => $lng['mysql']['databasename'],
'type' => 'text'
),
'description' => array(
'label' => $lng['mysql']['databasedescription'],
'type' => 'text'

View File

@@ -103,7 +103,7 @@ unset($_);
unset($value);
unset($key);
$filename = htmlentities(basename($_SERVER['PHP_SELF']));
$filename = htmlentities(basename($_SERVER['SCRIPT_NAME']));
// check whether the userdata file exists
if (! file_exists(\Froxlor\Froxlor::getInstallDir() . '/lib/userdata.inc.php')) {
@@ -161,7 +161,9 @@ $idna_convert = new \Froxlor\Idna\IdnaWrapper();
/**
* If Froxlor was called via HTTPS -> enforce it for the next time by settings HSTS header according to settings
*/
$is_ssl = false;
if (isset($_SERVER['HTTPS']) && (strtolower($_SERVER['HTTPS']) != 'off')) {
$is_ssl = true;
$maxage = Settings::Get('system.hsts_maxage');
if (empty($maxage)) {
$maxage = 0;
@@ -217,6 +219,8 @@ if (isset($s) && $s != "" && $nosession != 1) {
ini_set("session.name", "s");
ini_set("url_rewriter.tags", "");
ini_set("session.use_cookies", false);
ini_set("session.cookie_httponly", true);
ini_set("session.cookie_secure", $is_ssl);
session_id($s);
session_start();
$query = "SELECT `s`.*, `u`.* FROM `" . TABLE_PANEL_SESSIONS . "` `s` LEFT JOIN `";
@@ -265,7 +269,7 @@ if (isset($s) && $s != "" && $nosession != 1) {
}
/**
* Language Managament
* Language Management
*/
$langs = array();
$languages = array();
@@ -279,7 +283,7 @@ while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
$langs[$row['language']][] = $row;
// check for row[iso] cause older froxlor
// versions didn't have that and it will
// lead to a lot of undfined variables
// lead to a lot of undefined variables
// before the admin can even update
if (isset($row['iso'])) {
$iso[$row['iso']] = $row['language'];
@@ -380,10 +384,23 @@ if (! array_key_exists('variants', $_themeoptions) || ! array_key_exists($themev
// check for custom header-graphic
$hl_path = 'templates/' . $theme . '/assets/img';
$header_logo = $hl_path . '/logo.png';
if (file_exists($hl_path . '/logo_custom.png')) {
// default is theme-image
$header_logo = $hl_path . '/logo.png';
$header_logo_login = $hl_path . '/logo.png';
if (Settings::Get('panel.logo_overridetheme') == 1 || Settings::Get('panel.logo_overridecustom') == 1) {
// logo settings shall overwrite theme logo and possible custom logo
$header_logo = Settings::Get('panel.logo_image_header') ?: $header_logo;
$header_logo_login = Settings::Get('panel.logo_image_login') ?: $header_logo_login;
}
if (Settings::Get('panel.logo_overridecustom') == 0 && file_exists($hl_path . '/logo_custom.png')) {
// custom theme image (logo_custom.png) is not being overwritten by logo_image_* setting
$header_logo = $hl_path . '/logo_custom.png';
$header_logo_login = $hl_path . '/logo_custom.png';
if (file_exists($hl_path . '/logo_custom_login.png')) {
$header_logo_login = $hl_path . '/logo_custom_login.png';
}
}
/**

2096
lng/czech.lng.php Normal file

File diff suppressed because it is too large Load Diff

View File

@@ -558,10 +558,6 @@ $lng['traffic']['sumhttp'] = 'Samenvatting HTTP-verkeer in';
$lng['traffic']['sumftp'] = 'Samenvatting FTP-verkeer in';
$lng['traffic']['summail'] = 'Samenvatting Mail-verkeer in';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Zoekmachines toestaan uw Froxlor-installatie te indexeren';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Instellingen voor logs';
@@ -591,7 +587,7 @@ $lng['panel']['reseller'] = 'wederverkoper';
$lng['panel']['admin'] = 'beheerder';
$lng['panel']['customer'] = 'klant(en)';
$lng['error']['nomessagetosend'] = 'U hebt geen bericht opgegeven.';
$lng['error']['noreceipientsgiven'] = 'U hebt geen ontvanger opgegeven';
$lng['error']['norecipientsgiven'] = 'U hebt geen ontvanger opgegeven';
$lng['admin']['emaildomain'] = 'Emaildomein';
$lng['admin']['email_only'] = 'Alleen email?';
$lng['admin']['wwwserveralias'] = 'Voeg een "www." ServerAlias toe';
@@ -599,14 +595,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Is dit een SSL-poort?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Pad naar SSL-certificaat';
$lng['panel']['send'] = 'verzenden';
$lng['admin']['subject'] = 'Onderwerp';
$lng['admin']['receipient'] = 'Ontvanger';
$lng['admin']['recipient'] = 'Ontvanger';
$lng['admin']['message'] = 'Bericht schrijven';
$lng['admin']['text'] = 'Bericht';
$lng['menu']['message'] = 'Berichten';
$lng['error']['errorsendingmail'] = 'Het versturen van het bericht naar "%s" is mislukt';
$lng['error']['cannotreaddir'] = 'De map "%s" kan niet gelezen worden';
$lng['message']['success'] = 'Bericht verzonden naar ontvangers %s';
$lng['message']['noreceipients'] = 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn';
$lng['message']['norecipients'] = 'Er is geen email verstuurd omdat er geen ontvangers in de database zijn';
$lng['admin']['sslsettings'] = 'Instellingen voor SSL';
$lng['cronjobs']['notyetrun'] = 'Nog niet uitgevoerd';
$lng['serversettings']['default_vhostconf']['title'] = 'Standaard vhost-instellingen';

View File

@@ -332,7 +332,7 @@ $lng['serversettings']['session_timeout']['description'] = 'How long does a user
$lng['serversettings']['accountprefix']['title'] = 'Customer prefix';
$lng['serversettings']['accountprefix']['description'] = 'Which prefix should customer accounts have?';
$lng['serversettings']['mysqlprefix']['title'] = 'SQL Prefix';
$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix';
$lng['serversettings']['mysqlprefix']['description'] = 'Which prefix should MySQL accounts have?</br>Use "RANDOM" as value to get a 3-digit random prefix</br>Use "DBNAME" as the value, a database name field is used together with the customer name as a prefix.';
$lng['serversettings']['ftpprefix']['title'] = 'FTP Prefix';
$lng['serversettings']['ftpprefix']['description'] = 'Which prefix should ftp accounts have?<br/><b>If you change this you also have to change the Quota SQL Query in your FTP Server config file in case you use it!</b> ';
$lng['serversettings']['documentroot_prefix']['title'] = 'Home directory';
@@ -626,10 +626,6 @@ $lng['traffic']['sumhttp'] = 'Total HTTP-Traffic';
$lng['traffic']['sumftp'] = 'Total FTP-Traffic';
$lng['traffic']['summail'] = 'Total Mail-Traffic';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Allow searchengine-robots to index your Froxlor installation';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Log settings';
@@ -664,7 +660,7 @@ $lng['panel']['reseller'] = 'reseller';
$lng['panel']['admin'] = 'admin';
$lng['panel']['customer'] = 'customer/s';
$lng['error']['nomessagetosend'] = 'You did not enter a message.';
$lng['error']['noreceipientsgiven'] = 'You did not specify any recipient';
$lng['error']['norecipientsgiven'] = 'You did not specify any recipient';
$lng['admin']['emaildomain'] = 'Emaildomain';
$lng['admin']['email_only'] = 'Only email?';
$lng['admin']['wwwserveralias'] = 'Add a "www." ServerAlias';
@@ -672,14 +668,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Is this an SSL Port?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Path to the SSL Certificate';
$lng['panel']['send'] = 'send';
$lng['admin']['subject'] = 'Subject';
$lng['admin']['receipient'] = 'Recipient';
$lng['admin']['recipient'] = 'Recipient';
$lng['admin']['message'] = 'Write a Message';
$lng['admin']['text'] = 'Message';
$lng['menu']['message'] = 'Messages';
$lng['error']['errorsendingmail'] = 'The message to "%s" failed';
$lng['error']['cannotreaddir'] = 'Unable to read directory "%s"';
$lng['message']['success'] = 'Successfully sent message to %s recipients';
$lng['message']['noreceipients'] = 'No e-mail has been sent because there are no recipients in the database';
$lng['message']['norecipients'] = 'No e-mail has been sent because there are no recipients in the database';
$lng['admin']['sslsettings'] = 'SSL settings';
$lng['cronjobs']['notyetrun'] = 'Not yet run';
$lng['serversettings']['default_vhostconf']['title'] = 'Default vHost-settings';
@@ -930,7 +926,7 @@ $lng['admin']['ipsandports']['default_vhostconf_domain'] = 'Default vHost-settin
$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Path to the SSL Keyfile';
$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specify the path including the filename for the private-key file (.key mostly)';
$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Path to the SSL CA certificate (optional)';
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentification, set this only if you know what it is.';
$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Client authentication, set this only if you know what it is.';
$lng['error']['usernamealreadyexists'] = 'The username %s already exists.';
@@ -1600,12 +1596,14 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Allow admins to chan
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Allow customers to change the theme';
$lng['serversettings']['axfrservers']['title'] = 'AXFR servers';
$lng['serversettings']['axfrservers']['description'] = 'A comma separated list of IP addresses allowed to transfer (AXFR) dns zones.';
$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode';
$lng['serversettings']['powerdns_mode']['description'] = 'Select the PoweDNS mode: Native for no replication (Default) / Master if DNS replication is needed.';
$lng['panel']['ssleditor'] = 'SSL settings for this domain';
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Paste your complete certificate content in the textbox';
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Content of the ssl certificate';
$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Content of the ssl (private-) key file';
$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Content of the ssl CA file (optional)';
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentification, set this only if you know what it is.';
$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Client authentication, set this only if you know what it is.';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Content of the certificate chain file (optional)';
$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Mostly CA_Bundle, or similar, you probably want to set this if you bought a SSL certificate.';
$lng['error']['sslcertificateismissingprivatekey'] = 'You need to specify a private key for your certificate';
@@ -1615,7 +1613,7 @@ $lng['error']['sslcertificateinvalidcertkeypair'] = 'The given private-key does
$lng['error']['sslcertificateinvalidca'] = 'The given CA certificate data does not seem to be a valid certificate';
$lng['error']['sslcertificateinvalidchain'] = 'The given certificate chain data does not seem to be a valid certificate';
$lng['serversettings']['customerssl_directory']['title'] = 'Webserver customer-ssl certificates-directory';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regulary so avoid storing data in there manually.</div>';
$lng['serversettings']['customerssl_directory']['description'] = 'Where should customer-specified ssl-certificates be created?<br /><br /><div class="red">NOTE: This folder\'s content gets deleted regularly so avoid storing data in there manually.</div>';
$lng['admin']['phpfpm.ininote'] = 'Not all values you may want to define can be used in the php-fpm pool configuration';
// Added in Froxlor 0.9.30
@@ -1832,15 +1830,15 @@ $lng['opcacheinfo']['false'] = '<i>false</i>';
// Added for let's encrypt
$lng['admin']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled. This feature is still in beta.';
$lng['admin']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> If wildcards are enabled, this option will automatically be disabled.';
$lng['customer']['letsencrypt']['title'] = 'Use Let\'s Encrypt';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.<br><strong class="red">ATTENTION:</strong> This feature is still in beta.';
$lng['customer']['letsencrypt']['description'] = 'Get a free certificate from <a href="https://letsencrypt.org">Let\'s Encrypt</a>. The certificate will be created and renewed automatically.';
$lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using Let\'s Encrypt is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt cannot handle wildcard-domains using ACME in froxlor (requires dns-challenge), sorry. Please set the ServerAlias to WWW or disable it completely';
$lng['panel']['letsencrypt'] = 'Using Let\'s encrypt';
$lng['crondesc']['cron_letsencrypt'] = 'updating Let\'s Encrypt certificates';
$lng['serversettings']['letsencryptca']['title'] = "Let's Encrypt environment";
$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt certificates.";
$lng['serversettings']['letsencryptca']['title'] = "ACME environment";
$lng['serversettings']['letsencryptca']['description'] = "Environment to be used for Let's Encrypt / ZeroSSL certificates.";
$lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt country code";
$lng['serversettings']['letsencryptcountrycode']['description'] = "2 letter country code used to generate Let's Encrypt certificates.";
$lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt state";
@@ -1922,7 +1920,7 @@ $lng['dnseditor']['records'] = 'records';
$lng['error']['dns_notfoundorallowed'] = 'Domain not found or no permission';
$lng['serversettings']['dnseditorenable']['title'] = 'Enable DNS editor';
$lng['serversettings']['dnseditorenable']['description'] = 'Allows admins and customer to manage domain dns entries';
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are prefered, only missing entries will be automatically generated.';
$lng['dns']['howitworks'] = 'Here you can manage DNS entries for your domain. Note that froxlor will automatically generate NS/MX/A/AAAA records for you. The custom entries are preferred, only missing entries will be automatically generated.';
$lng['serversettings']['dns_server']['title'] = 'DNS server daemon';
$lng['serversettings']['dns_server']['description'] = 'Remember that daemons have to be configured using froxlors configuration templates';
@@ -1997,7 +1995,7 @@ $lng['serversettings']['leapiversion']['title'] = "Choose Let's Encrypt ACME imp
$lng['serversettings']['leapiversion']['description'] = "Currently only ACME v2 implementation for Let's Encrypt is supported.";
$lng['admin']['phpsettings']['pass_authorizationheader'] = 'Add "-pass-header Authorization" / "CGIPassAuth On" to vhosts';
$lng['serversettings']['ssl']['ssl_protocols']['title'] = 'Configure the TLS protocol version';
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protcol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
$lng['serversettings']['ssl']['ssl_protocols']['description'] = 'This is a list of ssl protocols that you want (or don\'t want) to use when using SSL. <b>Notice:</b> Some older browsers may not support the newest protocol versions.<br /><br /><b>Default value is:</b><pre>TLSv1.2</pre>';
$lng['serversettings']['phpfpm_settings']['limit_extensions']['title'] = 'Allowed extensions';
$lng['serversettings']['phpfpm_settings']['limit_extensions']['description'] = 'Limits the extensions of the main script FPM will allow to parse. This can prevent configuration mistakes on the web server side. You should only limit FPM to .php extensions to prevent malicious users to use other extensions to execute php code. Default value: .php';
$lng['phpfpm']['ini_flags'] = 'Enter possible <strong>php_flag</strong>s for php.ini. One entry per line';
@@ -2116,3 +2114,24 @@ $lng['serversettings']['terms_url']['description'] = 'Specify an URL to your ter
$lng['privacy'] = 'Privacy policy';
$lng['serversettings']['privacy_url']['title'] = 'URL to privacy policy';
$lng['serversettings']['privacy_url']['description'] = 'Specify an URL to your privacy policy site / imprint site. The link will be visible on the login screen and on the footer when logged in.';
$lng['admin']['domaindefaultalias'] = 'Default ServerAlias value for new domains';
$lng['serversettings']['logo_image_header']['title'] = 'Logo Image (Header)';
$lng['serversettings']['logo_image_header']['description'] = 'Upload your own logo image to be shown in the header after login (recommended height 30px)';
$lng['serversettings']['logo_image_login']['title'] = 'Logo Image (Login)';
$lng['serversettings']['logo_image_login']['description'] = 'Upload your own logo image to be shown during login';
$lng['panel']['image_field_delete'] = 'Delete the existing current image';
$lng['serversettings']['logo_overridetheme']['title'] = 'Overwrites logo defined in theme by "Logo Image" (Header and Login, see below)';
$lng['serversettings']['logo_overridetheme']['description'] = 'This needs to be set to "true" if you intend to use your uploaded logo; alternatively you can still use the theme-based "logo_custom.png" and "logo_custom_login.png" possibility.';
$lng['serversettings']['logo_overridecustom']['title'] = 'Overwrite custom logo (logo_custom.png and logo_custom_login.png) defined in theme by "Logo Image" (Header and Login, see below)';
$lng['serversettings']['logo_overridecustom']['description'] = 'Set this to "true" if you want to ignore theme-specific custom logos for header and login and use "Logo Image"';
$lng['serversettings']['createstdsubdom_default']['title'] = 'Preselected value for "'.$lng['admin']['stdsubdomain_add'].'" when creating a customer';
$lng['serversettings']['froxlorusergroup']['title'] = 'Custom system group for all customer users';
$lng['serversettings']['froxlorusergroup']['description'] = 'Usage of libnss-extrausers (system-settings) is required for this to take effect. An empty value skips creation or removes existing group.';
$lng['error']['local_group_exists'] = 'The given group already exists on the system.';
$lng['error']['local_group_invalid'] = 'The given group name is invalid';
$lng['error']['invaliddnsforletsencrypt'] = 'The domains DNS does not include any of the chosen IP addresses. Let\'s Encrypt certificate generation not possible.';
$lng['error']['notallowedphpconfigused'] = 'Trying to use php-config which is not assigned to customer';
$lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'] = 'Assign this configuration to all currently existing customers';
$lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'] = 'Set this to "true" if you want to assign this configuration to all currently existing customers so it can be used by them. This setting is not permanent but can be run multiple times.';

View File

@@ -598,10 +598,6 @@ $lng['traffic']['sumhttp'] = 'Trafic HTTP total entrant';
$lng['traffic']['sumftp'] = 'Trafic FTP total entrant';
$lng['traffic']['summail'] = 'Trafic E-mail total entrant';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Permettre aux robots des moteurs de recherche d\'indexer l\'installation de Froxlor';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Paramètres des logs';
@@ -631,7 +627,7 @@ $lng['panel']['reseller'] = 'revendeur';
$lng['panel']['admin'] = 'administrateur';
$lng['panel']['customer'] = 'client(s)';
$lng['error']['nomessagetosend'] = 'Vous n\'avez pas entré de message.';
$lng['error']['noreceipientsgiven'] = 'Vous n\'avez pas spécifier de destinataire';
$lng['error']['norecipientsgiven'] = 'Vous n\'avez pas spécifier de destinataire';
$lng['admin']['emaildomain'] = 'Domaine e-mail';
$lng['admin']['email_only'] = 'Seulement des e-mails ?';
$lng['admin']['wwwserveralias'] = 'Ajouter un "www." à l\'alias du serveur "ServerAlias"';
@@ -639,14 +635,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Est-ce un port SSL ?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Emplacement du certificat SSL';
$lng['panel']['send'] = 'envoyé';
$lng['admin']['subject'] = 'Sujet';
$lng['admin']['receipient'] = 'Destinataire';
$lng['admin']['recipient'] = 'Destinataire';
$lng['admin']['message'] = 'Ecrire un message';
$lng['admin']['text'] = 'Message';
$lng['menu']['message'] = 'Messages';
$lng['error']['errorsendingmail'] = 'Echec d\'envoi du message à "%s"';
$lng['error']['cannotreaddir'] = 'Impossible de lire dossier "%s"';
$lng['message']['success'] = 'Le message a été envoyé aux destinataires "%s"';
$lng['message']['noreceipients'] = 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données';
$lng['message']['norecipients'] = 'Aucun e-mail n\'a été envoyé car il n\'existe aucun destinataire dans la base de données';
$lng['admin']['sslsettings'] = 'Paramètres SSL';
$lng['cronjobs']['notyetrun'] = 'Pas encore lancé';
$lng['serversettings']['default_vhostconf']['title'] = 'Paramètres par défaut pour les vHosts';

View File

@@ -327,7 +327,7 @@ $lng['serversettings']['session_timeout']['description'] = 'Wie lange muss ein B
$lng['serversettings']['accountprefix']['title'] = 'Kundenpräfix';
$lng['serversettings']['accountprefix']['description'] = 'Welchen Präfix sollen die Kundenaccounts haben?';
$lng['serversettings']['mysqlprefix']['title'] = 'MySQL-Präfix';
$lng['serversettings']['mysqlprefix']['description'] = 'Welchen Präfix sollen die MySQL-Benutzerkonten haben?</br>Mit "RANDOM" als Wert wird ein 3-stelliger Zufallswert als Präfix verwendet.';
$lng['serversettings']['mysqlprefix']['description'] = 'Welchen Präfix sollen die MySQL-Benutzerkonten haben?</br>Mit "RANDOM" als Wert wird ein 3-stelliger Zufallswert als Präfix verwendet.</br>Mit "DBNAME" als Wert wird ein Feld Databankname zusammen mit dem Kundennamen als Präfix genutzt.';
$lng['serversettings']['ftpprefix']['title'] = 'FTP-Präfix';
$lng['serversettings']['ftpprefix']['description'] = 'Welchen Präfix sollen die FTP-Benutzerkonten haben?<br/><b>Falls FTP-Quoatas verwendet werden, ist es notwendig das Quota-SQL-Query in der FTP-Server-Config ebenfalls zu ändern!</b>';
$lng['serversettings']['documentroot_prefix']['title'] = 'Heimatverzeichnis';
@@ -619,10 +619,6 @@ $lng['traffic']['sumhttp'] = 'Gesamt HTTP-Traffic';
$lng['traffic']['sumftp'] = 'Gesamt FTP-Traffic';
$lng['traffic']['summail'] = 'Gesamt Mail-Traffic';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Erlaube die Indizierung Ihrer Froxlor-Installation durch Suchmaschinen';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Log-Einstellungen';
@@ -657,7 +653,7 @@ $lng['panel']['reseller'] = 'Reseller';
$lng['panel']['admin'] = 'Administrator';
$lng['panel']['customer'] = 'Kunde/n';
$lng['error']['nomessagetosend'] = 'Keine Nachricht angegeben';
$lng['error']['noreceipientsgiven'] = 'Keine Empfänger angegeben';
$lng['error']['norecipientsgiven'] = 'Keine Empfänger angegeben';
$lng['admin']['emaildomain'] = 'E-Mail-Domain';
$lng['admin']['email_only'] = 'Nur als E-Mail-Domain verwenden?';
$lng['admin']['wwwserveralias'] = 'Einen "www." ServerAlias hinzufügen';
@@ -665,14 +661,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Ist dies ein SSL-Port?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Pfad zum Zertifikat';
$lng['panel']['send'] = 'Versenden';
$lng['admin']['subject'] = 'Betreff';
$lng['admin']['receipient'] = 'Empfänger';
$lng['admin']['recipient'] = 'Empfänger';
$lng['admin']['message'] = 'Rundmail senden';
$lng['admin']['text'] = 'Nachricht';
$lng['menu']['message'] = 'Nachrichten';
$lng['error']['errorsendingmail'] = 'Das Versenden der Nachricht an "%s" schlug fehl.';
$lng['error']['cannotreaddir'] = 'Der Ordner "%s" kann nicht gelesen werden';
$lng['message']['success'] = 'Nachricht erfolgreich an "%s" Empfänger gesendet';
$lng['message']['noreceipients'] = 'Es wurde keine E-Mail versendet, da sich keine Empfänger in der Datenbank befinden';
$lng['message']['norecipients'] = 'Es wurde keine E-Mail versendet, da sich keine Empfänger in der Datenbank befinden';
$lng['admin']['sslsettings'] = 'SSL-Einstellungen';
$lng['cronjobs']['notyetrun'] = 'Bisher nicht gestartet';
$lng['serversettings']['default_vhostconf']['title'] = 'Standard vHost-Einstellungen';
@@ -1324,6 +1320,8 @@ $lng['serversettings']['panel_allow_theme_change_admin'] = 'Erlaube Admins das T
$lng['serversettings']['panel_allow_theme_change_customer'] = 'Erlaube Kunden das Theme zu wechseln';
$lng['serversettings']['axfrservers']['title'] = 'AXFR Server';
$lng['serversettings']['axfrservers']['description'] = 'Eine durch Kommas getrennte Liste von IP Adressen, die DNS-Zonen transferieren dürfen (AXFR).';
$lng['serversettings']['powerdns_mode']['title'] = 'PowerDNS Operation Mode';
$lng['serversettings']['powerdns_mode']['description'] = 'Wählen Sie den PowerDNS-Modus: Native für keine DNS-Replikation (Standard) / Master wenn eine DNS-Replikation benötigt wird.';
$lng['panel']['ssleditor'] = 'SSL-Einstellungen für diese Domain';
$lng['admin']['ipsandports']['ssl_paste_description'] = 'Bitte den Inhalt der Zertifikatsdatei in das Textfeld kopieren.';
$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Inhalt des SSL-Zertifikats (Certificate)';
@@ -1490,8 +1488,8 @@ $lng['error']['sslredirectonlypossiblewithsslipport'] = 'Die Nutzung von Let\'s
$lng['error']['nowildcardwithletsencrypt'] = 'Let\'s Encrypt kann mittels ACME Wildcard-Domains nur via DNS validieren, sorry. Bitte den ServerAlias auf WWW setzen oder deaktivieren';
$lng['panel']['letsencrypt'] = 'Benutzt Let\'s encrypt';
$lng['crondesc']['cron_letsencrypt'] = 'Aktualisierung der Let\'s Encrypt Zertifikate';
$lng['serversettings']['letsencryptca']['title'] = "Let's Encrypt Umgebung";
$lng['serversettings']['letsencryptca']['description'] = "Let's Encrypt - Umgebung, welche genutzt wird um Zertifikate zu bestellen.";
$lng['serversettings']['letsencryptca']['title'] = "ACME Umgebung";
$lng['serversettings']['letsencryptca']['description'] = "Umgebung, welche genutzt wird um Zertifikate zu bestellen.";
$lng['serversettings']['letsencryptcountrycode']['title'] = "Let's Encrypt Ländercode";
$lng['serversettings']['letsencryptcountrycode']['description'] = "2 - stelliger Ländercode, welcher benutzt wird um Let's Encrypt - Zertifikate zu bestellen.";
$lng['serversettings']['letsencryptstate']['title'] = "Let's Encrypt Bundesland";
@@ -1762,3 +1760,24 @@ $lng['serversettings']['terms_url']['description'] = 'Die URL zur AGB-Seite. Der
$lng['privacy'] = 'Datenschutzerklärung';
$lng['serversettings']['privacy_url']['title'] = 'URL zur Datenschutzerklärung';
$lng['serversettings']['privacy_url']['description'] = 'Die URL zur Datenschutzerklärungs-Seite. Der Link ist auf der Login-Seite und wenn eingeloggt, in der Fußzeile sichtbar.';
$lng['admin']['domaindefaultalias'] = 'Standard ServerAlias-Angabe für neue Domains';
$lng['serversettings']['logo_image_header']['title'] = 'Logo Bild (Header)';
$lng['serversettings']['logo_image_header']['description'] = 'Das hochgeladene Bild wird als Logo oben links nach dem Login angezeigt (empfohlene Höhe sind 30px)';
$lng['serversettings']['logo_image_login']['title'] = 'Logo Bild (Login)';
$lng['serversettings']['logo_image_login']['description'] = 'Das hochgeladene Bild wird als Logo während des Logins angezeigt';
$lng['panel']['image_field_delete'] = 'Das momentan vorhandene Bild löschen';
$lng['serversettings']['logo_overridetheme']['title'] = 'Überschreibe Theme-Logo mit "Logo Bild" (Header und Login, siehe unten)';
$lng['serversettings']['logo_overridetheme']['description'] = 'Ist die Nutzung eines hochgeladenen Logos gewünscht, muss diese Einstellung auf "Ja" gesetzt werden. Alternativ kann weiterhin das Theme-basierte Überschreiben via "logo_custom.png" und "logo_custom_login.png" genutzt werden.';
$lng['serversettings']['logo_overridecustom']['title'] = 'Überschreibe benutzerdefinierte Theme-Logos (logo_custom.png und logo_custom_login.png) mit "Logo Bold" (Header und Login, siehe unten)';
$lng['serversettings']['logo_overridecustom']['description'] = 'Ist diese Einstellung aktiv, werden benutzerdefinierte Logos im Theme-Ordner mit dem "Logo Bild" ersetzt';
$lng['serversettings']['createstdsubdom_default']['title'] = 'Standardwert für "'.$lng['admin']['stdsubdomain_add'].'" bei Erstellung eines Kunden';
$lng['serversettings']['froxlorusergroup']['title'] = 'Benutzerdefinierte Gruppe für alle Kunden-Benutzer';
$lng['serversettings']['froxlorusergroup']['description'] = 'Voraussetzung hierfür ist die Nutzung von libnss-extrausers (System-Einstellungen). Ein leerer Wert bedeutet, es wird keine Gruppe erstellt, bzw. vorhandene Gruppe wird entfernt.';
$lng['error']['local_group_exists'] = 'Die angegebene Gruppe existiert bereits auf dem System';
$lng['error']['local_group_invalid'] = 'Der angegebene Gruppen-Name ist nicht gültig';
$lng['error']['invaliddnsforletsencrypt'] = 'Die DNS-Einträge der Domain enhalten keine der gewählten IP Adressen. Let\'s Encrypt Zertifikats-Erstellung ist nicht möglich.';
$lng['error']['notallowedphpconfigused'] = 'Nutzung einer PHP-Konfiguration welche nicht dem Kunden zugeordnet ist';
$lng['serversettings']['phpfpm_settings']['allow_all_customers']['title'] = 'Für aktuelle Kunden automatisch hinzufügen';
$lng['serversettings']['phpfpm_settings']['allow_all_customers']['description'] = 'Ist diese Einstellung aktiv, wird die Konfiguration automatisch allen aktuell existierenden Kunden-Accounts zugewiesen. Diese Einstellung ist nicht permanent, kann aber mehrfach / nach Bedarf ausgeführt werden.';

View File

@@ -584,10 +584,6 @@ $lng['traffic']['sumhttp'] = 'Sommatoria Traffico in ingresso HTTP';
$lng['traffic']['sumftp'] = 'Sommatoria Traffico in ingresso FTP';
$lng['traffic']['summail'] = 'Sommatoria Traffico in ingresso Mail';
// ADDED IN 1.2.19-svn4.5
$lng['serversettings']['no_robots']['title'] = 'Permetti ai robot dei motori di ricerca di indicizzare l\'installazione di Froxlor';
// ADDED IN 1.2.19-svn6
$lng['admin']['loggersettings'] = 'Impostazioni Log';
@@ -614,7 +610,7 @@ $lng['panel']['reseller'] = 'rivenditore';
$lng['panel']['admin'] = 'amministratore';
$lng['panel']['customer'] = 'cliente/i';
$lng['error']['nomessagetosend'] = 'Non hai inserito un messaggio.';
$lng['error']['noreceipientsgiven'] = 'Non hai specificato alcun destinatario';
$lng['error']['norecipientsgiven'] = 'Non hai specificato alcun destinatario';
$lng['admin']['emaildomain'] = 'Email dominio';
$lng['admin']['email_only'] = 'Solo email?';
$lng['admin']['wwwserveralias'] = 'Aggiungi a "www." ServerAlias';
@@ -622,14 +618,14 @@ $lng['admin']['ipsandports']['enable_ssl'] = 'Questa è una porta SSL?';
$lng['admin']['ipsandports']['ssl_cert_file'] = 'Percorso del certificato SSL (SSL certificate)';
$lng['panel']['send'] = 'invia';
$lng['admin']['subject'] = 'Oggetto';
$lng['admin']['receipient'] = 'Destinatario';
$lng['admin']['recipient'] = 'Destinatario';
$lng['admin']['message'] = 'Scrivi un messaggio';
$lng['admin']['text'] = 'Messaggio';
$lng['menu']['message'] = 'Messaggi';
$lng['error']['errorsendingmail'] = 'Il messaggio a "%s" fallito';
$lng['error']['cannotreaddir'] = 'Impossibile leggere la cartella "%s"';
$lng['message']['success'] = 'Inviato correttamente il messaggio a %s recipients';
$lng['message']['noreceipients'] = 'Nessuna e-mail è stata inviata perch¸ non ci sono i destinatari nel database';
$lng['message']['norecipients'] = 'Nessuna e-mail è stata inviata perch¸ non ci sono i destinatari nel database';
$lng['admin']['sslsettings'] = 'Impostazioni SSL';
$lng['cronjobs']['notyetrun'] = 'Non ancora avviato';
$lng['serversettings']['default_vhostconf']['title'] = 'Impostazioni default vhost';

Some files were not shown because too many files have changed in this diff Show More