setting version to 0.9.29

Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>

.gitignore

@@ -1,2 +1,10 @@
 packages/*
+lib/classes/htmlpurifier/library/HTMLPurifier/DefinitionCache/Serializer/*/
 temp/*
+templates/*
+install/update.log
+.buildpath
+.project
+.settings/
+*.diff
+*~

COPYING

@@ -2,7 +2,7 @@
 		       Version 2, June 1991
 
  Copyright (C) 1989, 1991 Free Software Foundation, Inc.
-                          675 Mass Ave, Cambridge, MA 02139, USA
+                       51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
  Everyone is permitted to copy and distribute verbatim copies
  of this license document, but changing it is not allowed.
 
@@ -55,7 +55,7 @@ patent must be licensed for everyone's free use or not licensed at all.
 
   The precise terms and conditions for copying, distribution and
 modification follow.
-
+
 		    GNU GENERAL PUBLIC LICENSE
    TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
 
@@ -110,7 +110,7 @@ above, provided that you also meet all of these conditions:
     License.  (Exception: if the Program itself is interactive but
     does not normally print such an announcement, your work based on
     the Program is not required to print an announcement.)
-
+
 These requirements apply to the modified work as a whole.  If
 identifiable sections of that work are not derived from the Program,
 and can be reasonably considered independent and separate works in
@@ -168,7 +168,7 @@ access to copy from a designated place, then offering equivalent
 access to copy the source code from the same place counts as
 distribution of the source code, even though third parties are not
 compelled to copy the source along with the object code.
-
+
   4. You may not copy, modify, sublicense, or distribute the Program
 except as expressly provided under this License.  Any attempt
 otherwise to copy, modify, sublicense or distribute the Program is
@@ -225,7 +225,7 @@ impose that choice.
 
 This section is intended to make thoroughly clear what is believed to
 be a consequence of the rest of this License.
-
+
   8. If the distribution and/or use of the Program is restricted in
 certain countries either by patents or by copyrighted interfaces, the
 original copyright holder who places the Program under this License
@@ -278,4 +278,3 @@ PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
 POSSIBILITY OF SUCH DAMAGES.
 
 		     END OF TERMS AND CONDITIONS
-

actions/admin/settings/100.panel.php

@@ -33,7 +33,7 @@ return array(
 					'save_method' => 'storeSettingField',
 					),
 				'panel_default_theme' => array(
-					'label' => $lng['serversettings']['default_theme'],
+					'label' => array('title' => $lng['panel']['theme'], 'description' => $lng['serversettings']['default_theme']),
 					'settinggroup' => 'panel',
 					'varname' => 'default_theme',
 					'type' => 'option',
@@ -42,6 +42,22 @@ return array(
 					'option_options_method' => 'getThemes',
 					'save_method' => 'storeSettingField',
 					),
+				'panel_allow_theme_change_customer' => array(
+					'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
+					'settinggroup' => 'panel',
+					'varname' => 'allow_theme_change_customer',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					),
+				'panel_allow_theme_change_admin' => array(
+					'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
+					'settinggroup' => 'panel',
+					'varname' => 'allow_theme_change_admin',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField'
+					),
 				'panel_natsorting' => array(
 					'label' => $lng['serversettings']['natsorting'],
 					'settinggroup' => 'panel',
@@ -77,6 +93,23 @@ return array(
 					'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']),
 					'save_method' => 'storeSettingField',
 					),
+				'use_webfonts' => array(
+					'label' => $lng['serversettings']['enablewebfonts'],
+					'settinggroup' => 'panel',
+					'varname' => 'use_webfonts',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					),
+				'webfont' => array(
+					'label' => $lng['serversettings']['definewebfont']['title'],
+					'settinggroup' => 'panel',
+					'varname' => 'webfont',
+					'type' => 'string',
+					'default' => 'Numans',
+					'string_emptyallowed' => false,
+					'save_method' => 'storeSettingField',
+					),
 				'panel_adminmail' => array(
 					'label' => $lng['serversettings']['adminmail'],
 					'settinggroup' => 'panel',
@@ -177,6 +210,14 @@ return array(
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
+				'panel_phpconfigs_hidestdsubdomain' => array(
+					'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
+					'settinggroup' => 'panel',
+					'varname' => 'phpconfigs_hidestdsubdomain',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					),
 				),
 			),
 		),

actions/admin/settings/120.system.php

@@ -32,6 +32,14 @@ return array(
 					'save_method' => 'storeSettingField',
 					'plausibility_check_method' => 'checkPathConflicts'
 					),
+				'system_documentroot_use_default_value' => array(
+					'label' => $lng['serversettings']['documentroot_use_default_value'],
+					'settinggroup' => 'system',
+					'varname' => 'documentroot_use_default_value',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					),
 				'system_ipaddress' => array(
 					'label' => $lng['serversettings']['ipaddress'],
 					'settinggroup' => 'system',
@@ -138,7 +146,7 @@ return array(
 					'varname' => 'report_webmax',
 					'type' => 'int',
 					'int_min' => 1,
-					'int_max' => 99,
+					'int_max' => 150,
 					'default' => 90,
 					'save_method' => 'storeSettingField',
 					),
@@ -148,7 +156,7 @@ return array(
 					'varname' => 'report_trafficmax',
 					'type' => 'int',
 					'int_min' => 1,
-					'int_max' => 99,
+					'int_max' => 150,
 					'default' => 90,
 					'save_method' => 'storeSettingField',
 					),
@@ -159,7 +167,7 @@ return array(
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
-					),					
+					),
 				),
 			),
 		),

actions/admin/settings/130.webserver.php

@@ -33,6 +33,15 @@ return array(
 					'save_method' => 'storeSettingField',
 					'overview_option' => true
 					),
+				'system_apache_24' => array(
+					'label' => $lng['serversettings']['apache_24'],
+					'settinggroup' => 'system',
+					'varname' => 'apache24',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
 				'system_httpuser' => array(
 					'label' => $lng['admin']['webserver_user'],
 					'settinggroup' => 'system',
@@ -85,6 +94,15 @@ return array(
 					'default' => '/var/customers/logs/',
 					'save_method' => 'storeSettingField',
 					),
+				'system_customersslpath' => array(
+					'label' => $lng['serversettings']['customerssl_directory'],
+					'settinggroup' => 'system',
+					'varname' => 'customer_ssl_path',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/etc/apache2/ssl/',
+					'save_method' => 'storeSettingField',
+					),
 				'system_phpappendopenbasedir' => array(
 					'label' => $lng['serversettings']['phpappendopenbasedir'],
 					'settinggroup' => 'system',
@@ -124,7 +142,7 @@ return array(
 					'label' => $lng['serversettings']['phpreload_command'],
 					'settinggroup' => 'system',
 					'varname' => 'phpreload_command',
-					'type' => (getSetting('phpfpm', 'enabled') == '1') ? 'hidden' : 'string',
+					'type' => 'string',
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					'websrv_avail' => array('nginx')
@@ -133,19 +151,20 @@ return array(
 					'label' => $lng['serversettings']['nginx_php_backend'],
 					'settinggroup' => 'system',
 					'varname' => 'nginx_php_backend',
-					'type' => (getSetting('phpfpm', 'enabled') == '1') ? 'hidden' : 'string',
+					'type' => 'string',
 					'default' => '127.0.0.1:8888',
 					'save_method' => 'storeSettingField',
 					'websrv_avail' => array('nginx')
 					),
-				'system_mod_log_sql' => array(
-					'label' => $lng['serversettings']['mod_log_sql'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_log_sql',
-					'type' => 'bool',
-					'default' => false,
+				'nginx_fastcgiparams' => array(
+					'label' => $lng['serversettings']['nginx_fastcgiparams'],
+					'settinggroup' => 'nginx',
+					'varname' => 'fastcgiparams',
+					'type' => 'string',
+					'string_type' => 'file',
+					'default' => '/etc/nginx/fastcgi_params',
 					'save_method' => 'storeSettingField',
-					'websrv_avail' => array('apache2')
+					'websrv_avail' => array('nginx')
 					),
 				'defaultwebsrverrhandler_enabled' => array(
 					'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
@@ -209,72 +228,8 @@ return array(
 					'option_options_method' => 'getRedirectCodes',
 					'save_method' => 'storeSettingField',
 					'websrv_avail' => array('apache2', 'lighttpd')
-					),
-				),
-			),
-		'ssl' => array(
-			'title' => $lng['admin']['sslsettings'],
-			'fields' => array(
-				'system_ssl_enabled' => array(
-					'label' => $lng['serversettings']['ssl']['use_ssl'],
-					'settinggroup' => 'system',
-					'varname' => 'use_ssl',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					'overview_option' => true
-					),
-				'system_ssl_cert_file' => array(
-					'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
-					'settinggroup' => 'system',
-					'varname' => 'ssl_cert_file',
-					'type' => 'string',
-					'string_type' => 'file',
-					'string_emptyallowed' => true,
-					'default' => '/etc/apache2/apache2.pem',
-					'save_method' => 'storeSettingField',
-					),
-				'system_ssl_key_file' => array(
-					'label' => $lng['serversettings']['ssl']['ssl_key_file'],
-					'settinggroup' => 'system',
-					'varname' => 'ssl_key_file',
-					'type' => 'string',
-					'string_type' => 'file',
-					'string_emptyallowed' => true,
-					'default' => '/etc/apache2/apache2.key',
-					'save_method' => 'storeSettingField',
-					),
-				'system_ssl_ca_file' => array(
-					'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
-					'settinggroup' => 'system',
-					'varname' => 'ssl_ca_file',
-					'type' => 'string',
-					'string_type' => 'file',
-					'string_emptyallowed' => true,
-					'default' => '',
-					'save_method' => 'storeSettingField',
-					),
-				'system_ssl_cert_chainfile' => array(
-					'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
-					'settinggroup' => 'system',
-					'varname' => 'ssl_cert_chainfile',
-					'type' => 'string',
-					'string_type' => 'file',
-					'string_emptyallowed' => true,
-					'default' => '',
-					'save_method' => 'storeSettingField',
-					),
-				'system_ssl_openssl_cnf' => array(
-					'label' => $lng['serversettings']['ssl']['openssl_cnf'],
-					'settinggroup' => 'system',
-					'varname' => 'openssl_cnf',
-					'type' => 'text',
-					'default' => '',
-					'save_method' => 'storeSettingField',
-					),
-				),
-			),
-		),
+					)
+				)
+			)
+		)
 	);
-
-?>

actions/admin/settings/131.ssl.php

@@ -0,0 +1,77 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2003-2009 the SysCP Team (see authors).
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Florian Lippert <flo@syscp.org> (2003-2009)
+ * @author     Froxlor team <team@froxlor.org> (2010-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+			'ssl' => array(
+					'title' => $lng['admin']['sslsettings'],
+					'fields' => array(
+							'system_ssl_enabled' => array(
+									'label' => $lng['serversettings']['ssl']['use_ssl'],
+									'settinggroup' => 'system',
+									'varname' => 'use_ssl',
+									'type' => 'bool',
+									'default' => false,
+									'save_method' => 'storeSettingField',
+									'overview_option' => true
+							),
+							'system_ssl_cert_file' => array(
+									'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_cert_file',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '/etc/apache2/apache2.pem',
+									'save_method' => 'storeSettingField',
+							),
+							'system_ssl_key_file' => array(
+									'label' => $lng['serversettings']['ssl']['ssl_key_file'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_key_file',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '/etc/apache2/apache2.key',
+									'save_method' => 'storeSettingField',
+							),
+							'system_ssl_ca_file' => array(
+									'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_ca_file',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '',
+									'save_method' => 'storeSettingField',
+							),
+							'system_ssl_cert_chainfile' => array(
+									'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_cert_chainfile',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '',
+									'save_method' => 'storeSettingField',
+							)
+					)
+			)
+		)
+	);

actions/admin/settings/135.fcgid.php

@@ -30,7 +30,7 @@ return array(
 					'save_method' => 'storeSettingField',
 					'plausibility_check_method' => 'checkFcgidPhpFpm',
 					'overview_option' => true
-					),					
+					),
 				'system_mod_fcgid_configdir' => array(
 					'label' => $lng['serversettings']['mod_fcgid']['configdir'],
 					'settinggroup' => 'system',
@@ -66,7 +66,7 @@ return array(
 					'settinggroup' => 'system',
 					'varname' => 'mod_fcgid_wrapper',
 					'type' => 'option',
-					'option_options' => array(0 => 'ScriptAlias', 1=> 'FCGIWrapper'),
+					'option_options' => array(0 => 'ScriptAlias', 1=> 'FcgidWrapper'),
 					'default' => 1,
 					'save_method' => 'storeSettingField',
 					'websrv_avail' => array('apache2')
@@ -135,6 +135,14 @@ return array(
 					'save_method' => 'storeSettingField',
 					'websrv_avail' => array('apache2')
 					),
+				'system_mod_fcgid_idle_timeout' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_idle_timeout',
+					'type' => 'int',
+					'default' => 30,
+					'save_method' => 'storeSettingField'
+					),
 				)
 			)
 		)

actions/admin/settings/136.phpfpm.php

@@ -54,9 +54,16 @@ return array(
 					'default' => 'froxlorlocal',
 					'save_method' => 'storeSettingField'
 					),
-				/*
-				 * @TODO implement if phpfpm knows custom php.ini files
-				 * 
+				'system_phpfpm_defaultini' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'defaultini',
+					'type' => 'option',
+					'default' => '1',
+					'option_mode' => 'one',
+					'option_options_method' => 'getPhpConfigs',
+					'save_method' => 'storeSettingField',
+					),
 				'system_phpfpm_defaultini_ownvhost' => array(
 					'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
 					'settinggroup' => 'phpfpm',
@@ -67,7 +74,6 @@ return array(
 					'option_options_method' => 'getPhpConfigs',
 					'save_method' => 'storeSettingField',
 					),
-				*/
 				'system_phpfpm_configdir' => array(
 					'label' => $lng['serversettings']['phpfpm_settings']['configdir'],
 					'settinggroup' => 'phpfpm',
@@ -77,6 +83,15 @@ return array(
 					'default' => '/etc/php-fpm.d/',
 					'save_method' => 'storeSettingField',
 					),
+        'system_phpfpm_aliasconfigdir' => array(
+          'label' => $lng['serversettings']['phpfpm_settings']['aliasconfigdir'],
+          'settinggroup' => 'phpfpm',
+          'varname' => 'aliasconfigdir',
+          'type' => 'string',
+          'string_type' => 'dir',
+          'default' => '/var/www/php-fpm/',
+          'save_method' => 'storeSettingField',
+        ),
 				'system_phpfpm_tmpdir' => array(
 					'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
 					'settinggroup' => 'phpfpm',
@@ -110,7 +125,7 @@ return array(
 					'type' => 'option',
 					'default' => 'static',
 					'option_mode' => 'one',
-					'option_options' => array('static' => 'static', 'dynamic' => 'dynamic'),
+					'option_options' => array('static' => 'static', 'dynamic' => 'dynamic', 'ondemand' => 'ondemand'),
 					'save_method' => 'storeSettingField',
 					),
 				'system_phpfpm_max_children' => array(
@@ -153,6 +168,14 @@ return array(
 					'default' => 0,
 					'save_method' => 'storeSettingField',
 					),
+				'system_phpfpm_idle_timeout' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['idle_timeout'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'idle_timeout',
+					'type' => 'int',
+					'default' => 30,
+					'save_method' => 'storeSettingField'
+					),
 				),
 			),
 		),

actions/admin/settings/150.mail.php

@@ -51,6 +51,16 @@ return array(
 					'default' => '/var/customers/mail/',
 					'save_method' => 'storeSettingField',
 					),
+				'system_vmail_maildirname' => array(
+					'label' => $lng['serversettings']['vmail_maildirname'],
+					'settinggroup' => 'system',
+					'varname' => 'vmail_maildirname',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => 'Maildir',
+					'string_emptyallowed' => true,
+					'save_method' => 'storeSettingField',
+					),
 				'panel_sendalternativemail' => array(
 					'label' => $lng['serversettings']['sendalternativemail'],
 					'settinggroup' => 'panel',
@@ -90,9 +100,17 @@ return array(
 					'type' => 'hidden',
 					'default' => 0,
 					),
+				'system_catchall_enabled' => array(
+					'label' => $lng['serversettings']['catchall_enabled'],
+					'settinggroup' => 'catchall',
+					'varname' => 'catchall_enabled',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingResetCatchall',
+					),
 				),
 			),
 		),
 	);
 
-?>
+?>

actions/admin/settings/160.nameserver.php

@@ -22,6 +22,15 @@ return array(
 		'nameserver' => array(
 			'title' => $lng['admin']['nameserversettings'],
 			'fields' => array(
+				'nameserver_enable' => array(
+					'label' => $lng['serversettings']['bindenable'],
+					'settinggroup' => 'system',
+					'varname' => 'bind_enable',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					'overview_option' => true
+					),
 				'system_bindconf_directory' => array(
 					'label' => $lng['serversettings']['bindconf_directory'],
 					'settinggroup' => 'system',
@@ -59,6 +68,16 @@ return array(
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					),
+				'system_axfrservers' => array(
+					'label' => $lng['serversettings']['axfrservers'],
+					'settinggroup' => 'system',
+					'varname' => 'axfrservers',
+					'type' => 'string',
+					'string_type' => 'validate_ip',
+					'string_emptyallowed' => true,
+					'default' => '',
+					'save_method' => 'storeSettingField',
+				),
 				'system_dns_createmailentry' => array(
 					'label' => $lng['serversettings']['mail_also_with_mxservers'],
 					'settinggroup' => 'system',

actions/admin/settings/180.dkim.php

@@ -17,6 +17,8 @@
  *
  */
 
+global $settings;
+
 return array(
 	'groups' => array(
 		'dkim' => array(
@@ -79,7 +81,10 @@ return array(
 					'save_method' => 'storeSettingFieldInsertBindTask',
 					),
 				'dkim_keylength' => array(
-					'label' => $lng['dkim']['dkim_keylength'],
+					'label' => array(
+						'title' => $lng['dkim']['dkim_keylength']['title'], 
+						'description' => sprintf($lng['dkim']['dkim_keylength']['description'],$settings['dkim']['dkim_prefix'])
+					),
 					'settinggroup' => 'dkim',
 					'varname' => 'dkim_keylength',
 					'type' => 'option',

actions/admin/settings/200.aps.php

@@ -59,7 +59,7 @@ return array(
 					'type' => 'option',
 					'default' => '',
 					'option_mode' => 'multiple',
-					'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring'),
+					'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring', 'Zend Optimizer' => 'Zend Guard'),
 					'save_method' => 'storeSettingApsPhpExtensions',
 					),
 				'aps_php-function' => array(

actions/admin/settings/210.security.php

@@ -38,9 +38,17 @@ return array(
 					'default' => true,
 					'save_method' => 'storeSettingField',
 					),
-				),
-			),
-		),
+				'system_passwordcryptfunc' => array(
+					'label' => $lng['serversettings']['passwordcryptfunc'],
+					'settinggroup' => 'system',
+					'varname' => 'passwordcryptfunc',
+					'type' => 'option',
+					'default' => 0,
+					'option_mode' => 'one',
+					'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
+					'save_method' => 'storeSettingField',
+					)
+				)
+			)
+		)
 	);
-
-?>

actions/admin/settings/215.backup.php

@@ -28,6 +28,7 @@ return array(
 					'varname' => 'backup_enabled',
 					'type' => 'bool',
 					'default' => false,
+					'cronmodule' => 'froxlor/backup',
 					'save_method' => 'storeSettingField',
 					'overview_option' => true
 				),
@@ -38,7 +39,7 @@ return array(
 					'type' => 'string',
 					'string_type' => 'dir',
 					'default' => '/var/customers/backups/',
-					'string_regexp' => '^/.*/$',
+					'string_regexp' => '#^/.*/$#',
 					'save_method' => 'storeSettingField',
 				),
 				'backup_mysqldump_path' => array(

actions/admin/settings/220.quota.php

@@ -1,7 +1,7 @@
 <?php
 /**
  * This file is part of the Froxlor project.
- * Copyright (c) 2011 the Froxlor Team (see authors).
+ * Copyright (c) 2011- the Froxlor Team (see authors).
  *
  * For the full copyright and license information, please view the COPYING
  * file that was distributed with this source code. You can also view the

admin_admins.php

@@ -47,26 +47,6 @@ if($page == 'admins'
 			'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
 			'traffic' => $lng['customer']['traffic'],
 			'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
-/*
-			'mysqls' => $lng['customer']['mysqls'],
-			'mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
-			'ftps' => $lng['customer']['ftps'],
-			'ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
-			'tickets' => $lng['customer']['tickets'],
-			'tickets_used' => $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')',
-			'subdomains' => $lng['customer']['subdomains'],
-			'subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
-			'emails' => $lng['customer']['emails'],
-			'emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
-			'email_accounts' => $lng['customer']['accounts'],
-			'email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
-			'email_forwarders' => $lng['customer']['forwarders'],
-			'email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
-			'email_quota' => $lng['customer']['email_quota'],
-			'email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
-			'email_autoresponder' => $lng['customer']['autoresponder'],
-			'email_autoresponder_used' => $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')',
-*/
 			'deactivated' => $lng['admin']['deactivated']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
@@ -92,13 +72,23 @@ if($page == 'admins'
 				/**
 				 * percent-values for progressbar
 				 */
-				if($row['diskspace'] > 0) {
-					$percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
-					$doublepercent = round($percent*2, 2);
-				} else {
-					$percent = 0;
-					$doublepercent = 0;
-				}
+                                //For Disk usage
+                                if ($row['diskspace'] > 0) {
+                                        $disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
+                                        $disk_doublepercent = round($disk_percent*2, 2);
+                                } else {
+                                        $disk_percent = 0;
+                                        $disk_doublepercent = 0;
+                                }
+
+				//For Traffic usage
+                                if ($row['traffic'] > 0) {
+                                        $traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
+                                        $traffic_doublepercent = round($traffic_percent*2, 2);
+                                } else {
+                                        $traffic_percent = 0;
+                                        $traffic_doublepercent = 0;
+                                }
 				/* */
 
 				$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets');
@@ -281,7 +271,7 @@ if($page == 'admins'
 					$number_of_aps_packages = - 1;
 				}
 
-				$can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
+				$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
 			}
 			else
 			{
@@ -319,6 +309,10 @@ if($page == 'admins'
 				$traffic = - 1;
 			}
 
+			$tickets_see_all = 0;
+			if(isset($_POST['tickets_see_all']))
+				$tickets_see_all = intval($_POST['tickets_see_all']);
+
 			$diskspace = $diskspace * 1024;
 			$traffic = $traffic * 1024 * 1024;
 			$ipaddress = intval_ressource($_POST['ipaddress']);
@@ -386,6 +380,10 @@ if($page == 'admins'
 					$change_serversettings = '0';
 				}
 
+				if ($tickets_see_all != '1') {
+					$tickets_see_all  = '0';
+				}
+
 				$_theme = $settings['panel']['default_theme'];
 
 				$result = $db->query("INSERT INTO 
@@ -411,6 +409,7 @@ if($page == 'admins'
 					`email_quota` = '" . $db->escape($email_quota) . "', 
 					`ftps` = '" . $db->escape($ftps) . "', 
 					`tickets` = '" . $db->escape($tickets) . "', 
+					`tickets_see_all` = '" . $db->escape($tickets_see_all) . "',
 					`mysqls` = '" . $db->escape($mysqls) . "', 
 					`ip` = '" . (int)$ipaddress . "', 
 					`can_manage_aps_packages` = '" . (int)$can_manage_aps_packages . "', 
@@ -463,11 +462,13 @@ if($page == 'admins'
 			$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
-			#$change_serversettings = makeyesno('change_serversettings', '1', '0', '0');
-			#$customers_see_all = makeyesno('customers_see_all', '1', '0', '0');
-			#$domains_see_all = makeyesno('domains_see_all', '1', '0', '0');
-			#$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0');
-			#$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0');
+			/*
+			$change_serversettings = makeyesno('change_serversettings', '1', '0', '0');
+			$customers_see_all = makeyesno('customers_see_all', '1', '0', '0');
+			$domains_see_all = makeyesno('domains_see_all', '1', '0', '0');
+			$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0');
+			$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0');
+			*/
 			$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 
 			$admin_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_add.php';
@@ -508,6 +509,7 @@ if($page == 'admins'
 					$ftps = $result['ftps'];
 					$tickets = $result['tickets'];
 					$mysqls = $result['mysqls'];
+					$tickets_see_all = $result['tickets_see_all'];
 					$customers_see_all = $result['customers_see_all'];
 					$domains_see_all = $result['domains_see_all'];
 					$caneditphpsettings = $result['caneditphpsettings'];
@@ -522,114 +524,85 @@ if($page == 'admins'
 				{
 					$password = validate($_POST['admin_password'], 'new password');
 					$def_language = validate($_POST['def_language'], 'default language');
-					$deactivated = intval($_POST['deactivated']);
-					$customers = intval_ressource($_POST['customers']);
+					$deactivated = isset($_POST['deactivated']) ? 1 : 0;
 
-					if(isset($_POST['customers_ul']))
-					{
-						$customers = - 1;
+					$customers = intval_ressource($_POST['customers']);
+					if (isset($_POST['customers_ul'])) {
+						$customers = -1;
 					}
 
 					$domains = intval_ressource($_POST['domains']);
-
-					if(isset($_POST['domains_ul']))
-					{
-						$domains = - 1;
+					if (isset($_POST['domains_ul'])) {
+						$domains = -1;
 					}
 
 					$subdomains = intval_ressource($_POST['subdomains']);
-
-					if(isset($_POST['subdomains_ul']))
-					{
-						$subdomains = - 1;
+					if (isset($_POST['subdomains_ul'])) {
+						$subdomains = -1;
 					}
 
 					$emails = intval_ressource($_POST['emails']);
-
-					if(isset($_POST['emails_ul']))
-					{
-						$emails = - 1;
+					if (isset($_POST['emails_ul'])) {
+						$emails = -1;
 					}
 
 					$email_accounts = intval_ressource($_POST['email_accounts']);
-
-					if(isset($_POST['email_accounts_ul']))
-					{
-						$email_accounts = - 1;
+					if (isset($_POST['email_accounts_ul'])) {
+						$email_accounts = -1;
 					}
 
 					$email_forwarders = intval_ressource($_POST['email_forwarders']);
-
-					if(isset($_POST['email_forwarders_ul']))
-					{
-						$email_forwarders = - 1;
+					if (isset($_POST['email_forwarders_ul'])) {
+						$email_forwarders = -1;
 					}
 
-					if($settings['system']['mail_quota_enabled'] == '1')
-					{
+					if ($settings['system']['mail_quota_enabled'] == '1') {
 						$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
-
-						if(isset($_POST['email_quota_ul']))
-						{
-							$email_quota = - 1;
+						if (isset($_POST['email_quota_ul'])) {
+							$email_quota = -1;
 						}
-					}
-					else
-					{
-						$email_quota = - 1;
+					} else {
+						$email_quota = -1;
 					}
 
-					if($settings['autoresponder']['autoresponder_active'] == '1')
-					{
+					if ($settings['autoresponder']['autoresponder_active'] == '1') {
 						$email_autoresponder = intval_ressource($_POST['email_autoresponder']);
-
-						if(isset($_POST['email_autoresponder_ul']))
-						{
-							$email_autoresponder = - 1;
+						if (isset($_POST['email_autoresponder_ul'])) {
+							$email_autoresponder = -1;
 						}
-					}
-					else
-					{
+					} else {
 						$email_autoresponder = 0;
 					}
 
 					$ftps = intval_ressource($_POST['ftps']);
-
-					if(isset($_POST['ftps_ul']))
-					{
-						$ftps = - 1;
+					if (isset($_POST['ftps_ul'])) {
+						$ftps = -1;
 					}
 					
-					if($settings['ticket']['enabled'] == 1)
-					{
+					if ($settings['ticket']['enabled'] == 1) {
 						$tickets = intval_ressource($_POST['tickets']);
-
-						if(isset($_POST['tickets_ul']))
-						{
-							$tickets = - 1;
+						if (isset($_POST['tickets_ul'])) {
+							$tickets = -1;
 						}
-					}
-					else
-					{
+					} else {
 						$tickets = 0;
 					}
 
 					$mysqls = intval_ressource($_POST['mysqls']);
-
-					if(isset($_POST['mysqls_ul']))
-					{
+					if (isset($_POST['mysqls_ul'])) {
 						$mysqls = - 1;
 					}
 
-					$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
-
-					if(isset($_POST['number_of_aps_packages_ul']))
-					{
-						$number_of_aps_packages = - 1;
+					if ($settings['aps']['aps_active'] == '1') {
+						$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
+						if (isset($_POST['number_of_aps_packages_ul'])) {
+							$number_of_aps_packages = -1;
+						}
+						$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
+					} else {
+						$number_of_aps_packages = 0;
 					}
 
-					$can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
-
 					$customers_see_all = 0;
 					if(isset($_POST['customers_see_all']))
 						$customers_see_all = intval($_POST['customers_see_all']);
@@ -641,23 +614,23 @@ if($page == 'admins'
 					$caneditphpsettings = 0;
 					if(isset($_POST['caneditphpsettings']))
 						$caneditphpsettings = intval($_POST['caneditphpsettings']);
-					
+
 					$change_serversettings = 0;
 					if(isset($_POST['change_serversettings']))
-						$change_serversettings = intval($_POST['change_serversettings']);
-					
-					$diskspace = intval($_POST['diskspace']);
+						$change_serversettings = isset($_POST['change_serversettings']) ? 1 : 0;
 
-					if(isset($_POST['diskspace_ul']))
-					{
-						$diskspace = - 1;
+					$tickets_see_all = 0;
+					if (isset($_POST['tickets_see_all']))
+						$tickets_see_all = intval($_POST['tickets_see_all']);
+
+					$diskspace = intval($_POST['diskspace']);
+					if (isset($_POST['diskspace_ul'])) {
+						$diskspace = -1;
 					}
 
 					$traffic = doubleval_ressource($_POST['traffic']);
-
-					if(isset($_POST['traffic_ul']))
-					{
-						$traffic = - 1;
+					if (isset($_POST['traffic_ul'])) {
+						$traffic = -1;
 					}
 
 					$diskspace = $diskspace * 1024;
@@ -714,7 +687,88 @@ if($page == 'admins'
 						$change_serversettings = '0';
 					}
 
-					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `name`='" . $db->escape($name) . "', `email`='" . $db->escape($email) . "', `def_language`='" . $db->escape($def_language) . "', `change_serversettings` = '" . $db->escape($change_serversettings) . "', `customers` = '" . $db->escape($customers) . "', `customers_see_all` = '" . $db->escape($customers_see_all) . "', `domains` = '" . $db->escape($domains) . "', `domains_see_all` = '" . $db->escape($domains_see_all) . "', `caneditphpsettings` = '" . (int)$caneditphpsettings . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `email_quota`='" . $db->escape($email_quota) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `ip`='" . (int)$ipaddress . "', `deactivated`='" . $db->escape($deactivated) . "', `can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ", `aps_packages`=" . (int)$number_of_aps_packages . " WHERE `adminid`='" . $db->escape($id) . "'");
+					if ($tickets_see_all != '1') {
+						$tickets_see_all = '0';
+					}
+
+					// check if a resource was set to something lower
+					// than actually used by the admin/reseller
+					$res_warning = "";
+					if ($customers != $result['customers'] && $customers < $result['customers_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'customers');
+					}
+					if ($domains != $result['domains'] && $domains < $result['domains_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'domains');
+					}
+					if ($diskspace != $result['diskspace'] && ($diskspace / 1024) != -1 && $diskspace < $result['diskspace_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'diskspace');
+					}
+					if ($traffic != $result['traffic'] && ($traffic / 1024 / 1024) != -1 && $traffic < $result['traffic_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'traffic');
+					}
+					if ($emails != $result['emails'] && $emails < $result['emails_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'emails');
+					}
+					if ($email_accounts != $result['email_accounts'] && $email_accounts < $result['email_accounts_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email accounts');
+					}
+					if ($email_forwarders != $result['email_forwarders'] && $email_forwarders < $result['email_forwarders_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email forwarders');
+					}
+					if ($email_quota != $result['email_quota'] && $email_quota < $result['email_quota_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email quota');
+					}
+					if ($email_autoresponder != $result['email_autoresponder'] && $email_autoresponder < $result['email_autoresponder_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email autoresponder');
+					}
+					if ($ftps != $result['ftps'] && $ftps < $result['ftps_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'ftps');
+					}
+					if ($tickets != $result['tickets'] && $tickets < $result['tickets_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'tickets');
+					}
+					if ($mysqls != $result['mysqls'] && $mysqls < $result['mysqls_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'mysqls');
+					}
+					if ($number_of_aps_packages != $result['aps_packages'] && $number_of_aps_packages < $result['aps_packages_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'aps packages');
+					}
+
+					if ($res_warning != "") {
+						$link = '';
+						$error = $res_warning;
+						eval("echo \"" . getTemplate('misc/error', '1') . "\";");
+						exit;
+					}
+
+					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET
+						`name`='" . $db->escape($name) . "',
+						`email`='" . $db->escape($email) . "',
+						`def_language`='" . $db->escape($def_language) . "',
+						`change_serversettings` = '" . $db->escape($change_serversettings) . "',
+						`customers` = '" . $db->escape($customers) . "',
+						`customers_see_all` = '" . $db->escape($customers_see_all) . "',
+						`domains` = '" . $db->escape($domains) . "',
+						`domains_see_all` = '" . $db->escape($domains_see_all) . "',
+						`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
+						`password` = '" . $password . "',
+						`diskspace`='" . $db->escape($diskspace) . "',
+						`traffic`='" . $db->escape($traffic) . "',
+						`subdomains`='" . $db->escape($subdomains) . "',
+						`emails`='" . $db->escape($emails) . "',
+						`email_accounts` = '" . $db->escape($email_accounts) . "',
+						`email_forwarders`='" . $db->escape($email_forwarders) . "',
+						`email_quota`='" . $db->escape($email_quota) . "',
+						`email_autoresponder`='" . $db->escape($email_autoresponder) . "',
+						`ftps`='" . $db->escape($ftps) . "',
+						`tickets`='" . $db->escape($tickets) . "',
+						`tickets_see_all`='".$db->escape($tickets_see_all) . "',
+						`mysqls`='" . $db->escape($mysqls) . "',
+						`ip`='" . (int)$ipaddress . "',
+						`deactivated`='" . $db->escape($deactivated) . "',
+						`can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ",
+						`aps_packages`=" . (int)$number_of_aps_packages . "
+						 WHERE `adminid`='" . $db->escape($id) . "'");
 					$log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'");
 					$redirect_props = Array(
 						'page' => $page,
@@ -852,13 +906,14 @@ if($page == 'admins'
 					}
 				}
 
-				#$change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']);
-				#$customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']);
-				#$domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']);
-				#$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']);
-				#$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
-				#$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']);
-
+				/*
+				$change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']);
+				$customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']);
+				$domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']);
+				$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']);
+				$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
+				$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']);
+				*/
 				$result = htmlentities_array($result);
 
 				$admin_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_edit.php';

admin_cronjobs.php

@@ -16,24 +16,17 @@
  */
 
 define('AREA', 'admin');
+require_once('./lib/init.php');
 
-require_once("./lib/init.php");
-
-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif(isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }
 
-if($page == 'cronjobs'
-  || $page == 'overview')
-{
-	if($action == '')
-	{
-		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_cronjobs");
+if ($page == 'cronjobs' || $page == 'overview') {
+	if ($action == '') {
+		$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs');
 
 		$fields = array(
 			'c.lastrun' => $lng['cron']['lastrun'],
@@ -56,88 +49,65 @@ if($page == 'cronjobs'
 		$i = 0;
 		$count = 0;
 
-		while($row = $db->fetch_array($result))
-		{
-			if($paging->checkDisplay($i))
-			{
+		while ($row = $db->fetch_array($result)) {
+			if ($paging->checkDisplay($i)) {
 				$row = htmlentities_array($row);
-				
+
 				$row['lastrun'] = date('d.m.Y H:i', $row['lastrun']);
-				
-				if((int)$row['isactive'] == 1)
-				{
-					$row['isactive'] = $lng['panel']['yes'];
-				}
-				else
-				{
-					$row['isactive'] = $lng['panel']['no'];
-				}
-				
+				$row['isactive'] = ((int)$row['isactive'] == 1) ? $lng['panel']['yes'] : $lng['panel']['no'];
+
 				$description = $lng['crondesc'][$row['desc_lng_key']];
-				
-				eval("\$crons.=\"" . getTemplate("cronjobs/cronjobs_cronjob") . "\";");
+
+				eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjob') . "\";");
 				$count++;
 			}
 
 			$i++;
 		}
 
-		eval("echo \"" . getTemplate("cronjobs/cronjobs") . "\";");
+		eval("echo \"" . getTemplate('cronjobs/cronjobs') . "\";");
 
-	}
-	elseif($action == 'new')
-	{
+	} elseif ($action == 'new') {
 		/*
 		 * @TODO later
 		 */
-	}
-	elseif($action == 'edit'
-	&& $id != 0)
-	{
+	} elseif ($action == 'edit' && $id != 0) {
 		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'");
-		
-		if ($result['cronfile'] != '')
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
-				$isactive = intval($_POST['isactive']);
+		if ($result['cronfile'] != '') {
+			if (isset($_POST['send']) && $_POST['send'] == 'send') {
+				$isactive = isset($_POST['isactive']) ? 1 : 0;
 				$interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty');
 				$interval_interval = validate($_POST['interval_interval'], 'interval_interval');
-				
-				if($isactive != 1)
-				{
+
+				if ($isactive != 1) {
 					$isactive = 0;
 				}
-				
-				$interval = $interval_value.' '.strtoupper($interval_interval);
-				
+
+				$interval = $interval_value . ' ' . strtoupper($interval_interval);
+
 				$db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "` 
 							SET `isactive` = '".(int)$isactive."',
 							`interval` = '".$interval."'
 							WHERE `id` = '" . (int)$id . "'");
 
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			}
-			else
-			{
-				#$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
+			} else {
+				//$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
 				// interval
 				$interval_nfo = explode(' ', $result['interval']);
 				$interval_value = $interval_nfo[0];
 
 				$interval_interval = '';
-				$interval_interval.= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
-				$interval_interval.= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
-				$interval_interval.= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
-				$interval_interval.= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
-				$interval_interval.= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
-				$interval_interval.= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
 				// end of interval
-				
+
 				$change_cronfile = false;
-				if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor')
-				{
+				if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor') {
 					$change_cronfile = true;
 				}
 
@@ -147,17 +117,13 @@ if($page == 'cronjobs'
 				$title = $cronjobs_edit_data['cronjobs_edit']['title'];
 				$image = $cronjobs_edit_data['cronjobs_edit']['image'];
 
-				eval("echo \"" . getTemplate("cronjobs/cronjob_edit") . "\";");
+				eval("echo \"" . getTemplate('cronjobs/cronjob_edit') . "\";");
 			}
 		}
 	}
-	elseif($action == 'delete'
-	&& $id != 0)
-	{
+	elseif ($action == 'delete' && $id != 0) {
 		/*
 		 * @TODO later
 		 */
 	}
 }
-
-?>

admin_customers.php

@@ -48,52 +48,22 @@ if($page == 'customers'
 			'c.loginname' => $lng['login']['username'],
 			'a.loginname' => $lng['admin']['admin'],
 			'c.name' => $lng['customer']['name'],
+			'c.email' => $lng['customer']['email'],
 			'c.firstname' => $lng['customer']['firstname'],
 			'c.company' => $lng['customer']['company'],
 			'c.diskspace' => $lng['customer']['diskspace'],
 			'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
 			'c.traffic' => $lng['customer']['traffic'],
-			'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
-			'c.backup_allowed' => $lng['backup_allowed']
-/*
-			'c.mysqls' => $lng['customer']['mysqls'],
-			'c.mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
-			'c.ftps' => $lng['customer']['ftps'],
-			'c.ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
-			'c.subdomains' => $lng['customer']['subdomains'],
-			'c.subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
-			'c.emails' => $lng['customer']['emails'],
-			'c.emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
-			'c.email_accounts' => $lng['customer']['accounts'],
-			'c.email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
-			'c.email_forwarders' => $lng['customer']['forwarders'],
-			'c.email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
-			'c.email_quota' => $lng['customer']['email_quota'],
-			'c.email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
-			'c.deactivated' => $lng['admin']['deactivated'],
-			'c.lastlogin_succ' => $lng['admin']['lastlogin_succ'],
-			'c.phpenabled' => $lng['admin']['phpenabled'],
-			'c.perlenabled' => $lng['admin']['perlenabled']
-*/
+			'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')'
 		);
 
-/*
-		if($settings['ticket']['enabled'] == 1)
-		{
-			$fields['c.tickets'] = $lng['customer']['tickets'];
-			$fields['c.tickets_used'] = $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')';
+		if ($settings['system']['backup_enabled'] == '1') {
+			$field['c.backup_allowed'] = $lng['backup_allowed'];
 		}
 
-		if($settings['autoresponder']['autoresponder_active'] == 1)
-		{
-			$fields['c.email_autoresponder'] = $lng['customer']['autoresponder'];
-			$fields['c.email_autoresponder_used'] = $lng['customer']['autoresponder'] . ' (' . $lng['panel']['used'] . ')';
-		}
-*/
-
 		$paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$customers = '';
-		$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy(false) . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy($settings['panel']['natsorting']) . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng, true);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -163,11 +133,14 @@ if($page == 'customers'
 
 		if($destination_user != '')
 		{
+			if ($result['deactivated'] == '1') {
+				standard_error("usercurrentlydeactivated", $destination_user);
+			}
 			$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'");
 			$s = md5(uniqid(microtime(), 1));
 			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
 			$log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'");
-			redirectTo('customer_index.php', Array('s' => $s));
+			redirectTo('customer_index.php', Array('s' => $s), true);
 		}
 		else
 		{
@@ -211,7 +184,6 @@ if($page == 'customers'
 			{
 				$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
 				$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
-				unset($db_root->password);
 				$last_dbserver = 0;
 
 				while($row_database = $db->fetch_array($databases))
@@ -221,16 +193,20 @@ if($page == 'customers'
 						$db_root->query('FLUSH PRIVILEGES;');
 						$db_root->close();
 						$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
-						unset($db_root->password);
 						$last_dbserver = $row_database['dbserver'];
 					}
 
-					foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
+					if(mysql_get_server_info() < '5.0.2') {
+						// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
+						$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
+					}
+
+					$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($row_database['databasename']) . "'");
+					while($host = $db_root->fetch_array($host_res))
 					{
-						$mysql_access_host = trim($mysql_access_host);
-						$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`',false,true);
-						$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`',false,true);
-						$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($row_database['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
+						// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+)
+						$db_root->query('DROP USER \'' . $db_root->escape($row_database['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true);
+						
 					}
 
 					$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`');
@@ -306,7 +282,7 @@ if($page == 'customers'
 
 				if($result['email_autoresponder'] != '-1')
 				{
-					$admin_update_query.= ", `email_autoresponder` = `email_autoresponder` - 0" . (int)$result['email_autoresponder'];
+					$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` - 0" . (int)$result['email_autoresponder'];
 				}
 
 				if($result['subdomains'] != '-1')
@@ -326,7 +302,7 @@ if($page == 'customers'
 
 				if($result['aps_packages'] != '-1')
 				{
-					$admin_update_query.= ", `aps_packages` = `aps_packages` - 0" . (int)$result['aps_packages'];
+					$admin_update_query.= ", `aps_packages_used` = `aps_packages_used` - 0" . (int)$result['aps_packages'];
 				}
 
 				if(($result['diskspace'] / 1024) != '-1')
@@ -338,19 +314,18 @@ if($page == 'customers'
 				$db->query($admin_update_query);
 				$log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'");
 				inserttask('1');
+
+				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
 
-				if(isset($_POST['delete_userfiles'])
-				  && (int)$_POST['delete_userfiles'] == 1)
-				{
+				if (isset($_POST['delete_userfiles'])
+						&& (int)$_POST['delete_userfiles'] == 1
+				) {
 					inserttask('6', $result['loginname']);
 				}
 
-				# Using filesystem - quota, insert a task which cleans the filesystem - quota
-				if ($settings['system']['diskquota_enabled'])
-				{
-					inserttask('10');
-				}
+				// Using filesystem - quota, insert a task which cleans the filesystem - quota
+				inserttask('10');
 
 				/*
 				 * move old tickets to archive
@@ -620,6 +595,11 @@ if($page == 'customers'
 						{
 							standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
 						}
+						
+						//Additional filtering for Bug #962
+						if(function_exists('posix_getpwnam') && !in_array("posix_getpwnam",explode(",",ini_get('disable_functions'))) && posix_getpwnam($loginname)) {
+							standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
+						}
 					}
 					else
 					{
@@ -783,13 +763,10 @@ if($page == 'customers'
 					$log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'");
 					inserttask('2', $loginname, $guid, $guid, $store_defaultindex);
 
-					# Using filesystem - quota, insert a task which cleans the filesystem - quota
-					if ($settings['system']['diskquota_enabled'])
-					{
-						inserttask('10');
-					}
-					// Add htpasswd for the webalizer stats
+					// Using filesystem - quota, insert a task which cleans the filesystem - quota
+					inserttask('10');
 
+					// Add htpasswd for the webalizer stats
 					if(CRYPT_STD_DES == 1)
 					{
 						$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
@@ -812,7 +789,8 @@ if($page == 'customers'
 					}
 
 					inserttask('1');
-					$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
+					$cryptPassword = makeCryptPassword($password);
+					$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
 					$result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')");
 					$result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')");
 					$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'");
@@ -840,7 +818,6 @@ if($page == 'customers'
 							"`isemaildomain` = '0', " .
 							"`caneditdomain` = '0', " .
 							"`openbasedir` = '1', " .
-							"`safemode` = '1', " .
 							"`speciallogfile` = '0', " .
 							"`specialsettings` = '', " .
 							"`add_date` = '".date('Y-m-d')."'");
@@ -916,14 +893,6 @@ if($page == 'customers'
 				$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
-				#$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', '1');
-				#$email_imap = makeyesno('email_imap', '1', '0', '1');
-				#$email_pop3 = makeyesno('email_pop3', '1', '0', '1');
-				#$sendpassword = makeyesno('sendpassword', '1', '0', '1');
-				#$phpenabled = makeyesno('phpenabled', '1', '0', '1');
-				#$perlenabled = makeyesno('perlenabled', '1', '0', '0');
-				#$store_defaultindex = makeyesno('store_defaultindex', '1', '0', '1');
-				$backup_allowed = makeyesno('backup_allowed', '1', '0', '0');
 
 				$gender_options = makeoption($lng['gender']['undef'], 0, true, true, true);
 				$gender_options .= makeoption($lng['gender']['male'], 1, null, true, true);
@@ -1188,7 +1157,7 @@ if($page == 'customers'
 							$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname'];
 						}
 
-						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `safemode`, `speciallogfile`, `specialsettings`, `add_date`) " . "VALUES ('" . $db->escape($_stdsubdomain) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '1', '0', '', '".date('Y-m-d')."')");
+						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `speciallogfile`, `specialsettings`, `add_date`) " . "VALUES ('" . $db->escape($_stdsubdomain) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '0', '', '".date('Y-m-d')."')");
 						$domainid = $db->insert_id();
 						$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
 						$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'");
@@ -1227,14 +1196,13 @@ if($page == 'customers'
 
 					if($deactivated != $result['deactivated'])
 					{
-						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : '1') . "', `imap`='" . (($deactivated) ? '0' : '1') . "' WHERE `customerid`='" . (int)$id . "'");
+						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : (int)$result['pop3']) . "', `imap`='" . (($deactivated) ? '0' : (int)$result['imap']) . "' WHERE `customerid`='" . (int)$id . "'");
 						$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'");
 						$db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'");
 
 						/* Retrieve customer's databases */
 						$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
 						$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
-						unset($db_root->password);
 						$last_dbserver = 0;
 
 						/* For each of them */
@@ -1245,7 +1213,6 @@ if($page == 'customers'
 								$db_root->query('FLUSH PRIVILEGES;');
 								$db_root->close();
 								$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
-								unset($db_root->password);
 								$last_dbserver = $row_database['dbserver'];
 							}
 
@@ -1256,8 +1223,8 @@ if($page == 'customers'
 								/* Prevent access, if deactivated */
 								if($deactivated)
 								{
-									$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-									$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
+									// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
+									$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
 								}
 								else /* Otherwise grant access */
 								{
@@ -1293,11 +1260,8 @@ if($page == 'customers'
 					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `gender`='" . $db->escape($gender) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `backup_allowed`='" . $db->escape($backup_allowed) . "' WHERE `customerid`='" . (int)$id . "'");
 					$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` ";
 
-					# Using filesystem - quota, insert a task which cleans the filesystem - quota
-					if ($settings['system']['diskquota_enabled'])
-					{
-						inserttask('10');
-					}
+					// Using filesystem - quota, insert a task which cleans the filesystem - quota
+					inserttask('10');
 
 					if($mysqls != '-1'
 					   || $result['mysqls'] != '-1')
@@ -1582,13 +1546,6 @@ if($page == 'customers'
 					$result['aps_packages'] = '';
 				}
 
-				#$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', (($result['standardsubdomain'] != '0') ? '1' : '0'));
-				#$phpenabled = makeyesno('phpenabled', '1', '0', $result['phpenabled']);
-				#$perlenabled = makeyesno('perlenabled', '1', '0', $result['perlenabled']);
-				#$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
-				#$email_imap = makeyesno('email_imap', '1', '0', $result['imap']);
-				#$email_pop3 = makeyesno('email_pop3', '1', '0', $result['pop3']);
-				$backup_allowed = makeyesno('backup_allowed', '1', '0', $result['backup_allowed']);
 				$result = htmlentities_array($result);
 
 				$gender_options = makeoption($lng['gender']['undef'], 0, ($result['gender'] == '0' ? true : false), true, true);

admin_domains.php

@@ -194,7 +194,10 @@ if($page == 'domains'
 				$log->logAction(ADM_ACTION, LOG_INFO, "deleted domain/subdomains (#" . $result['id'] . ")");
 				updateCounters();
 				inserttask('1');
+
+				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
+
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 			elseif ($alias_check['count'] > 0) {
@@ -278,9 +281,16 @@ if($page == 'domains'
 
 				if($userinfo['change_serversettings'] == '1')
 				{
-					$isbinddomain = intval($_POST['isbinddomain']);
-					$caneditdomain = intval($_POST['caneditdomain']);
-					$zonefile = validate($_POST['zonefile'], 'zonefile');
+					$caneditdomain = isset($_POST['caneditdomain']) ? intval($_POST['caneditdomain']) : 0;
+
+					$isbinddomain = '0';
+					$zonefile = '';
+					if ($settings['system']['bind_enable'] == '1') {
+						if (isset($_POST['isbinddomain'])) {
+							$isbinddomain = intval($_POST['isbinddomain']);
+						}
+						$zonefile = validate($_POST['zonefile'], 'zonefile');
+					}
 
 					if(isset($_POST['dkim']))
 					{
@@ -294,11 +304,13 @@ if($page == 'domains'
 					$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
 					validate($_POST['documentroot'], 'documentroot');
 
+					// If path is empty and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+					// set default path to subdomain or domain name
 					if(isset($_POST['documentroot'])
-					   && $_POST['documentroot'] != '')
+						&& ($_POST['documentroot'] != ''))
 					{
 						if(substr($_POST['documentroot'], 0, 1) != '/'
-						   && !preg_match('/^https?\:\/\//', $_POST['documentroot']))
+							&& !preg_match('/^https?\:\/\//', $_POST['documentroot']))
 						{
 							$documentroot.= '/' . $_POST['documentroot'];
 						}
@@ -307,10 +319,19 @@ if($page == 'domains'
 							$documentroot = $_POST['documentroot'];
 						}
 					}
+					elseif (isset($_POST['documentroot'])
+						&& ($_POST['documentroot'] == '') 
+						&& ($settings['system']['documentroot_use_default_value'] == 1))
+					{
+						$documentroot = makeCorrectDir($customer['documentroot'] . '/' . $domain);
+					}
 				}
 				else
 				{
-					$isbinddomain = '1';
+					$isbinddomain = '0';
+					if ($settings['system']['bind_enable'] == '1') {
+						$isbinddomain = '1';
+					}
 					$caneditdomain = '1';
 					$zonefile = '';
 					$dkim = '1';
@@ -320,10 +341,9 @@ if($page == 'domains'
 				if($userinfo['caneditphpsettings'] == '1'
 				   || $userinfo['change_serversettings'] == '1')
 				{
-					$openbasedir = intval($_POST['openbasedir']);
-					$safemode = intval($_POST['safemode']);
+					$openbasedir = isset($_POST['openbasedir']) ? intval($_POST['openbasedir']) : 0;
 
-					if((int)$settings['system']['mod_fcgid'] == 1)
+					if((int)$settings['system']['mod_fcgid'] == 1 || (int)$settings['phpfpm']['enabled'] == 1)
 					{
 						$phpsettingid = (int)$_POST['phpsettingid'];
 						$phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid);
@@ -335,12 +355,21 @@ if($page == 'domains'
 							standard_error('phpsettingidwrong');
 						}
 
-						$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
-						$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
+						if( (int)$settings['system']['mod_fcgid'] == 1) {
+							$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
+							$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
+						} else {
+							$mod_fcgid_starter = '-1';
+							$mod_fcgid_maxrequests = '-1';
+						}
 					}
 					else
 					{
-						$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
+						if ((int)$settings['phpfpm']['enabled'] == 1) {
+							$phpsettingid = $settings['phpfpm']['defaultini'];
+						} else {
+							$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
+						}
 						$mod_fcgid_starter = '-1';
 						$mod_fcgid_maxrequests = '-1';
 					}
@@ -348,8 +377,11 @@ if($page == 'domains'
 				else
 				{
 					$openbasedir = '1';
-					$safemode = '1';
-					$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
+					if ((int)$settings['phpfpm']['enabled'] == 1) {
+						$phpsettingid = $settings['phpfpm']['defaultini'];
+					} else {
+						$phpsettingid = $settings['system']['mod_fcgid_defaultini'];
+					}
 					$mod_fcgid_starter = '-1';
 					$mod_fcgid_maxrequests = '-1';
 				}
@@ -380,7 +412,7 @@ if($page == 'domains'
 				   && isset($_POST['ssl_ipandport'])
 				   && $_POST['ssl'] != '0')
 				{
-					$ssl = (int)$_POST['ssl'];
+					$ssl = 1; // if ssl is set and != 0 it can only be 1
 					$ssl_redirect = 0;
 					if (isset($_POST['ssl_redirect'])) {
 						$ssl_redirect = (int)$_POST['ssl_redirect'];
@@ -430,11 +462,6 @@ if($page == 'domains'
 					$openbasedir = '0';
 				}
 
-				if($safemode != '1')
-				{
-					$safemode = '0';
-				}
-
 				if($speciallogfile != '1')
 				{
 					$speciallogfile = '0';
@@ -535,7 +562,6 @@ if($page == 'domains'
 						'ssl_redirect' => $ssl_redirect,
 						'ssl_ipandport' => $ssl_ipandport,
 						'openbasedir' => $openbasedir,
-						'safemode' => $safemode,
 						'phpsettingid' => $phpsettingid,
 						'mod_fcgid_starter' => $mod_fcgid_starter,
 						'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests,
@@ -565,12 +591,15 @@ if($page == 'domains'
 						$question_nr++;
 					}
 
-					$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`domain`, `customerid`, `adminid`, `documentroot`, `ipandport`,`aliasdomain`, `zonefile`, `dkim`, `wwwserveralias`, `isbinddomain`, `isemaildomain`, `email_only`, `subcanemaildomain`, `caneditdomain`, `openbasedir`, `safemode`,`speciallogfile`, `specialsettings`, `ssl`, `ssl_redirect`, `ssl_ipandport`, `add_date`, `registration_date`, `phpsettingid`, `mod_fcgid_starter`, `mod_fcgid_maxrequests`, `ismainbutsubto`) VALUES ('" . $db->escape($domain) . "', '" . (int)$customerid . "', '" . (int)$adminid . "', '" . $db->escape($documentroot) . "', '" . $db->escape($ipandport) . "', " . (($aliasdomain != 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", '" . $db->escape($zonefile) . "', '" . $db->escape($dkim) . "', '" . $db->escape($wwwserveralias) . "', '" . $db->escape($isbinddomain) . "', '" . $db->escape($isemaildomain) . "', '" . $db->escape($email_only) . "', '" . $db->escape($subcanemaildomain) . "', '" . $db->escape($caneditdomain) . "', '" . $db->escape($openbasedir) . "', '" . $db->escape($safemode) . "', '" . $db->escape($speciallogfile) . "', '" . $db->escape($specialsettings) . "', '" . $ssl . "', '" . $ssl_redirect . "' , '" . $ssl_ipandport . "', '" . $db->escape(time()) . "', '" . $db->escape($registration_date) . "', '" . (int)$phpsettingid . "', '" . (int)$mod_fcgid_starter . "', '" . (int)$mod_fcgid_maxrequests . "', '".(int)$issubof."')");
+					$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`domain`, `customerid`, `adminid`, `documentroot`, `ipandport`,`aliasdomain`, `zonefile`, `dkim`, `wwwserveralias`, `isbinddomain`, `isemaildomain`, `email_only`, `subcanemaildomain`, `caneditdomain`, `openbasedir`, `speciallogfile`, `specialsettings`, `ssl`, `ssl_redirect`, `ssl_ipandport`, `add_date`, `registration_date`, `phpsettingid`, `mod_fcgid_starter`, `mod_fcgid_maxrequests`, `ismainbutsubto`) VALUES ('" . $db->escape($domain) . "', '" . (int)$customerid . "', '" . (int)$adminid . "', '" . $db->escape($documentroot) . "', '" . $db->escape($ipandport) . "', " . (($aliasdomain != 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", '" . $db->escape($zonefile) . "', '" . $db->escape($dkim) . "', '" . $db->escape($wwwserveralias) . "', '" . $db->escape($isbinddomain) . "', '" . $db->escape($isemaildomain) . "', '" . $db->escape($email_only) . "', '" . $db->escape($subcanemaildomain) . "', '" . $db->escape($caneditdomain) . "', '" . $db->escape($openbasedir) . "', '" . $db->escape($speciallogfile) . "', '" . $db->escape($specialsettings) . "', '" . $ssl . "', '" . $ssl_redirect . "' , '" . $ssl_ipandport . "', '" . $db->escape(time()) . "', '" . $db->escape($registration_date) . "', '" . (int)$phpsettingid . "', '" . (int)$mod_fcgid_starter . "', '" . (int)$mod_fcgid_maxrequests . "', '".(int)$issubof."')");
 					$domainid = $db->insert_id();
 					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` + 1 WHERE `adminid` = '" . (int)$adminid . "'");
 					$log->logAction(ADM_ACTION, LOG_INFO, "added domain '" . $domain . "'");
 					inserttask('1');
+
+					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
+
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
@@ -670,21 +699,14 @@ if($page == 'domains'
 
 				while($row = $db->fetch_array($configs))
 				{
-					$phpconfigs.= makeoption($row['description'], $row['id'], $settings['system']['mod_fcgid_defaultini'], true, true);
+					if ((int)$settings['phpfpm']['enabled'] == 1) {
+						$phpconfigs.= makeoption($row['description'], $row['id'], $settings['phpfpm']['defaultini'], true, true);
+					} else {
+						$phpconfigs.= makeoption($row['description'], $row['id'], $settings['system']['mod_fcgid_defaultini'], true, true);
+					}
 				}
 
-				#$isbinddomain = makeyesno('isbinddomain', '1', '0', '1');
-				#$isemaildomain = makeyesno('isemaildomain', '1', '0', '1');
-				#$email_only = makeyesno('email_only', '1', '0', '0');
 				$subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', '0', true, true) . makeoption($lng['admin']['subcanemaildomain']['always'], '3', '0', true, true);
-				#$dkim = makeyesno('dkim', '1', '0', '1');
-				#$wwwserveralias = makeyesno('wwwserveralias', '1', '0', '1');
-				#$caneditdomain = makeyesno('caneditdomain', '1', '0', '1');
-				#$openbasedir = makeyesno('openbasedir', '1', '0', '1');
-				#$safemode = makeyesno('safemode', '1', '0', '1');
-				#$speciallogfile = makeyesno('speciallogfile', '1', '0', '0');
-				#$ssl = makeyesno('ssl', '1', '0', '0');
-				#$ssl_redirect = makeyesno('ssl_redirect', '1', '0', '0');
 				$add_date = date('Y-m-d');
 
 				$domain_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/domains/formfield.domains_add.php';
@@ -783,7 +805,7 @@ if($page == 'domains'
 				$aliasdomain = intval($_POST['alias']);
 				$issubof = intval($_POST['issubof']);
 				$subcanemaildomain = intval($_POST['subcanemaildomain']);
-				$caneditdomain = intval($_POST['caneditdomain']);
+				$caneditdomain = isset($_POST['caneditdomain']) ? intval($_POST['caneditdomain']) : 0;
 				$registration_date = trim($_POST['registration_date']);
 				$registration_date = validate($registration_date, 'registration_date', '/^(19|20)\d\d[-](0[1-9]|1[012])[-](0[1-9]|[12][0-9]|3[01])$/', '', array('0000-00-00', '0', ''));
 
@@ -799,14 +821,25 @@ if($page == 'domains'
 				if(isset($_POST['wwwserveralias']))
 					$wwwserveralias = intval($_POST['wwwserveralias']);
 
+				$speciallogfile = 0;
+				if(isset($_POST['speciallogfile']))
+					$speciallogfile = intval($_POST['speciallogfile']);
+
+
 				if($userinfo['change_serversettings'] == '1')
 				{
-					$isbinddomain = intval($_POST['isbinddomain']);
-					$zonefile = validate($_POST['zonefile'], 'zonefile');
+					$isbinddomain = $result['isbinddomain'];
+					$zonefile = $result['zonefile'];
+					if ($settings['system']['bind_enable'] == '1') {
+						if (isset($_POST['isbinddomain'])) {
+							$isbinddomain = (int)$_POST['isbinddomain'];
+						}
+						$zonefile = validate($_POST['zonefile'], 'zonefile');
+					}
 
 					if($settings['dkim']['use_dkim'] == '1')
 					{
-						$dkim = intval($_POST['dkim']);
+						$dkim = isset($_POST['dkim']) ? 1 : 0;
 					}
 					else
 					{
@@ -818,7 +851,16 @@ if($page == 'domains'
 
 					if($documentroot == '')
 					{
-						$documentroot = $customer['documentroot'];
+						// If path is empty and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+						// set default path to subdomain or domain name
+						if ($settings['system']['documentroot_use_default_value'] == 1)
+						{
+							$documentroot = makeCorrectDir($customer['documentroot'] . '/' . $result['domain']);
+						}
+						else
+						{
+							$documentroot = $customer['documentroot'];
+						}
 					}
 
 					if(!preg_match('/^https?\:\/\//', $documentroot)
@@ -839,10 +881,9 @@ if($page == 'domains'
 				if($userinfo['caneditphpsettings'] == '1'
 				   || $userinfo['change_serversettings'] == '1')
 				{
-					$openbasedir = intval($_POST['openbasedir']);
-					$safemode = intval($_POST['safemode']);
+					$openbasedir = isset($_POST['openbasedir']) ? intval($_POST['openbasedir']) : 0;
 
-					if((int)$settings['system']['mod_fcgid'] == 1)
+					if((int)$settings['system']['mod_fcgid'] == 1 || (int)$settings['phpfpm']['enabled'] == 1)
 					{
 						$phpsettingid = (int)$_POST['phpsettingid'];
 						$phpsettingid_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = " . (int)$phpsettingid);
@@ -854,8 +895,13 @@ if($page == 'domains'
 							standard_error('phpsettingidwrong');
 						}
 
-						$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
-						$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
+						if ((int)$settings['system']['mod_fcgid'] == 1) {
+							$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
+							$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
+						} else {
+							$mod_fcgid_starter = $result['mod_fcgid_starter'];
+							$mod_fcgid_maxrequests = $result['mod_fcgid_maxrequests'];
+						}
 					}
 					else
 					{
@@ -867,7 +913,6 @@ if($page == 'domains'
 				else
 				{
 					$openbasedir = $result['openbasedir'];
-					$safemode = $result['safemode'];
 					$phpsettingid = $result['phpsettingid'];
 					$mod_fcgid_starter = $result['mod_fcgid_starter'];
 					$mod_fcgid_maxrequests = $result['mod_fcgid_maxrequests'];
@@ -899,7 +944,7 @@ if($page == 'domains'
 				   && isset($_POST['ssl_ipandport'])
 				   && $_POST['ssl'] != '0')
 				{
-					$ssl = (int)$_POST['ssl'];
+					$ssl = 1; // if ssl is set and != 0, it can only be 1
 					$ssl_redirect = 0;
 					if (isset($_POST['ssl_redirect'])) {
 						$ssl_redirect = (int)$_POST['ssl_redirect'];
@@ -931,11 +976,6 @@ if($page == 'domains'
 					$openbasedir = '0';
 				}
 
-				if($safemode != '1')
-				{
-					$safemode = '0';
-				}
-
 				if($isbinddomain != '1')
 				{
 					$isbinddomain = '0';
@@ -1013,13 +1053,13 @@ if($page == 'domains'
 					'ssl_redirect' => $ssl_redirect,
 					'ssl_ipandport' => $ssl_ipandport,
 					'openbasedir' => $openbasedir,
-					'safemode' => $safemode,
 					'phpsettingid' => $phpsettingid,
 					'mod_fcgid_starter' => $mod_fcgid_starter,
 					'mod_fcgid_maxrequests' => $mod_fcgid_maxrequests,
 					'specialsettings' => $specialsettings,
 					'registration_date' => $registration_date,
-					'issubof' => $issubof
+					'issubof' => $issubof,
+					'speciallogfile' => $speciallogfile
 				);
 
 				$security_questions = array(
@@ -1048,18 +1088,20 @@ if($page == 'domains'
 				   || $ssl_ipandport != $result['ssl_ipandport']
 				   || $wwwserveralias != $result['wwwserveralias']
 				   || $openbasedir != $result['openbasedir']
-				   || $safemode != $result['safemode']
 				   || $phpsettingid != $result['phpsettingid']
 				   || $mod_fcgid_starter != $result['mod_fcgid_starter']
 				   || $mod_fcgid_maxrequests != $result['mod_fcgid_maxrequests']
 				   || $specialsettings != $result['specialsettings']
 				   || $aliasdomain != $result['aliasdomain']
 				   || $issubof != $result['ismainbutsubto']
-				   || $email_only != $result['email_only'])
+				   || $email_only != $result['email_only']
+				   || ($speciallogfile != $result['speciallogfile'] && $_POST['speciallogverified'] == '1'))
 				{
 					inserttask('1');
 				}
 
+				if($speciallogfile != $result['speciallogfile'] && $_POST['speciallogverified'] != '1') $speciallogfile = $result['speciallogfile'];
+
 				if($isbinddomain != $result['isbinddomain']
 				   || $zonefile != $result['zonefile']
 				   || $dkim != $result['dkim']
@@ -1105,7 +1147,7 @@ if($page == 'domains'
 					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `domains_used` = `domains_used` - 1 WHERE `adminid` = '" . (int)$result['adminid'] . "' ");
 				}
 
-				$ssfs = isset($_POST['specialsettingsforsubdomains']) ? intval($_POST['specialsettingsforsubdomains']) : 1;
+				$ssfs = isset($_POST['specialsettingsforsubdomains']) ? 1 : 0;
 				if($ssfs == 1)
 				{
 					$upd_specialsettings = ", `specialsettings`='" . $db->escape($specialsettings) . "' ";
@@ -1117,8 +1159,8 @@ if($page == 'domains'
 					$log->logAction(ADM_ACTION, LOG_INFO, "removed specialsettings on all subdomains of domain #" . $id);
 				}
 
-				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `documentroot`='" . $db->escape($documentroot) . "', `ipandport`='" . $db->escape($ipandport) . "', `ssl`='" . (int)$ssl . "', `ssl_redirect`='" . (int)$ssl_redirect . "', `ssl_ipandport`='" . (int)$ssl_ipandport . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", `isbinddomain`='" . $db->escape($isbinddomain) . "', `isemaildomain`='" . $db->escape($isemaildomain) . "', `email_only`='" . $db->escape($email_only) . "', `subcanemaildomain`='" . $db->escape($subcanemaildomain) . "', `dkim`='" . $db->escape($dkim) . "', `caneditdomain`='" . $db->escape($caneditdomain) . "', `zonefile`='" . $db->escape($zonefile) . "', `wwwserveralias`='" . $db->escape($wwwserveralias) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `safemode`='" . $db->escape($safemode) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "', `specialsettings`='" . $db->escape($specialsettings) . "', `registration_date`='" . $db->escape($registration_date) . "', `ismainbutsubto`='" . (int)$issubof . "' WHERE `id`='" . (int)$id . "'");
-				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `ipandport`='" . $db->escape($ipandport) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `safemode`='" . $db->escape($safemode) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "'" . $upd_specialsettings . $updatechildren . " WHERE `parentdomainid`='" . (int)$id . "'");
+				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `documentroot`='" . $db->escape($documentroot) . "', `ipandport`='" . $db->escape($ipandport) . "', `ssl`='" . (int)$ssl . "', `ssl_redirect`='" . (int)$ssl_redirect . "', `ssl_ipandport`='" . (int)$ssl_ipandport . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ", `isbinddomain`='" . $db->escape($isbinddomain) . "', `isemaildomain`='" . $db->escape($isemaildomain) . "', `email_only`='" . $db->escape($email_only) . "', `subcanemaildomain`='" . $db->escape($subcanemaildomain) . "', `dkim`='" . $db->escape($dkim) . "', `caneditdomain`='" . $db->escape($caneditdomain) . "', `zonefile`='" . $db->escape($zonefile) . "', `wwwserveralias`='" . $db->escape($wwwserveralias) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `speciallogfile`='" . $db->escape($speciallogfile) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "', `specialsettings`='" . $db->escape($specialsettings) . "', `registration_date`='" . $db->escape($registration_date) . "', `ismainbutsubto`='" . (int)$issubof . "' WHERE `id`='" . (int)$id . "'");
+				$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `customerid` = '" . (int)$customerid . "', `adminid` = '" . (int)$adminid . "', `ipandport`='" . $db->escape($ipandport) . "', `openbasedir`='" . $db->escape($openbasedir) . "', `speciallogfile`='" . $db->escape($speciallogfile) . "', `phpsettingid`='" . $db->escape($phpsettingid) . "', `mod_fcgid_starter`='" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests`='" . $db->escape($mod_fcgid_maxrequests) . "'" . $upd_specialsettings . $updatechildren . " WHERE `parentdomainid`='" . (int)$id . "'");
 				$log->logAction(ADM_ACTION, LOG_INFO, "edited domain #" . $id);
 				$redirect_props = Array(
 					'page' => $page,
@@ -1218,20 +1260,11 @@ if($page == 'domains'
 				}
 
 				$result['specialsettings'] = $result['specialsettings'];
-				#$isbinddomain = makeyesno('isbinddomain', '1', '0', $result['isbinddomain']);
-				#$wwwserveralias = makeyesno('wwwserveralias', '1', '0', $result['wwwserveralias']);
-				#$isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
-				#$email_only = makeyesno('email_only', '1', '0', $result['email_only']);
-				#$ssl = makeyesno('ssl', '1', '0', $result['ssl']);
-				#$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
+
 				$subcanemaildomain = makeoption($lng['admin']['subcanemaildomain']['never'], '0', $result['subcanemaildomain'], true, true);
 				$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableno'], '1', $result['subcanemaildomain'], true, true);
 				$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['choosableyes'], '2', $result['subcanemaildomain'], true, true);
 				$subcanemaildomain.= makeoption($lng['admin']['subcanemaildomain']['always'], '3', $result['subcanemaildomain'], true, true);
-				#$dkim = makeyesno('dkim', '1', '0', $result['dkim']);
-				#$caneditdomain = makeyesno('caneditdomain', '1', '0', $result['caneditdomain']);
-				#$openbasedir = makeyesno('openbasedir', '1', '0', $result['openbasedir']);
-				#$safemode = makeyesno('safemode', '1', '0', $result['safemode']);
 				$speciallogfile = ($result['speciallogfile'] == 1 ? $lng['panel']['yes'] : $lng['panel']['no']);
 				$result['add_date'] = date('Y-m-d', $result['add_date']);
 
@@ -1243,8 +1276,6 @@ if($page == 'domains'
 					$phpconfigs.= makeoption($phpconfigs_row['description'], $phpconfigs_row['id'], $result['phpsettingid'], true, true);
 				}
 
-				#$specialsettingsforsubdomains = makeyesno('specialsettingsforsubdomains', '1', '0', '1');
-
 				$result = htmlentities_array($result);
 
 				$domain_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/domains/formfield.domains_edit.php';
@@ -1253,6 +1284,8 @@ if($page == 'domains'
 				$title = $domain_edit_data['domain_edit']['title'];
 				$image = $domain_edit_data['domain_edit']['image'];
 
+				$speciallogwarning = sprintf($lng['admin']['speciallogwarning'], $lng['admin']['delete_statistics']);
+
 				eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
 			}
 		}

admin_index.php

@@ -104,11 +104,13 @@ if($page == 'overview')
 					$_message = isset($latestversion[1]) ? $latestversion[1] : '';
 					$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
 
-					$lookfornewversion_lable = $_version;
+					// add the branding so debian guys are not gettings confused
+					// about their version-number
+					$lookfornewversion_lable = $_version.$branding;
 					$lookfornewversion_link = $_link;
 					$lookfornewversion_addinfo = $_message;
 
-					if (version_compare($version, $_version) == -1) {
+					if (version_compare2($version, $_version) == -1) {
 						$isnewerversion = 1;
 					} else {
 						$isnewerversion = 0;

admin_ipsandports.php

@@ -104,7 +104,10 @@ if($page == 'ipsandports'
 								$db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'");
 								$log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'");
 								inserttask('1');
+
+								// Using nameserver, insert a task which rebuilds the server config
 								inserttask('4');
+
 								redirectTo($filename, Array('page' => $page, 's' => $s));
 							}
 							else
@@ -136,11 +139,11 @@ if($page == 'ipsandports'
 		{
 			$ip = validate_ip($_POST['ip']);
 			$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
-			$listen_statement = intval($_POST['listen_statement']);
-			$namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
-			$vhostcontainer = intval($_POST['vhostcontainer']);
+			$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
+			$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
+			$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
 			$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
-			$vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
+			$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
 			$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
 			$docroot = validate($_POST['docroot'], 'docroot');
 			if((int)$settings['system']['use_ssl'] == 1)
@@ -245,17 +248,22 @@ if($page == 'ipsandports'
 
 				$log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'");
 				inserttask('1');
+
+				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
+
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 		}
 		else
 		{
-			#$enable_ssl = makeyesno('ssl', '1', '0', '0');
-			#$listen_statement = makeyesno('listen_statement', '1', '0', '1');
-			#$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1');
-			#$vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1');
-			#$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1');
+			/*
+			$enable_ssl = makeyesno('ssl', '1', '0', '0');
+			$listen_statement = makeyesno('listen_statement', '1', '0', '1');
+			$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1');
+			$vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1');
+			$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1');
+			*/
 
 			$ipsandports_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_add.php';
 			$ipsandports_add_form = htmlform::genHTMLForm($ipsandports_add_data);
@@ -280,16 +288,23 @@ if($page == 'ipsandports'
 				$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
 				$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");
 				$result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'");
-				$listen_statement = intval($_POST['listen_statement']);
-				$namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
-				$vhostcontainer = intval($_POST['vhostcontainer']);
+				$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
+				$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
+				$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
 				$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
-				$vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
+				$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
 				$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
 				$docroot =  validate($_POST['docroot'], 'docroot');
-				if((int)$settings['system']['use_ssl'] == 1)
-				{
-					$ssl = intval($_POST['ssl']);
+
+				if((int)$settings['system']['use_ssl'] == 1
+					/* 
+					 * check here if ssl is even checked, cause if not, we don't need
+					 * to validate and set all the $ssl_*_file vars
+					 */
+					&& isset($_POST['ssl'])
+					&& $_POST['ssl'] != 0
+				) {
+					$ssl = 1;
 					$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
 					$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
 					$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
@@ -391,18 +406,23 @@ if($page == 'ipsandports'
 
 					$log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'");
 					inserttask('1');
+
+					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
+
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
 			else
 			{
-				#$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
 				$result = htmlentities_array($result);
-				#$listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']);
-				#$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']);
-				#$vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']);
-				#$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']);
+				/*
+				$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
+				$listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']);
+				$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']);
+				$vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']);
+				$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']);
+				*/
 
 				$ipsandports_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_edit.php';
 				$ipsandports_edit_form = htmlform::genHTMLForm($ipsandports_edit_data);

admin_logger.php

@@ -22,14 +22,12 @@ define('AREA', 'admin');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
+require('./lib/init.php');
 
-require ("./lib/init.php");
-
-if($page == 'log'
-   && $userinfo['change_serversettings'] == '1')
-{
-	if($action == '')
-	{
+if ($page == 'log'
+   && $userinfo['change_serversettings'] == '1'
+) {
+	if ($action == '') {
 		$fields = array(
 			'date' => $lng['logger']['date'],
 			'type' => $lng['logger']['type'],
@@ -47,24 +45,21 @@ if($page == 'log'
 		$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
 		$clog = array();
 
-		while($row = $db->fetch_array($result))
-		{
-			if(!isset($clog[$row['action']])
-			   || !is_array($clog[$row['action']]))
-			{
+		while ($row = $db->fetch_array($result)) {
+			if (!isset($clog[$row['action']])
+			   || !is_array($clog[$row['action']])
+			) {
 				$clog[$row['action']] = array();
 			}
 
 			$clog[$row['action']][$row['logid']] = $row;
 		}
 
-		if($paging->sortfield == 'date'
-		   && $paging->sortorder == 'desc')
-		{
+		if ($paging->sortfield == 'date'
+		   && $paging->sortorder == 'desc'
+		) {
 			krsort($clog);
-		}
-		else
-		{
+		} else {
 			ksort($clog);
 		}
 
@@ -72,20 +67,15 @@ if($page == 'log'
 		$count = 0;
 		$log_count = 0;
 		$log = '';
-		foreach($clog as $action => $logrows)
-		{
+		foreach ($clog as $action => $logrows) {
 			$_action = 0;
-			foreach($logrows as $row)
-			{
-				if($paging->checkDisplay($i))
-				{
+			foreach ($logrows as $row) {
+				if ($paging->checkDisplay($i)) {
 					$row = htmlentities_array($row);
 					$row['date'] = date("d.m.y H:i:s", $row['date']);
 
-					if($_action != $action)
-					{
-						switch($action)
-						{
+					if ($_action != $action) {
+						switch ($action) {
 							case USR_ACTION:
 								$_action = $lng['admin']['customer'];
 								break;
@@ -107,15 +97,14 @@ if($page == 'log'
 						}
 
 						$row['action'] = $_action;
-						eval("\$log.=\"" . getTemplate("logger/logger_action") . "\";");
+						eval("\$log.=\"" . getTemplate('logger/logger_action') . "\";");
 					}
 
 					$log_count++;
 					$type = $row['type'];
 					$_type = 'unknown';
 
-					switch($type)
-					{
+					switch ($type) {
 						case LOG_INFO:
 							$_type = 'Information';
 							break;
@@ -137,32 +126,27 @@ if($page == 'log'
 					}
 
 					$row['type'] = $_type;
-					eval("\$log.=\"" . getTemplate("logger/logger_log") . "\";");
+					eval("\$log.=\"" . getTemplate('logger/logger_log') . "\";");
 					$count++;
 					$_action = $action;
 				}
 			}
-
 			$i++;
 		}
 
-		eval("echo \"" . getTemplate("logger/logger") . "\";");
-	}
-	elseif($action == 'truncate')
-	{
-		if(isset($_POST['send'])
-		   && $_POST['send'] == 'send')
-		{
+		eval("echo \"" . getTemplate('logger/logger') . "\";");
+	} elseif ($action == 'truncate') {
+		if (isset($_POST['send'])
+		   && $_POST['send'] == 'send'
+		) {
 			$yesterday = time() - (60 * 10);
 
 			/* (60*60*24); */
 
 			$db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'");
-			$log->logAction(ADM_ACTION, LOG_WARNING, "truncated the system-log (mysql)");
+			$log->logAction(ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)');
 			redirectTo($filename, Array('page' => $page, 's' => $s));
-		}
-		else
-		{
+		} else {
 			ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG);
 		}
 	}

admin_message.php

@@ -22,79 +22,60 @@ define('AREA', 'admin');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
+require('./lib/init.php');
 
-require ("./lib/init.php");
-
-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif (isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }
 
-if($page == 'message')
-{
-	if($action == '')
-	{
-		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed panel_message");
+if ($page == 'message') {
+	if ($action == '') {
+		$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed panel_message');
 
-		if(isset($_POST['send'])
-		   && $_POST['send'] == 'send')
-		{
-			if($_POST['receipient'] == 0
-			   && $userinfo['customers_see_all'] == '1')
-			{
-				$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to admins");
+		if (isset($_POST['send'])
+		   && $_POST['send'] == 'send'
+		) {
+			if ($_POST['receipient'] == 0
+			   && $userinfo['customers_see_all'] == '1'
+			) {
+				$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to admins');
 				$result = $db->query('SELECT `name`, `email`  FROM `' . TABLE_PANEL_ADMINS . "`");
-			}
-			elseif($_POST['receipient'] == 1)
-			{
-				if($userinfo['customers_see_all'] == "1")
-				{
-					$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to ALL customers");
+			} elseif ($_POST['receipient'] == 1) {
+				if ($userinfo['customers_see_all'] == '1') {
+					$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers');
 					$result = $db->query('SELECT `firstname`, `name`, `email`  FROM `' . TABLE_PANEL_CUSTOMERS . "`");
-				}
-				else
-				{
-					$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to customers");
+				} else {
+					$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to customers');
 					$result = $db->query('SELECT `firstname`, `name`, `email`  FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'");
 				}
-			}
-			else
-			{
+			} else {
 				standard_error('noreceipientsgiven');
 			}
 
 			$subject = $_POST['subject'];
 			$message = wordwrap($_POST['message'], 70);
 
-			if(!empty($message))
-			{
+			if (!empty($message)) {
 				$mailcounter = 0;
 				$mail->Body = $message;
 				$mail->Subject = $subject;
 
-				while($row = $db->fetch_array($result))
-				{
+				while ($row = $db->fetch_array($result)) {
 					$mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']);
 					$mail->From = $userinfo['email'];
 					$mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name'];
 
-					if(!$mail->Send())
-					{
-						if($mail->ErrorInfo != '')
-						{
+					if (!$mail->Send()) {
+						if ($mail->ErrorInfo != '') {
 							$mailerr_msg = $mail->ErrorInfo;
-						}
-						else
-						{
-							$mailerr_msg = $row["email"];
+						} else {
+							$mailerr_msg = $row['email'];
 						}
 
-						$log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
-						standard_error('errorsendingmail', $row["email"]);
+						$log->logAction(ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg);
+						standard_error('errorsendingmail', $row['email']);
 					}
 
 					$mailcounter++;
@@ -102,47 +83,34 @@ if($page == 'message')
 				}
 
 				redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter));
-			}
-			else
-			{
+			} else {
 				standard_error('nomessagetosend');
 			}
 		}
 	}
 
-	if($action == 'showsuccess')
-	{
+	if ($action == 'showsuccess') {
 		$success = 1;
 		$sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0;
 
-		if($sentitems == 0)
-		{
+		if ($sentitems == 0) {
 			$successmessage = $lng['message']['noreceipients'];
-		}
-		else
-		{
+		} else {
 			$successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
 		}
-
-		$action = '';
-	}
-	else
-	{
+	} else {
 		$success = 0;
 		$sentitems = 0;
 		$successmessage = '';
-		$action = '';
 	}
+	$action = '';
 
 	$receipients = '';
 
-	if($userinfo['customers_see_all'] == "1")
-	{
+	if ($userinfo['customers_see_all'] == '1') {
 		$receipients.= makeoption($lng['panel']['reseller'], 0);
 	}
 
-	$receipients.= makeoption($lng['panel']['customer'], 1);
-	eval("echo \"" . getTemplate("message/message") . "\";");
+	$receipients .= makeoption($lng['panel']['customer'], 1);
+	eval("echo \"" . getTemplate('message/message') . "\";");
 }
-
-?>

admin_phpsettings.php

@@ -25,47 +25,54 @@ define('AREA', 'admin');
 
 require ("./lib/init.php");
 
-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif (isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }
 
-if($page == 'overview')
-{
-	if($action == '')
-	{
+if ($page == 'overview') {
+
+	if ($action == '') {
+
 		$tablecontent = '';
 		$count = 0;
 		$result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`");
 
-		while($row = $db->fetch_array($result))
-		{
+		while ($row = $db->fetch_array($result)) {
+
 			$domainresult = false;
 
-			if((int)$userinfo['domains_see_all'] == 0)
-			{
-				$domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `adminid` = " . (int)$userinfo['userid'] . " AND `phpsettingid` = " . (int)$row['id']);
-			}
-			else
-			{
-				$domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `phpsettingid` = " . (int)$row['id']);
+			$query = "SELECT * FROM `".TABLE_PANEL_DOMAINS."`
+					WHERE `phpsettingid` = '".(int)$row['id']."'
+					AND `parentdomainid` = '0'";
+
+			if ((int)$userinfo['domains_see_all'] == 0) {
+				$query .= " AND `adminid` = '".(int)$userinfo['userid']."'";
 			}
 
-			$domains = '';
-
-			if($db->num_rows($domainresult) > 0)
-			{
-				while($row2 = $db->fetch_array($domainresult))
-				{
-					$domains.= $row2['domain'] . '<br/>';
+			if ((int)$settings['panel']['phpconfigs_hidestdsubdomain'] == 1) {
+				$query2 = "SELECT DISTINCT `standardsubdomain`
+						FROM `".TABLE_PANEL_CUSTOMERS."`
+						WHERE `standardsubdomain` > 0 ORDER BY `standardsubdomain` ASC;";
+				$ssdids_res = $db->query($query2);
+				$ssdids = array();
+				while ($ssd = $db->fetch_array($ssdids_res)) {
+					$ssdids[] = $ssd['standardsubdomain'];
+				}
+				if (count($ssdids) > 0) {
+					$query .= " AND `id` NOT IN (".implode(', ', $ssdids).")";
 				}
 			}
-			else
-			{
+
+			$domainresult = $db->query($query);
+
+			$domains = '';
+			if ($db->num_rows($domainresult) > 0) {
+				while ($row2 = $db->fetch_array($domainresult)) {
+					$domains.= $row2['domain'] . '<br/>';
+				}
+			} else {
 				$domains = $lng['admin']['phpsettings']['notused'];
 			}
 

admin_settings.php

@@ -82,9 +82,9 @@ if(($page == 'settings' || $page == 'overview')
 		) {
 			$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
 			inserttask('1');
+			// Using nameserver, insert a task which rebuilds the server config
 			inserttask('4');
-			inserttask('5');
-			inserttask('9');
+
 			standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page));
 		}
 	}
@@ -123,10 +123,10 @@ elseif($page == 'rebuildconfigs'
 	{
 		$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles");
 		inserttask('1');
-		inserttask('4');
-		inserttask('5');
-		inserttask('9');
 		inserttask('10');
+		// Using nameserver, insert a task which rebuilds the server config
+		inserttask('4');
+
 		standard_success('rebuildingconfigs', '', array('filename' => 'admin_index.php'));
 	}
 	else

admin_templates.php

@@ -48,17 +48,28 @@ elseif(isset($_GET['id']))
 $available_templates = array(
 	'createcustomer',
 	'pop_success',
-	'trafficmaxpercent',
-	'diskmaxpercent',
-	'new_ticket_by_customer',
-	'new_ticket_for_customer',
-	'new_ticket_by_staff',
-	'new_reply_ticket_by_customer',
-	'new_reply_ticket_by_staff',
 	'new_database_by_customer',
 	'new_ftpaccount_by_customer',
 	'password_reset'
 );
+
+// only show templates of features that are enabled #1191
+if ((int)$settings['system']['report_enable'] == 1) {
+	array_push($available_templates,
+		'trafficmaxpercent',
+		'diskmaxpercent'
+	);
+}
+if ((int)$settings['ticket']['enabled'] == 1) {
+	array_push($available_templates,
+		'new_ticket_by_customer',
+		'new_ticket_for_customer',
+		'new_ticket_by_staff',
+		'new_reply_ticket_by_customer',
+		'new_reply_ticket_by_staff'
+	);
+}
+
 $file_templates = array(
 	'index_html'
 );

admin_tickets.php

@@ -32,6 +32,22 @@ if(isset($_POST['id']))
 elseif(isset($_GET['id']))
 {
 	$id = intval($_GET['id']);
+
+	// only check if this is not a category-id
+	if (!isset($_GET['page']) || (isset($_GET['page']) && $_GET['page'] != 'categories')) {
+		if (!$userinfo['customers_see_all']) {
+			/*
+			 * Check if the current user is allowed to see the current ticket.
+			 */
+			$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `adminid` = '".$userinfo['admindid']."'";
+
+			$result = $db->query_first($sql);
+			if ($result == null) {
+				// no rights to see the requested ticket
+				standard_error(array('ticketnotaccessible'));
+			}
+		}
+	}
 }
 
 if($page == 'tickets'
@@ -102,13 +118,17 @@ if($page == 'tickets'
 					if($_cid != $row['customerid'])
 					{
 						$cid = $row['customerid'];
-						$usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
                                      WHERE `customerid` = "' . (int)$cid . '"');
 
-						if(isset($usr['loginname'])) {
-							$customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
-							//$customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
-						} else {
+						if(isset($usr['loginname']))
+						{
+							$customer = getCorrectFullUserDetails($usr);
+							$customerloginname =  $usr['loginname'];
+							$customerid = $usr['customerid'];
+						}
+						else
+						{
 							$customer = $lng['ticket']['nonexistingcustomer'];
 						}
 						eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
@@ -199,12 +219,16 @@ if($page == 'tickets'
 			else
 			{
 				$categories = '';
-				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
+				$where = '';
+				if ($userinfo['tickets_see_all'] != '1') {
+					$where = 'WHERE `adminid` = "' . $userinfo['adminid'] . '"';
+				}
+				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');
 
 				if(isset($result['name'])
 				   && $result['name'] != '')
 				{
-					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
+					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');
 
 					while($row = $db->fetch_array($result2))
 					{
@@ -302,13 +326,20 @@ if($page == 'tickets'
 				$isclosed = 1;
 			}
 
-			if($mainticket->Get('by') == '1')
+			if ($mainticket->Get('by') == '1')
 			{
 				$by = $lng['ticket']['staff'];
 			}
 			else
 			{
-				$by = $lng['ticket']['customer'];
+				$cid = $mainticket->Get('customer');
+				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+				);
+				$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+				$by .= getCorrectFullUserDetails($usr).'</a>';
+				//$by = $lng['ticket']['customer'];
 			}
 
 			$subject = $mainticket->Get('subject');
@@ -330,7 +361,14 @@ if($page == 'tickets'
 				}
 				else
 				{
-					$by = $lng['ticket']['customer'];
+					$cid = $subticket->Get('customer');
+					$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+					);
+					$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+					$by .= getCorrectFullUserDetails($usr).'</a>';
+					//$by = $lng['ticket']['customer'];
 				}
 
 				$subject = $subticket->Get('subject');
@@ -437,11 +475,16 @@ elseif($page == 'categories'
 			'name' => $lng['ticket']['category'],
 			'logicalorder' => $lng['ticket']['logicalorder']
 		);
+
+		$where = '1'; // WHERE 1 is like no 'where-clause'
+		if ($userinfo['tickets_see_all'] != '1') {
+			$where = " `main`.`adminid` = '" . (int)$userinfo['adminid'] . "'";
+		}
 		$paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, (
                               SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub`
                               WHERE `sub`.`category` = `main`.`id`
-                              AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
+                              AND `sub`.`answerto` = '0'  AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
                               as `ticketcount`, (
                               SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2`
                               WHERE `sub2`.`category` = `main`.`id`
@@ -449,7 +492,7 @@ elseif($page == 'categories'
                               AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2')
                               AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "'
                               ) as `ticketcountnotclosed`
-                              FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE `main`.`adminid` = '" . (int)$userinfo['adminid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+                              FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE " . $where . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -486,7 +529,7 @@ elseif($page == 'categories'
 			if($order < 1 || $order >= 1000)
 			{
 				// use the latest available
-				$order = ticket::getHighestOrderNumber($db) + 1;
+				$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1;
 			}
 
 			if($category == '')
@@ -502,7 +545,7 @@ elseif($page == 'categories'
 		}
 		else
 		{
-			$order = ticket::getHighestOrderNumber($db) + 1;
+			$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1;
 
 			$category_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_new.php';
 			$category_new_form = htmlform::genHTMLForm($category_new_data);
@@ -660,12 +703,17 @@ elseif($page == 'archive'
 						if($_cid != $ticket['customerid'])
 						{
 							$cid = $ticket['customerid'];
-							$usr = $db->query_first('SELECT `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
+							$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
                                        WHERE `customerid` = "' . (int)$cid . '"');
 
-							if(isset($usr['loginname'])) {
-								$customer = getCorrectFullUserDetails($usr) . ' (' . $usr['loginname'] . ')';
-							} else {
+							if(isset($usr['loginname']))
+							{
+								$customer = getCorrectFullUserDetails($usr);
+								$customerloginname =  $usr['loginname'];
+								$customerid = $usr['customerid'];
+							}
+							else
+							{
 								$customer = $lng['ticket']['nonexistingcustomer'];
 							}
 
@@ -681,7 +729,7 @@ elseif($page == 'archive'
 							break;
 							case 3: $ticket['display'] = 'low';
 							break;
-							default: $ticket['display'] = 'unknown'; 
+							default: $ticket['display'] = 'unknown';
 						}
 						$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);
 
@@ -782,11 +830,18 @@ elseif($page == 'archive'
 		}
 		else
 		{
-			$by = $lng['ticket']['customer'];
+			$cid = $mainticket->Get('customer');
+			$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+			);
+			$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+			$by .= getCorrectFullUserDetails($usr).'</a>';
+			//$by = $lng['ticket']['customer'];
 		}
 
-		$subject = htmlentities($mainticket->Get('subject'));
-		$message = htmlentities($mainticket->Get('message'));
+		$subject = $mainticket->Get('subject');
+		$message = $mainticket->Get('message');
 		eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
 		$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
                               WHERE `id`="' . (int)$mainticket->Get('category') . '"');
@@ -804,22 +859,28 @@ elseif($page == 'archive'
 			}
 			else
 			{
-				$by = $lng['ticket']['customer'];
+				$cid = $subticket->Get('customer');
+				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+				);
+				$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+				$by .= getCorrectFullUserDetails($usr).'</a>';
+				//$by = $lng['ticket']['customer'];
 			}
 
-			$subject = htmlentities($subticket->Get('subject'));
-			$message = htmlentities($subticket->Get('message'));
+			$subject = $subticket->Get('subject');
+			$message = $subticket->Get('message');
 			eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
 		}
 
 		$priorities = makeoption($lng['ticket']['high'], '1', htmlentities($mainticket->Get('priority')), true, true);
 		$priorities.= makeoption($lng['ticket']['normal'], '2', htmlentities($mainticket->Get('priority')), true, true);
 		$priorities.= makeoption($lng['ticket']['low'], '3', htmlentities($mainticket->Get('priority')), true, true);
-		$subject = htmlentities($mainticket->Get('subject'));
+		$subject = $mainticket->Get('subject');
 		$ticket_replies_count = $db->num_rows($andere) + 1;
 
 		// don't forget the main-ticket!
-
 		eval("echo \"" . getTemplate("tickets/tickets_view") . "\";");
 	}
 	elseif($action == 'delete'
@@ -839,6 +900,6 @@ elseif($page == 'archive'
 			ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
 		}
 	}
+} else {
+	standard_error('nocustomerforticket');
 }
-
-?>

admin_traffic.php

@@ -128,7 +128,7 @@ if($page == 'overview' || $page == 'customers')
 			
 			$traffic_list = $db->query("SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE year = " . (date("Y")-$years) . " AND `customerid` = '" . $customer_name['customerid'] . "' GROUP BY month ORDER BY month");
 			while($traffic_month = $db->fetch_array($traffic_list)) {
-				$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.3f %s');
+				$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s');
 				$totals[$months[(int)$traffic_month['month']]] += $traffic_month['traffic'];
 			}
 			eval("\$domain_list .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
@@ -138,7 +138,7 @@ if($page == 'overview' || $page == 'customers')
 			'name' => $lng['traffic']['months']['total'],
 		);
 		foreach($totals as $month => $bytes) {
-			$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.3f %s'));
+			$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s'));
 		}
 		$customerview = 0;
 		eval("\$total_list = sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");

admin_updates.php

@@ -16,10 +16,9 @@
  */
 
 define('AREA', 'admin');
-require ("./lib/init.php");
+require('./lib/init.php');
 
-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates");
 
 	/**
@@ -29,13 +28,13 @@ if($page == 'overview')
 	 */
 	if (!isFroxlor()) {
 		if (!isset($settings['panel']['version'])
-		|| $settings['panel']['version'] == ''
+			|| $settings['panel']['version'] == ''
 		) {
 			$settings['panel']['version'] = '1.4.2.1';
 			$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')");
 		}
 		if (!isset($settings['system']['dbversion'])
-		|| $settings['system']['dbversion'] == ''
+			|| $settings['system']['dbversion'] == ''
 		) {
 			/**
 			 * for syscp-stable (1.4.2.1) this value has to be 0
@@ -43,11 +42,9 @@ if($page == 'overview')
 			 * and the svn-version has its value in the database
 			 * -> bug #54
 			 */
-			
 			$result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'");
-			
-			if(isset($result['value']))
-			{
+
+			if (isset($result['value'])) {
 				$settings['system']['dbversion'] = (int)$result['value'];
 			} else {
 				$settings['system']['dbversion'] = 0;
@@ -55,40 +52,36 @@ if($page == 'overview')
 		}
 	}
 
-	if(hasUpdates($version))
-	{
+	if (hasUpdates($version)) {
 		$successful_update = false;
 		$message = '';
 
-		if(isset($_POST['send'])
-		&& $_POST['send'] == 'send')
-		{
-			if((isset($_POST['update_preconfig'])
+		if (isset($_POST['send'])
+			&& $_POST['send'] == 'send'
+		) {
+			if ((isset($_POST['update_preconfig'])
 				&& isset($_POST['update_changesagreed'])
 				&& intval($_POST['update_changesagreed']) != 0)
 				|| !isset($_POST['update_preconfig'])
 			) {
-				eval("echo \"" . getTemplate("update/update_start") . "\";");
+				eval("echo \"" . getTemplate('update/update_start') . "\";");
 	
 				include_once './install/updatesql.php';
 	
 				$redirect_url = 'admin_index.php?s=' . $s;
-				eval("echo \"" . getTemplate("update/update_end") . "\";");
+				eval("echo \"" . getTemplate('update/update_end') . "\";");
 	
 				updateCounters();
 				inserttask('1');
 				@chmod('./lib/userdata.inc.php', 0440);
 				
 				$successful_update = true;
-			}
-			else
-			{
-				$message = '<br /><strong style="color:#ff0000;">You have to agree that you have read the update notifications.</strong>';
+			} else {
+				$message = '<br /><strong style="color: red">You have to agree that you have read the update notifications.</strong>';
 			}
 		}
 
-		if(!$successful_update)
-		{
+		if (!$successful_update) {
 			$current_version = $settings['panel']['version'];
 			$new_version = $version;
 
@@ -96,29 +89,23 @@ if($page == 'overview')
 			$ui_text = str_replace('%curversion', $current_version, $ui_text);
 			$ui_text = str_replace('%newversion', $new_version, $ui_text);
 			$update_information = $ui_text;
-			
+
 			include_once './install/updates/preconfig.php';
 			$preconfig = getPreConfig($current_version);
-			if($preconfig != '')
-			{
-				$update_information .= '<br />'.$preconfig.$message;
+			if ($preconfig != '') {
+				$update_information .= '<br />' . $preconfig . $message;
 			}
-			
+
 			$update_information .= $lng['update']['update_information']['part_b'];
 
-			eval("echo \"" . getTemplate("update/index") . "\";");
+			eval("echo \"" . getTemplate('update/index') . "\";");
 		}
-	}
-	else
-	{
+	} else {
 		/*
 		 * @TODO version-webcheck check here
 		 */
-
 		$success_message = $lng['update']['noupdatesavail'];
 		$redirect_url = 'admin_index.php?s=' . $s;
-		eval("echo \"" . getTemplate("update/noupdatesavail") . "\";");
+		eval("echo \"" . getTemplate('update/noupdatesavail') . "\";");
 	}
 }
-
-?>

css/jquery.jqplot.css

@@ -0,0 +1,226 @@
+/*rules for the plot target div.  These will be cascaded down to all plot elements according to css rules*/
+.jqplot-target {
+    position: relative;
+    color: #666666;
+    font-family: "Trebuchet MS", Arial, Helvetica, sans-serif;
+    font-size: 1em;
+/*    height: 300px;
+    width: 400px;*/
+}
+
+/*rules applied to all axes*/
+.jqplot-axis {
+    font-size: 0.75em;
+}
+
+.jqplot-xaxis {
+    margin-top: 10px;
+}
+
+.jqplot-x2axis {
+    margin-bottom: 10px;
+}
+
+.jqplot-yaxis {
+    margin-right: 10px;
+}
+
+.jqplot-y2axis, .jqplot-y3axis, .jqplot-y4axis, .jqplot-y5axis, .jqplot-y6axis, .jqplot-y7axis, .jqplot-y8axis, .jqplot-y9axis {
+    margin-left: 10px;
+    margin-right: 10px;
+}
+
+/*rules applied to all axis tick divs*/
+.jqplot-axis-tick, .jqplot-xaxis-tick, .jqplot-yaxis-tick, .jqplot-x2axis-tick, .jqplot-y2axis-tick, .jqplot-y3axis-tick, .jqplot-y4axis-tick, .jqplot-y5axis-tick, .jqplot-y6axis-tick, .jqplot-y7axis-tick, .jqplot-y8axis-tick, .jqplot-y9axis-tick {
+    position: absolute;
+}
+
+
+.jqplot-xaxis-tick {
+    top: 0px;
+    /* initial position untill tick is drawn in proper place */
+    left: 15px;
+/*    padding-top: 10px;*/
+    vertical-align: top;
+}
+
+.jqplot-x2axis-tick {
+    bottom: 0px;
+    /* initial position untill tick is drawn in proper place */
+    left: 15px;
+/*    padding-bottom: 10px;*/
+    vertical-align: bottom;
+}
+
+.jqplot-yaxis-tick {
+    right: 0px;
+    /* initial position untill tick is drawn in proper place */
+    top: 15px;
+/*    padding-right: 10px;*/
+    text-align: right;
+}
+
+.jqplot-yaxis-tick.jqplot-breakTick {
+	right: -20px;
+	margin-right: 0px;
+	padding:1px 5px 1px 5px;
+/*	background-color: white;*/
+	z-index: 2;
+	font-size: 1.5em;
+}
+
+.jqplot-y2axis-tick, .jqplot-y3axis-tick, .jqplot-y4axis-tick, .jqplot-y5axis-tick, .jqplot-y6axis-tick, .jqplot-y7axis-tick, .jqplot-y8axis-tick, .jqplot-y9axis-tick {
+    left: 0px;
+    /* initial position untill tick is drawn in proper place */
+    top: 15px;
+/*    padding-left: 10px;*/
+/*    padding-right: 15px;*/
+    text-align: left;
+}
+
+.jqplot-meterGauge-tick {
+    font-size: 0.75em;
+    color: #999999;
+}
+
+.jqplot-meterGauge-label {
+    font-size: 1em;
+    color: #999999;
+}
+.jqplot-xaxis-label {
+    margin-top: 10px;
+    font-size: 11pt;
+    position: absolute;
+}
+
+.jqplot-x2axis-label {
+    margin-bottom: 10px;
+    font-size: 11pt;
+    position: absolute;
+}
+
+.jqplot-yaxis-label {
+    margin-right: 10px;
+/*    text-align: center;*/
+    font-size: 11pt;
+    position: absolute;
+}
+
+.jqplot-y2axis-label, .jqplot-y3axis-label, .jqplot-y4axis-label, .jqplot-y5axis-label, .jqplot-y6axis-label, .jqplot-y7axis-label, .jqplot-y8axis-label, .jqplot-y9axis-label {
+/*    text-align: center;*/
+    font-size: 11pt;
+    position: absolute;
+}
+
+table.jqplot-table-legend {
+    margin-top: 12px;
+    margin-bottom: 12px;
+    margin-left: 12px;
+    margin-right: 12px;
+}
+
+table.jqplot-table-legend, table.jqplot-cursor-legend {
+    background-color: rgba(255,255,255,0.6);
+    border: 1px solid #cccccc;
+    position: absolute;
+    font-size: 0.75em;
+}
+
+td.jqplot-table-legend {
+    vertical-align:middle;
+}
+
+td.jqplot-seriesToggle:hover, td.jqplot-seriesToggle:active {
+    cursor: pointer;
+}
+
+td.jqplot-table-legend > div {
+    border: 1px solid #cccccc;
+    padding:1px;
+}
+
+div.jqplot-table-legend-swatch {
+    width:0px;
+    height:0px;
+    border-top-width: 5px;
+    border-bottom-width: 5px;
+    border-left-width: 6px;
+    border-right-width: 6px;
+    border-top-style: solid;
+    border-bottom-style: solid;
+    border-left-style: solid;
+    border-right-style: solid;
+}
+
+.jqplot-title {
+    top: 0px;
+    left: 0px;
+    padding-bottom: 0.5em;
+    font-size: 1.2em;
+}
+
+table.jqplot-cursor-tooltip {
+    border: 1px solid #cccccc;
+    font-size: 0.75em;
+}
+
+
+.jqplot-cursor-tooltip {
+    border: 1px solid #cccccc;
+    font-size: 0.75em;
+    white-space: nowrap;
+    background: rgba(208,208,208,0.5);
+    padding: 1px;
+}
+
+.jqplot-highlighter-tooltip {
+    border: 1px solid #cccccc;
+    font-size: 0.75em;
+    white-space: nowrap;
+    background: rgba(208,208,208,0.5);
+    padding: 1px;
+}
+
+.jqplot-point-label {
+    font-size: 0.75em;
+    z-index: 2;
+}
+      
+td.jqplot-cursor-legend-swatch {
+vertical-align:middle;
+text-align:center;
+}
+
+div.jqplot-cursor-legend-swatch {
+width:1.2em;
+height:0.7em;
+}
+
+.jqplot-error {
+/*   Styles added to the plot target container when there is an error go here.*/
+    text-align: center;
+}
+
+.jqplot-error-message {
+/*    Styling of the custom error message div goes here.*/
+    position: relative;
+    top: 46%;
+    display: inline-block;
+}
+
+div.jqplot-bubble-label {
+    font-size: 0.8em;
+/*    background: rgba(90%, 90%, 90%, 0.15);*/
+    padding-left: 2px;
+    padding-right: 2px;
+    color: rgb(20%, 20%, 20%);
+}
+
+div.jqplot-bubble-label.jqplot-bubble-label-highlight {
+    background: rgba(90%, 90%, 90%, 0.7);
+}
+
+div.jqplot-noData-container {
+	text-align: center;
+	background-color: rgba(96%, 96%, 96%, 0.3);
+}

css/jquery.jqplot.min.css

@@ -0,0 +1 @@
+.jqplot-target{position:relative;color:#666;font-family:"Trebuchet MS",Arial,Helvetica,sans-serif;font-size:1em;}.jqplot-axis{font-size:.75em;}.jqplot-xaxis{margin-top:10px;}.jqplot-x2axis{margin-bottom:10px;}.jqplot-yaxis{margin-right:10px;}.jqplot-y2axis,.jqplot-y3axis,.jqplot-y4axis,.jqplot-y5axis,.jqplot-y6axis,.jqplot-y7axis,.jqplot-y8axis,.jqplot-y9axis{margin-left:10px;margin-right:10px;}.jqplot-axis-tick,.jqplot-xaxis-tick,.jqplot-yaxis-tick,.jqplot-x2axis-tick,.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{position:absolute;}.jqplot-xaxis-tick{top:0;left:15px;vertical-align:top;}.jqplot-x2axis-tick{bottom:0;left:15px;vertical-align:bottom;}.jqplot-yaxis-tick{right:0;top:15px;text-align:right;}.jqplot-yaxis-tick.jqplot-breakTick{right:-20px;margin-right:0;padding:1px 5px 1px 5px;z-index:2;font-size:1.5em;}.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{left:0;top:15px;text-align:left;}.jqplot-meterGauge-tick{font-size:.75em;color:#999;}.jqplot-meterGauge-label{font-size:1em;color:#999;}.jqplot-xaxis-label{margin-top:10px;font-size:11pt;position:absolute;}.jqplot-x2axis-label{margin-bottom:10px;font-size:11pt;position:absolute;}.jqplot-yaxis-label{margin-right:10px;font-size:11pt;position:absolute;}.jqplot-y2axis-label,.jqplot-y3axis-label,.jqplot-y4axis-label,.jqplot-y5axis-label,.jqplot-y6axis-label,.jqplot-y7axis-label,.jqplot-y8axis-label,.jqplot-y9axis-label{font-size:11pt;position:absolute;}table.jqplot-table-legend{margin-top:12px;margin-bottom:12px;margin-left:12px;margin-right:12px;}table.jqplot-table-legend,table.jqplot-cursor-legend{background-color:rgba(255,255,255,0.6);border:1px solid #ccc;position:absolute;font-size:.75em;}td.jqplot-table-legend{vertical-align:middle;}td.jqplot-seriesToggle:hover,td.jqplot-seriesToggle:active{cursor:pointer;}td.jqplot-table-legend>div{border:1px solid #ccc;padding:1px;}div.jqplot-table-legend-swatch{width:0;height:0;border-top-width:5px;border-bottom-width:5px;border-left-width:6px;border-right-width:6px;border-top-style:solid;border-bottom-style:solid;border-left-style:solid;border-right-style:solid;}.jqplot-title{top:0;left:0;padding-bottom:.5em;font-size:1.2em;}table.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;}.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px;}.jqplot-highlighter-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px;}.jqplot-point-label{font-size:.75em;z-index:2;}td.jqplot-cursor-legend-swatch{vertical-align:middle;text-align:center;}div.jqplot-cursor-legend-swatch{width:1.2em;height:.7em;}.jqplot-error{text-align:center;}.jqplot-error-message{position:relative;top:46%;display:inline-block;}div.jqplot-bubble-label{font-size:.8em;padding-left:2px;padding-right:2px;color:rgb(20%,20%,20%);}div.jqplot-bubble-label.jqplot-bubble-label-highlight{background:rgba(90%,90%,90%,0.7);}div.jqplot-noData-container{text-align:center;background-color:rgba(96%,96%,96%,0.3);}

css/jquery.jquery-ui.css

@@ -0,0 +1,563 @@
+/*
+ * jQuery UI CSS Framework 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Theming/API
+ */
+
+/* Layout helpers
+----------------------------------*/
+.ui-helper-hidden { display: none; }
+.ui-helper-hidden-accessible { position: absolute !important; clip: rect(1px 1px 1px 1px); clip: rect(1px,1px,1px,1px); }
+.ui-helper-reset { margin: 0; padding: 0; border: 0; outline: 0; line-height: 1.3; text-decoration: none; font-size: 100%; list-style: none; }
+.ui-helper-clearfix:before, .ui-helper-clearfix:after { content: ""; display: table; }
+.ui-helper-clearfix:after { clear: both; }
+.ui-helper-clearfix { zoom: 1; }
+.ui-helper-zfix { width: 100%; height: 100%; top: 0; left: 0; position: absolute; opacity: 0; filter:Alpha(Opacity=0); }
+
+
+/* Interaction Cues
+----------------------------------*/
+.ui-state-disabled { cursor: default !important; }
+
+
+/* Icons
+----------------------------------*/
+
+/* states and images */
+.ui-icon { display: block; text-indent: -99999px; overflow: hidden; background-repeat: no-repeat; }
+
+
+/* Misc visuals
+----------------------------------*/
+
+/* Overlays */
+.ui-widget-overlay { position: absolute; top: 0; left: 0; width: 100%; height: 100%; }
+/*
+ * jQuery UI Accordion 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Accordion#theming
+ */
+/* IE/Win - Fix animation bug - #4615 */
+.ui-accordion { width: 100%; }
+.ui-accordion .ui-accordion-header { cursor: pointer; position: relative; margin-top: 1px; zoom: 1; }
+.ui-accordion .ui-accordion-li-fix { display: inline; }
+.ui-accordion .ui-accordion-header-active { border-bottom: 0 !important; }
+.ui-accordion .ui-accordion-header a { display: block; font-size: 1em; padding: .5em .5em .5em .7em; }
+.ui-accordion-icons .ui-accordion-header a { padding-left: 2.2em; }
+.ui-accordion .ui-accordion-header .ui-icon { position: absolute; left: .5em; top: 50%; margin-top: -8px; }
+.ui-accordion .ui-accordion-content { padding: 1em 2.2em; border-top: 0; margin-top: -2px; position: relative; top: 1px; margin-bottom: 2px; overflow: auto; display: none; zoom: 1; }
+.ui-accordion .ui-accordion-content-active { display: block; }
+/*
+ * jQuery UI Autocomplete 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Autocomplete#theming
+ */
+.ui-autocomplete { position: absolute; cursor: default; }
+
+/* workarounds */
+* html .ui-autocomplete { width:1px; } /* without this, the menu expands to 100% in IE6 */
+
+/*
+ * jQuery UI Menu 1.8.17
+ *
+ * Copyright 2010, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Menu#theming
+ */
+.ui-menu {
+	list-style:none;
+	padding: 2px;
+	margin: 0;
+	display:block;
+	float: left;
+}
+.ui-menu .ui-menu {
+	margin-top: -3px;
+}
+.ui-menu .ui-menu-item {
+	margin:0;
+	padding: 0;
+	zoom: 1;
+	float: left;
+	clear: left;
+	width: 100%;
+}
+.ui-menu .ui-menu-item a {
+	text-decoration:none;
+	display:block;
+	padding:.2em .4em;
+	line-height:1.5;
+	zoom:1;
+}
+.ui-menu .ui-menu-item a.ui-state-hover,
+.ui-menu .ui-menu-item a.ui-state-active {
+	font-weight: normal;
+	margin: -1px;
+}
+/*
+ * jQuery UI Button 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Button#theming
+ */
+.ui-button { display: inline-block; position: relative; padding: 0; margin-right: .1em; text-decoration: none !important; cursor: pointer; text-align: center; zoom: 1; overflow: visible; } /* the overflow property removes extra width in IE */
+.ui-button-icon-only { width: 2.2em; } /* to make room for the icon, a width needs to be set here */
+button.ui-button-icon-only { width: 2.4em; } /* button elements seem to need a little more width */
+.ui-button-icons-only { width: 3.4em; }
+button.ui-button-icons-only { width: 3.7em; }
+
+/*button text element */
+.ui-button .ui-button-text { display: block; line-height: 1.4;  }
+.ui-button-text-only .ui-button-text { padding: .4em 1em; }
+.ui-button-icon-only .ui-button-text, .ui-button-icons-only .ui-button-text { padding: .4em; text-indent: -9999999px; }
+.ui-button-text-icon-primary .ui-button-text, .ui-button-text-icons .ui-button-text { padding: .4em 1em .4em 2.1em; }
+.ui-button-text-icon-secondary .ui-button-text, .ui-button-text-icons .ui-button-text { padding: .4em 2.1em .4em 1em; }
+.ui-button-text-icons .ui-button-text { padding-left: 2.1em; padding-right: 2.1em; }
+/* no icon support for input elements, provide padding by default */
+input.ui-button { padding: .4em 1em; }
+
+/*button icon element(s) */
+.ui-button-icon-only .ui-icon, .ui-button-text-icon-primary .ui-icon, .ui-button-text-icon-secondary .ui-icon, .ui-button-text-icons .ui-icon, .ui-button-icons-only .ui-icon { position: absolute; top: 50%; margin-top: -8px; }
+.ui-button-icon-only .ui-icon { left: 50%; margin-left: -8px; }
+.ui-button-text-icon-primary .ui-button-icon-primary, .ui-button-text-icons .ui-button-icon-primary, .ui-button-icons-only .ui-button-icon-primary { left: .5em; }
+.ui-button-text-icon-secondary .ui-button-icon-secondary, .ui-button-text-icons .ui-button-icon-secondary, .ui-button-icons-only .ui-button-icon-secondary { right: .5em; }
+.ui-button-text-icons .ui-button-icon-secondary, .ui-button-icons-only .ui-button-icon-secondary { right: .5em; }
+
+/*button sets*/
+.ui-buttonset { margin-right: 7px; }
+.ui-buttonset .ui-button { margin-left: 0; margin-right: -.3em; }
+
+/* workarounds */
+button.ui-button::-moz-focus-inner { border: 0; padding: 0; } /* reset extra padding in Firefox */
+/*
+ * jQuery UI Datepicker 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Datepicker#theming
+ */
+.ui-datepicker { width: 17em; padding: .2em .2em 0; display: none; }
+.ui-datepicker .ui-datepicker-header { position:relative; padding:.2em 0; }
+.ui-datepicker .ui-datepicker-prev, .ui-datepicker .ui-datepicker-next { position:absolute; top: 2px; width: 1.8em; height: 1.8em; }
+.ui-datepicker .ui-datepicker-prev-hover, .ui-datepicker .ui-datepicker-next-hover { top: 1px; }
+.ui-datepicker .ui-datepicker-prev { left:2px; }
+.ui-datepicker .ui-datepicker-next { right:2px; }
+.ui-datepicker .ui-datepicker-prev-hover { left:1px; }
+.ui-datepicker .ui-datepicker-next-hover { right:1px; }
+.ui-datepicker .ui-datepicker-prev span, .ui-datepicker .ui-datepicker-next span { display: block; position: absolute; left: 50%; margin-left: -8px; top: 50%; margin-top: -8px;  }
+.ui-datepicker .ui-datepicker-title { margin: 0 2.3em; line-height: 1.8em; text-align: center; }
+.ui-datepicker .ui-datepicker-title select { font-size:1em; margin:1px 0; }
+.ui-datepicker select.ui-datepicker-month-year {width: 100%;}
+.ui-datepicker select.ui-datepicker-month,
+.ui-datepicker select.ui-datepicker-year { width: 49%;}
+.ui-datepicker table {width: 100%; font-size: .9em; border-collapse: collapse; margin:0 0 .4em; }
+.ui-datepicker th { padding: .7em .3em; text-align: center; font-weight: bold; border: 0;  }
+.ui-datepicker td { border: 0; padding: 1px; }
+.ui-datepicker td span, .ui-datepicker td a { display: block; padding: .2em; text-align: right; text-decoration: none; }
+.ui-datepicker .ui-datepicker-buttonpane { background-image: none; margin: .7em 0 0 0; padding:0 .2em; border-left: 0; border-right: 0; border-bottom: 0; }
+.ui-datepicker .ui-datepicker-buttonpane button { float: right; margin: .5em .2em .4em; cursor: pointer; padding: .2em .6em .3em .6em; width:auto; overflow:visible; }
+.ui-datepicker .ui-datepicker-buttonpane button.ui-datepicker-current { float:left; }
+
+/* with multiple calendars */
+.ui-datepicker.ui-datepicker-multi { width:auto; }
+.ui-datepicker-multi .ui-datepicker-group { float:left; }
+.ui-datepicker-multi .ui-datepicker-group table { width:95%; margin:0 auto .4em; }
+.ui-datepicker-multi-2 .ui-datepicker-group { width:50%; }
+.ui-datepicker-multi-3 .ui-datepicker-group { width:33.3%; }
+.ui-datepicker-multi-4 .ui-datepicker-group { width:25%; }
+.ui-datepicker-multi .ui-datepicker-group-last .ui-datepicker-header { border-left-width:0; }
+.ui-datepicker-multi .ui-datepicker-group-middle .ui-datepicker-header { border-left-width:0; }
+.ui-datepicker-multi .ui-datepicker-buttonpane { clear:left; }
+.ui-datepicker-row-break { clear:both; width:100%; font-size:0em; }
+
+/* RTL support */
+.ui-datepicker-rtl { direction: rtl; }
+.ui-datepicker-rtl .ui-datepicker-prev { right: 2px; left: auto; }
+.ui-datepicker-rtl .ui-datepicker-next { left: 2px; right: auto; }
+.ui-datepicker-rtl .ui-datepicker-prev:hover { right: 1px; left: auto; }
+.ui-datepicker-rtl .ui-datepicker-next:hover { left: 1px; right: auto; }
+.ui-datepicker-rtl .ui-datepicker-buttonpane { clear:right; }
+.ui-datepicker-rtl .ui-datepicker-buttonpane button { float: left; }
+.ui-datepicker-rtl .ui-datepicker-buttonpane button.ui-datepicker-current { float:right; }
+.ui-datepicker-rtl .ui-datepicker-group { float:right; }
+.ui-datepicker-rtl .ui-datepicker-group-last .ui-datepicker-header { border-right-width:0; border-left-width:1px; }
+.ui-datepicker-rtl .ui-datepicker-group-middle .ui-datepicker-header { border-right-width:0; border-left-width:1px; }
+
+/* IE6 IFRAME FIX (taken from datepicker 1.5.3 */
+.ui-datepicker-cover {
+    display: none; /*sorry for IE5*/
+    display/**/: block; /*sorry for IE5*/
+    position: absolute; /*must have*/
+    z-index: -1; /*must have*/
+    filter: mask(); /*must have*/
+    top: -4px; /*must have*/
+    left: -4px; /*must have*/
+    width: 200px; /*must have*/
+    height: 200px; /*must have*/
+}/*
+ * jQuery UI Dialog 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Dialog#theming
+ */
+.ui-dialog { position: absolute; padding: .2em; width: 300px; overflow: hidden; }
+.ui-dialog .ui-dialog-titlebar { padding: .4em 1em; position: relative;  }
+.ui-dialog .ui-dialog-title { float: left; margin: .1em 16px .1em 0; }
+.ui-dialog .ui-dialog-titlebar-close { position: absolute; right: .3em; top: 50%; width: 19px; margin: -10px 0 0 0; padding: 1px; height: 18px; }
+.ui-dialog .ui-dialog-titlebar-close span { display: block; margin: 1px; }
+.ui-dialog .ui-dialog-titlebar-close:hover, .ui-dialog .ui-dialog-titlebar-close:focus { padding: 0; }
+.ui-dialog .ui-dialog-content { position: relative; border: 0; padding: .5em 1em; background: none; overflow: auto; zoom: 1; }
+.ui-dialog .ui-dialog-buttonpane { text-align: left; border-width: 1px 0 0 0; background-image: none; margin: .5em 0 0 0; padding: .3em 1em .5em .4em; }
+.ui-dialog .ui-dialog-buttonpane .ui-dialog-buttonset { float: right; }
+.ui-dialog .ui-dialog-buttonpane button { margin: .5em .4em .5em 0; cursor: pointer; }
+.ui-dialog .ui-resizable-se { width: 14px; height: 14px; right: 3px; bottom: 3px; }
+.ui-draggable .ui-dialog-titlebar { cursor: move; }
+/*
+ * jQuery UI Progressbar 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Progressbar#theming
+ */
+.ui-progressbar { height:2em; text-align: left; overflow: hidden; }
+.ui-progressbar .ui-progressbar-value {margin: -1px; height:100%; }/*
+ * jQuery UI Resizable 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Resizable#theming
+ */
+.ui-resizable { position: relative;}
+.ui-resizable-handle { position: absolute;font-size: 0.1px;z-index: 99999; display: block; }
+.ui-resizable-disabled .ui-resizable-handle, .ui-resizable-autohide .ui-resizable-handle { display: none; }
+.ui-resizable-n { cursor: n-resize; height: 7px; width: 100%; top: -5px; left: 0; }
+.ui-resizable-s { cursor: s-resize; height: 7px; width: 100%; bottom: -5px; left: 0; }
+.ui-resizable-e { cursor: e-resize; width: 7px; right: -5px; top: 0; height: 100%; }
+.ui-resizable-w { cursor: w-resize; width: 7px; left: -5px; top: 0; height: 100%; }
+.ui-resizable-se { cursor: se-resize; width: 12px; height: 12px; right: 1px; bottom: 1px; }
+.ui-resizable-sw { cursor: sw-resize; width: 9px; height: 9px; left: -5px; bottom: -5px; }
+.ui-resizable-nw { cursor: nw-resize; width: 9px; height: 9px; left: -5px; top: -5px; }
+.ui-resizable-ne { cursor: ne-resize; width: 9px; height: 9px; right: -5px; top: -5px;}/*
+ * jQuery UI Selectable 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Selectable#theming
+ */
+.ui-selectable-helper { position: absolute; z-index: 100; border:1px dotted black; }
+/*
+ * jQuery UI Slider 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Slider#theming
+ */
+.ui-slider { position: relative; text-align: left; }
+.ui-slider .ui-slider-handle { position: absolute; z-index: 2; width: 1.2em; height: 1.2em; cursor: default; }
+.ui-slider .ui-slider-range { position: absolute; z-index: 1; font-size: .7em; display: block; border: 0; background-position: 0 0; }
+
+.ui-slider-horizontal { height: .8em; }
+.ui-slider-horizontal .ui-slider-handle { top: -.3em; margin-left: -.6em; }
+.ui-slider-horizontal .ui-slider-range { top: 0; height: 100%; }
+.ui-slider-horizontal .ui-slider-range-min { left: 0; }
+.ui-slider-horizontal .ui-slider-range-max { right: 0; }
+
+.ui-slider-vertical { width: .8em; height: 100px; }
+.ui-slider-vertical .ui-slider-handle { left: -.3em; margin-left: 0; margin-bottom: -.6em; }
+.ui-slider-vertical .ui-slider-range { left: 0; width: 100%; }
+.ui-slider-vertical .ui-slider-range-min { bottom: 0; }
+.ui-slider-vertical .ui-slider-range-max { top: 0; }/*
+ * jQuery UI Tabs 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Tabs#theming
+ */
+.ui-tabs { position: relative; padding: .2em; zoom: 1; } /* position: relative prevents IE scroll bug (element with position: relative inside container with overflow: auto appear as "fixed") */
+.ui-tabs .ui-tabs-nav { margin: 0; padding: .2em .2em 0; }
+.ui-tabs .ui-tabs-nav li { list-style: none; float: left; position: relative; top: 1px; margin: 0 .2em 1px 0; border-bottom: 0 !important; padding: 0; white-space: nowrap; }
+.ui-tabs .ui-tabs-nav li a { float: left; padding: .5em 1em; text-decoration: none; }
+.ui-tabs .ui-tabs-nav li.ui-tabs-selected { margin-bottom: 0; padding-bottom: 1px; }
+.ui-tabs .ui-tabs-nav li.ui-tabs-selected a, .ui-tabs .ui-tabs-nav li.ui-state-disabled a, .ui-tabs .ui-tabs-nav li.ui-state-processing a { cursor: text; }
+.ui-tabs .ui-tabs-nav li a, .ui-tabs.ui-tabs-collapsible .ui-tabs-nav li.ui-tabs-selected a { cursor: pointer; } /* first selector in group seems obsolete, but required to overcome bug in Opera applying cursor: text overall if defined elsewhere... */
+.ui-tabs .ui-tabs-panel { display: block; border-width: 0; padding: 1em 1.4em; background: none; }
+.ui-tabs .ui-tabs-hide { display: none !important; }
+/*
+ * jQuery UI CSS Framework 1.8.17
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI/Theming/API
+ *
+ * To view and modify this theme, visit http://jqueryui.com/themeroller/
+ */
+
+
+/* Component containers
+----------------------------------*/
+.ui-widget { font-family: Verdana,Arial,sans-serif/*{ffDefault}*/; font-size: 1.1em/*{fsDefault}*/; }
+.ui-widget .ui-widget { font-size: 1em; }
+.ui-widget input, .ui-widget select, .ui-widget textarea, .ui-widget button { font-family: Verdana,Arial,sans-serif/*{ffDefault}*/; font-size: 1em; }
+.ui-widget-content { border: 1px solid #aaaaaa/*{borderColorContent}*/; background: #ffffff/*{bgColorContent}*/ url(images/ui-bg_flat_75_ffffff_40x100.png)/*{bgImgUrlContent}*/ 50%/*{bgContentXPos}*/ 50%/*{bgContentYPos}*/ repeat-x/*{bgContentRepeat}*/; color: #222222/*{fcContent}*/; }
+.ui-widget-content a { color: #222222/*{fcContent}*/; }
+.ui-widget-header { border: 1px solid #aaaaaa/*{borderColorHeader}*/; background: #cccccc/*{bgColorHeader}*/ url(images/ui-bg_highlight-soft_75_cccccc_1x100.png)/*{bgImgUrlHeader}*/ 50%/*{bgHeaderXPos}*/ 50%/*{bgHeaderYPos}*/ repeat-x/*{bgHeaderRepeat}*/; color: #222222/*{fcHeader}*/; font-weight: bold; }
+.ui-widget-header a { color: #222222/*{fcHeader}*/; }
+
+/* Interaction states
+----------------------------------*/
+.ui-state-default, .ui-widget-content .ui-state-default, .ui-widget-header .ui-state-default { border: 1px solid #d3d3d3/*{borderColorDefault}*/; background: #e6e6e6/*{bgColorDefault}*/ url(images/ui-bg_glass_75_e6e6e6_1x400.png)/*{bgImgUrlDefault}*/ 50%/*{bgDefaultXPos}*/ 50%/*{bgDefaultYPos}*/ repeat-x/*{bgDefaultRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #555555/*{fcDefault}*/; }
+.ui-state-default a, .ui-state-default a:link, .ui-state-default a:visited { color: #555555/*{fcDefault}*/; text-decoration: none; }
+.ui-state-hover, .ui-widget-content .ui-state-hover, .ui-widget-header .ui-state-hover, .ui-state-focus, .ui-widget-content .ui-state-focus, .ui-widget-header .ui-state-focus { border: 1px solid #999999/*{borderColorHover}*/; background: #dadada/*{bgColorHover}*/ url(images/ui-bg_glass_75_dadada_1x400.png)/*{bgImgUrlHover}*/ 50%/*{bgHoverXPos}*/ 50%/*{bgHoverYPos}*/ repeat-x/*{bgHoverRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #212121/*{fcHover}*/; }
+.ui-state-hover a, .ui-state-hover a:hover { color: #212121/*{fcHover}*/; text-decoration: none; }
+.ui-state-active, .ui-widget-content .ui-state-active, .ui-widget-header .ui-state-active { border: 1px solid #aaaaaa/*{borderColorActive}*/; background: #ffffff/*{bgColorActive}*/ url(images/ui-bg_glass_65_ffffff_1x400.png)/*{bgImgUrlActive}*/ 50%/*{bgActiveXPos}*/ 50%/*{bgActiveYPos}*/ repeat-x/*{bgActiveRepeat}*/; font-weight: normal/*{fwDefault}*/; color: #212121/*{fcActive}*/; }
+.ui-state-active a, .ui-state-active a:link, .ui-state-active a:visited { color: #212121/*{fcActive}*/; text-decoration: none; }
+.ui-widget :active { outline: none; }
+
+/* Interaction Cues
+----------------------------------*/
+.ui-state-highlight, .ui-widget-content .ui-state-highlight, .ui-widget-header .ui-state-highlight  {border: 1px solid #fcefa1/*{borderColorHighlight}*/; background: #fbf9ee/*{bgColorHighlight}*/ url(images/ui-bg_glass_55_fbf9ee_1x400.png)/*{bgImgUrlHighlight}*/ 50%/*{bgHighlightXPos}*/ 50%/*{bgHighlightYPos}*/ repeat-x/*{bgHighlightRepeat}*/; color: #363636/*{fcHighlight}*/; }
+.ui-state-highlight a, .ui-widget-content .ui-state-highlight a,.ui-widget-header .ui-state-highlight a { color: #363636/*{fcHighlight}*/; }
+.ui-state-error, .ui-widget-content .ui-state-error, .ui-widget-header .ui-state-error {border: 1px solid #cd0a0a/*{borderColorError}*/; background: #fef1ec/*{bgColorError}*/ url(images/ui-bg_glass_95_fef1ec_1x400.png)/*{bgImgUrlError}*/ 50%/*{bgErrorXPos}*/ 50%/*{bgErrorYPos}*/ repeat-x/*{bgErrorRepeat}*/; color: #cd0a0a/*{fcError}*/; }
+.ui-state-error a, .ui-widget-content .ui-state-error a, .ui-widget-header .ui-state-error a { color: #cd0a0a/*{fcError}*/; }
+.ui-state-error-text, .ui-widget-content .ui-state-error-text, .ui-widget-header .ui-state-error-text { color: #cd0a0a/*{fcError}*/; }
+.ui-priority-primary, .ui-widget-content .ui-priority-primary, .ui-widget-header .ui-priority-primary { font-weight: bold; }
+.ui-priority-secondary, .ui-widget-content .ui-priority-secondary,  .ui-widget-header .ui-priority-secondary { opacity: .7; filter:Alpha(Opacity=70); font-weight: normal; }
+.ui-state-disabled, .ui-widget-content .ui-state-disabled, .ui-widget-header .ui-state-disabled { opacity: .35; filter:Alpha(Opacity=35); background-image: none; }
+
+/* Icons
+----------------------------------*/
+
+/* states and images */
+.ui-icon { width: 16px; height: 16px; background-image: url(images/ui-icons_222222_256x240.png)/*{iconsContent}*/; }
+.ui-widget-content .ui-icon {background-image: url(images/ui-icons_222222_256x240.png)/*{iconsContent}*/; }
+.ui-widget-header .ui-icon {background-image: url(images/ui-icons_222222_256x240.png)/*{iconsHeader}*/; }
+.ui-state-default .ui-icon { background-image: url(images/ui-icons_888888_256x240.png)/*{iconsDefault}*/; }
+.ui-state-hover .ui-icon, .ui-state-focus .ui-icon {background-image: url(images/ui-icons_454545_256x240.png)/*{iconsHover}*/; }
+.ui-state-active .ui-icon {background-image: url(images/ui-icons_454545_256x240.png)/*{iconsActive}*/; }
+.ui-state-highlight .ui-icon {background-image: url(images/ui-icons_2e83ff_256x240.png)/*{iconsHighlight}*/; }
+.ui-state-error .ui-icon, .ui-state-error-text .ui-icon {background-image: url(images/ui-icons_cd0a0a_256x240.png)/*{iconsError}*/; }
+
+/* positioning */
+.ui-icon-carat-1-n { background-position: 0 0; }
+.ui-icon-carat-1-ne { background-position: -16px 0; }
+.ui-icon-carat-1-e { background-position: -32px 0; }
+.ui-icon-carat-1-se { background-position: -48px 0; }
+.ui-icon-carat-1-s { background-position: -64px 0; }
+.ui-icon-carat-1-sw { background-position: -80px 0; }
+.ui-icon-carat-1-w { background-position: -96px 0; }
+.ui-icon-carat-1-nw { background-position: -112px 0; }
+.ui-icon-carat-2-n-s { background-position: -128px 0; }
+.ui-icon-carat-2-e-w { background-position: -144px 0; }
+.ui-icon-triangle-1-n { background-position: 0 -16px; }
+.ui-icon-triangle-1-ne { background-position: -16px -16px; }
+.ui-icon-triangle-1-e { background-position: -32px -16px; }
+.ui-icon-triangle-1-se { background-position: -48px -16px; }
+.ui-icon-triangle-1-s { background-position: -64px -16px; }
+.ui-icon-triangle-1-sw { background-position: -80px -16px; }
+.ui-icon-triangle-1-w { background-position: -96px -16px; }
+.ui-icon-triangle-1-nw { background-position: -112px -16px; }
+.ui-icon-triangle-2-n-s { background-position: -128px -16px; }
+.ui-icon-triangle-2-e-w { background-position: -144px -16px; }
+.ui-icon-arrow-1-n { background-position: 0 -32px; }
+.ui-icon-arrow-1-ne { background-position: -16px -32px; }
+.ui-icon-arrow-1-e { background-position: -32px -32px; }
+.ui-icon-arrow-1-se { background-position: -48px -32px; }
+.ui-icon-arrow-1-s { background-position: -64px -32px; }
+.ui-icon-arrow-1-sw { background-position: -80px -32px; }
+.ui-icon-arrow-1-w { background-position: -96px -32px; }
+.ui-icon-arrow-1-nw { background-position: -112px -32px; }
+.ui-icon-arrow-2-n-s { background-position: -128px -32px; }
+.ui-icon-arrow-2-ne-sw { background-position: -144px -32px; }
+.ui-icon-arrow-2-e-w { background-position: -160px -32px; }
+.ui-icon-arrow-2-se-nw { background-position: -176px -32px; }
+.ui-icon-arrowstop-1-n { background-position: -192px -32px; }
+.ui-icon-arrowstop-1-e { background-position: -208px -32px; }
+.ui-icon-arrowstop-1-s { background-position: -224px -32px; }
+.ui-icon-arrowstop-1-w { background-position: -240px -32px; }
+.ui-icon-arrowthick-1-n { background-position: 0 -48px; }
+.ui-icon-arrowthick-1-ne { background-position: -16px -48px; }
+.ui-icon-arrowthick-1-e { background-position: -32px -48px; }
+.ui-icon-arrowthick-1-se { background-position: -48px -48px; }
+.ui-icon-arrowthick-1-s { background-position: -64px -48px; }
+.ui-icon-arrowthick-1-sw { background-position: -80px -48px; }
+.ui-icon-arrowthick-1-w { background-position: -96px -48px; }
+.ui-icon-arrowthick-1-nw { background-position: -112px -48px; }
+.ui-icon-arrowthick-2-n-s { background-position: -128px -48px; }
+.ui-icon-arrowthick-2-ne-sw { background-position: -144px -48px; }
+.ui-icon-arrowthick-2-e-w { background-position: -160px -48px; }
+.ui-icon-arrowthick-2-se-nw { background-position: -176px -48px; }
+.ui-icon-arrowthickstop-1-n { background-position: -192px -48px; }
+.ui-icon-arrowthickstop-1-e { background-position: -208px -48px; }
+.ui-icon-arrowthickstop-1-s { background-position: -224px -48px; }
+.ui-icon-arrowthickstop-1-w { background-position: -240px -48px; }
+.ui-icon-arrowreturnthick-1-w { background-position: 0 -64px; }
+.ui-icon-arrowreturnthick-1-n { background-position: -16px -64px; }
+.ui-icon-arrowreturnthick-1-e { background-position: -32px -64px; }
+.ui-icon-arrowreturnthick-1-s { background-position: -48px -64px; }
+.ui-icon-arrowreturn-1-w { background-position: -64px -64px; }
+.ui-icon-arrowreturn-1-n { background-position: -80px -64px; }
+.ui-icon-arrowreturn-1-e { background-position: -96px -64px; }
+.ui-icon-arrowreturn-1-s { background-position: -112px -64px; }
+.ui-icon-arrowrefresh-1-w { background-position: -128px -64px; }
+.ui-icon-arrowrefresh-1-n { background-position: -144px -64px; }
+.ui-icon-arrowrefresh-1-e { background-position: -160px -64px; }
+.ui-icon-arrowrefresh-1-s { background-position: -176px -64px; }
+.ui-icon-arrow-4 { background-position: 0 -80px; }
+.ui-icon-arrow-4-diag { background-position: -16px -80px; }
+.ui-icon-extlink { background-position: -32px -80px; }
+.ui-icon-newwin { background-position: -48px -80px; }
+.ui-icon-refresh { background-position: -64px -80px; }
+.ui-icon-shuffle { background-position: -80px -80px; }
+.ui-icon-transfer-e-w { background-position: -96px -80px; }
+.ui-icon-transferthick-e-w { background-position: -112px -80px; }
+.ui-icon-folder-collapsed { background-position: 0 -96px; }
+.ui-icon-folder-open { background-position: -16px -96px; }
+.ui-icon-document { background-position: -32px -96px; }
+.ui-icon-document-b { background-position: -48px -96px; }
+.ui-icon-note { background-position: -64px -96px; }
+.ui-icon-mail-closed { background-position: -80px -96px; }
+.ui-icon-mail-open { background-position: -96px -96px; }
+.ui-icon-suitcase { background-position: -112px -96px; }
+.ui-icon-comment { background-position: -128px -96px; }
+.ui-icon-person { background-position: -144px -96px; }
+.ui-icon-print { background-position: -160px -96px; }
+.ui-icon-trash { background-position: -176px -96px; }
+.ui-icon-locked { background-position: -192px -96px; }
+.ui-icon-unlocked { background-position: -208px -96px; }
+.ui-icon-bookmark { background-position: -224px -96px; }
+.ui-icon-tag { background-position: -240px -96px; }
+.ui-icon-home { background-position: 0 -112px; }
+.ui-icon-flag { background-position: -16px -112px; }
+.ui-icon-calendar { background-position: -32px -112px; }
+.ui-icon-cart { background-position: -48px -112px; }
+.ui-icon-pencil { background-position: -64px -112px; }
+.ui-icon-clock { background-position: -80px -112px; }
+.ui-icon-disk { background-position: -96px -112px; }
+.ui-icon-calculator { background-position: -112px -112px; }
+.ui-icon-zoomin { background-position: -128px -112px; }
+.ui-icon-zoomout { background-position: -144px -112px; }
+.ui-icon-search { background-position: -160px -112px; }
+.ui-icon-wrench { background-position: -176px -112px; }
+.ui-icon-gear { background-position: -192px -112px; }
+.ui-icon-heart { background-position: -208px -112px; }
+.ui-icon-star { background-position: -224px -112px; }
+.ui-icon-link { background-position: -240px -112px; }
+.ui-icon-cancel { background-position: 0 -128px; }
+.ui-icon-plus { background-position: -16px -128px; }
+.ui-icon-plusthick { background-position: -32px -128px; }
+.ui-icon-minus { background-position: -48px -128px; }
+.ui-icon-minusthick { background-position: -64px -128px; }
+.ui-icon-close { background-position: -80px -128px; }
+.ui-icon-closethick { background-position: -96px -128px; }
+.ui-icon-key { background-position: -112px -128px; }
+.ui-icon-lightbulb { background-position: -128px -128px; }
+.ui-icon-scissors { background-position: -144px -128px; }
+.ui-icon-clipboard { background-position: -160px -128px; }
+.ui-icon-copy { background-position: -176px -128px; }
+.ui-icon-contact { background-position: -192px -128px; }
+.ui-icon-image { background-position: -208px -128px; }
+.ui-icon-video { background-position: -224px -128px; }
+.ui-icon-script { background-position: -240px -128px; }
+.ui-icon-alert { background-position: 0 -144px; }
+.ui-icon-info { background-position: -16px -144px; }
+.ui-icon-notice { background-position: -32px -144px; }
+.ui-icon-help { background-position: -48px -144px; }
+.ui-icon-check { background-position: -64px -144px; }
+.ui-icon-bullet { background-position: -80px -144px; }
+.ui-icon-radio-off { background-position: -96px -144px; }
+.ui-icon-radio-on { background-position: -112px -144px; }
+.ui-icon-pin-w { background-position: -128px -144px; }
+.ui-icon-pin-s { background-position: -144px -144px; }
+.ui-icon-play { background-position: 0 -160px; }
+.ui-icon-pause { background-position: -16px -160px; }
+.ui-icon-seek-next { background-position: -32px -160px; }
+.ui-icon-seek-prev { background-position: -48px -160px; }
+.ui-icon-seek-end { background-position: -64px -160px; }
+.ui-icon-seek-start { background-position: -80px -160px; }
+/* ui-icon-seek-first is deprecated, use ui-icon-seek-start instead */
+.ui-icon-seek-first { background-position: -80px -160px; }
+.ui-icon-stop { background-position: -96px -160px; }
+.ui-icon-eject { background-position: -112px -160px; }
+.ui-icon-volume-off { background-position: -128px -160px; }
+.ui-icon-volume-on { background-position: -144px -160px; }
+.ui-icon-power { background-position: 0 -176px; }
+.ui-icon-signal-diag { background-position: -16px -176px; }
+.ui-icon-signal { background-position: -32px -176px; }
+.ui-icon-battery-0 { background-position: -48px -176px; }
+.ui-icon-battery-1 { background-position: -64px -176px; }
+.ui-icon-battery-2 { background-position: -80px -176px; }
+.ui-icon-battery-3 { background-position: -96px -176px; }
+.ui-icon-circle-plus { background-position: 0 -192px; }
+.ui-icon-circle-minus { background-position: -16px -192px; }
+.ui-icon-circle-close { background-position: -32px -192px; }
+.ui-icon-circle-triangle-e { background-position: -48px -192px; }
+.ui-icon-circle-triangle-s { background-position: -64px -192px; }
+.ui-icon-circle-triangle-w { background-position: -80px -192px; }
+.ui-icon-circle-triangle-n { background-position: -96px -192px; }
+.ui-icon-circle-arrow-e { background-position: -112px -192px; }
+.ui-icon-circle-arrow-s { background-position: -128px -192px; }
+.ui-icon-circle-arrow-w { background-position: -144px -192px; }
+.ui-icon-circle-arrow-n { background-position: -160px -192px; }
+.ui-icon-circle-zoomin { background-position: -176px -192px; }
+.ui-icon-circle-zoomout { background-position: -192px -192px; }
+.ui-icon-circle-check { background-position: -208px -192px; }
+.ui-icon-circlesmall-plus { background-position: 0 -208px; }
+.ui-icon-circlesmall-minus { background-position: -16px -208px; }
+.ui-icon-circlesmall-close { background-position: -32px -208px; }
+.ui-icon-squaresmall-plus { background-position: -48px -208px; }
+.ui-icon-squaresmall-minus { background-position: -64px -208px; }
+.ui-icon-squaresmall-close { background-position: -80px -208px; }
+.ui-icon-grip-dotted-vertical { background-position: 0 -224px; }
+.ui-icon-grip-dotted-horizontal { background-position: -16px -224px; }
+.ui-icon-grip-solid-vertical { background-position: -32px -224px; }
+.ui-icon-grip-solid-horizontal { background-position: -48px -224px; }
+.ui-icon-gripsmall-diagonal-se { background-position: -64px -224px; }
+.ui-icon-grip-diagonal-se { background-position: -80px -224px; }
+
+
+/* Misc visuals
+----------------------------------*/
+
+/* Corner radius */
+.ui-corner-all, .ui-corner-top, .ui-corner-left, .ui-corner-tl { -moz-border-radius-topleft: 4px/*{cornerRadius}*/; -webkit-border-top-left-radius: 4px/*{cornerRadius}*/; -khtml-border-top-left-radius: 4px/*{cornerRadius}*/; border-top-left-radius: 4px/*{cornerRadius}*/; }
+.ui-corner-all, .ui-corner-top, .ui-corner-right, .ui-corner-tr { -moz-border-radius-topright: 4px/*{cornerRadius}*/; -webkit-border-top-right-radius: 4px/*{cornerRadius}*/; -khtml-border-top-right-radius: 4px/*{cornerRadius}*/; border-top-right-radius: 4px/*{cornerRadius}*/; }
+.ui-corner-all, .ui-corner-bottom, .ui-corner-left, .ui-corner-bl { -moz-border-radius-bottomleft: 4px/*{cornerRadius}*/; -webkit-border-bottom-left-radius: 4px/*{cornerRadius}*/; -khtml-border-bottom-left-radius: 4px/*{cornerRadius}*/; border-bottom-left-radius: 4px/*{cornerRadius}*/; }
+.ui-corner-all, .ui-corner-bottom, .ui-corner-right, .ui-corner-br { -moz-border-radius-bottomright: 4px/*{cornerRadius}*/; -webkit-border-bottom-right-radius: 4px/*{cornerRadius}*/; -khtml-border-bottom-right-radius: 4px/*{cornerRadius}*/; border-bottom-right-radius: 4px/*{cornerRadius}*/; }
+
+/* Overlays */
+.ui-widget-overlay { background: #aaaaaa/*{bgColorOverlay}*/ url(images/ui-bg_flat_0_aaaaaa_40x100.png)/*{bgImgUrlOverlay}*/ 50%/*{bgOverlayXPos}*/ 50%/*{bgOverlayYPos}*/ repeat-x/*{bgOverlayRepeat}*/; opacity: .3;filter:Alpha(Opacity=30)/*{opacityOverlay}*/; }
+.ui-widget-shadow { margin: -8px/*{offsetTopShadow}*/ 0 0 -8px/*{offsetLeftShadow}*/; padding: 8px/*{thicknessShadow}*/; background: #aaaaaa/*{bgColorShadow}*/ url(images/ui-bg_flat_0_aaaaaa_40x100.png)/*{bgImgUrlShadow}*/ 50%/*{bgShadowXPos}*/ 50%/*{bgShadowYPos}*/ repeat-x/*{bgShadowRepeat}*/; opacity: .3;filter:Alpha(Opacity=30)/*{opacityShadow}*/; -moz-border-radius: 8px/*{cornerRadiusShadow}*/; -khtml-border-radius: 8px/*{cornerRadiusShadow}*/; -webkit-border-radius: 8px/*{cornerRadiusShadow}*/; border-radius: 8px/*{cornerRadiusShadow}*/; }

customer_aps.php

@@ -17,18 +17,18 @@
  *
  */
 
-// Required code
-
 define('AREA', 'customer');
-require ("./lib/init.php");
+require ('./lib/init.php');
+
 $Id = 0;
+if (isset($_GET['id'])) {
+    $Id = (int)$_GET['id'];
+}
+if (isset($_POST['id'])) {
+    $Id = (int)$_POST['id'];
+}
 
-if(isset($_GET['id']))$Id = (int)$_GET['id'];
-
-if(isset($_POST['id']))$Id = (int)$_POST['id'];
-eval("echo \"" . getTemplate("aps/header") . "\";");
+eval("echo \"" . getTemplate('aps/header') . "\";");
 $Aps = new ApsParser($userinfo, $settings, $db);
 $Aps->MainHandler($action);
-eval("echo \"" . getTemplate("aps/footer") . "\";");
-
-?>
+eval("echo \"" . getTemplate('aps/footer') . "\";");

customer_autoresponder.php

@@ -17,18 +17,14 @@
  *
  */
 
-// Required code
-
 define('AREA', 'customer');
-require ("./lib/init.php");
+require('./lib/init.php');
 
-// Create new autoresponder
-
-if($action == "add")
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+if ($action == 'add') {
+	// Create new autoresponder
+	if (isset($_POST['send'])
+	   && $_POST['send'] == 'send'
+	) {
 		$account = trim($_POST['account']);
 		$subject = trim($_POST['subject']);
 		$message = trim($_POST['message']);
@@ -42,39 +38,31 @@ if($action == "add")
 		$ts_from = -1;
 		$ts_until = -1;
 
-		if($date_from_off > -1)
-		{
+		if ($date_from_off > -1) {
 			$date_from = $_POST['date_from'];
 			$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
 		}
-		if($date_until_off > -1)
-		{
+		if ($date_until_off > -1) {
 			$date_until = $_POST['date_until'];
 			$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
 		}
 
-		if(empty($account)
+		if (empty($account)
 		   || empty($subject)
-		   || empty($message))
-		{
+		   || empty($message)
+		) {
 			standard_error('missingfields');
 		}
 
 		// Does account exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
-		{
+		if ($db->num_rows($result) == 0) {
 			standard_error('accountnotexisting');
 		}
 
 		// Does autoresponder exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 1)
-		{
+		if ($db->num_rows($result) == 1) {
 			standard_error('autoresponderalreadyexists');
 		}
 
@@ -92,25 +80,20 @@ if($action == "add")
 	}
 
 	// Get accounts
-
 	$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC");
-
-	if($db->num_rows($result) == 0)
-	{
+	if ($db->num_rows($result) == 0) {
 		standard_error('noemailaccount');
 	}
 
 	$accounts = '';
-
-	while($row = $db->fetch_array($result))
-	{
-		$accounts.= "<option value=\"" . $row['email'] . "\">" . $row['email'] . "</option>";
+	while ($row = $db->fetch_array($result)) {
+		$accounts .= '<option value="' . $row['email'] . '">' . $row['email'] . '</option>';
 	}
 
 	$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
 	$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
 
-	#$isactive = makeyesno('active', '1', '0', '1');
+	//$isactive = makeyesno('active', '1', '0', '1');
 
 	$autoresponder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_add.php';
 	$autoresponder_add_form = htmlform::genHTMLForm($autoresponder_add_data);
@@ -118,18 +101,12 @@ if($action == "add")
 	$title = $autoresponder_add_data['autoresponder_add']['title'];
 	$image = $autoresponder_add_data['autoresponder_add']['image'];
 
-	eval("echo \"" . getTemplate("autoresponder/autoresponder_add") . "\";");
-}
-
-// Edit autoresponder
-
-else
-
-if($action == "edit")
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+	eval("echo \"" . getTemplate('autoresponder/autoresponder_add') . "\";");
+} elseif ($action == 'edit') {
+	// Edit autoresponder
+	if (isset($_POST['send'])
+	   && $_POST['send'] == 'send'
+	) {
 		$account = trim($_POST['account']);
 		$subject = trim($_POST['subject']);
 		$message = trim($_POST['message']);
@@ -143,49 +120,36 @@ if($action == "edit")
 		$ts_from = -1;
 		$ts_until = -1;
 
-		if($date_from_off > -1)
-		{
+		if ($date_from_off > -1) {
 			$date_from = $_POST['date_from'];
 			$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
 		}
-		if($date_until_off > -1)
-		{
+		if ($date_until_off > -1) {
 			$date_until = $_POST['date_until'];
 			$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
 		}
 
-		if(empty($account)
+		if (empty($account)
 		   || empty($subject)
-		   || empty($message))
-		{
+		   || empty($message)
+		) {
 			standard_error('missingfields');
 		}
 
 		// Does account exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
+		if ($db->num_rows($result) == 0)
 		{
 			standard_error('accountnotexisting');
 		}
 
 		// Does autoresponder exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
-		{
+		if ($db->num_rows($result) == 0) {
 			standard_error('invalidautoresponder');
 		}
 
-		$ResponderActive = 0;
-
-		if(isset($_POST['active'])
-		   && $_POST['active'] == '1')
-		{
-			$ResponderActive = 1;
-		}
+		$ResponderActive = (isset($_POST['active']) && $_POST['active'] == '1') ? 1 : 0;
 
 		$db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "`
 			SET `message` = '" . $db->escape($message) . "',
@@ -202,11 +166,8 @@ if($action == "edit")
 	$email = trim(htmlspecialchars($_GET['email']));
 
 	// Get account data
-
 	$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1");
-
-	if($db->num_rows($result) == 0)
-	{
+	if ($db->num_rows($result) == 0) {
 		standard_error('invalidautoresponder');
 	}
 
@@ -217,31 +178,25 @@ if($action == "edit")
 	$date_from = (int)$row['date_from'];
 	$date_until = (int)$row['date_until'];
 
-	if($date_from == -1)
-	{
+	if ($date_from == -1) {
 		$deactivated = '-1';
 		$date_from = '';
-	}
-	else
-	{
+	} else {
 		$deactivated = '0';
 		$date_from = date('d-m-Y', $date_from);
 	}
 	$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
 
-	if($date_until == -1)
-	{
+	if ($date_until == -1) {
 		$deactivated = '-1';
 		$date_until = '';
-	}
-	else
-	{
+	} else {
 		$deactivated = '0';
 		$date_until = date('d-m-Y', $date_until);
 	}
 	$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
 
-	#$isactive = makeyesno('active', '1', '0', $row['enabled']);
+	//$isactive = makeyesno('active', '1', '0', $row['enabled']);
 
 	$autoresponder_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_edit.php';
 	$autoresponder_edit_form = htmlform::genHTMLForm($autoresponder_edit_data);
@@ -249,26 +204,17 @@ if($action == "edit")
 	$title = $autoresponder_edit_data['autoresponder_edit']['title'];
 	$image = $autoresponder_edit_data['autoresponder_edit']['image'];
 
-	eval("echo \"" . getTemplate("autoresponder/autoresponder_edit") . "\";");
-}
-
-// Delete autoresponder
-
-else
-
-if($action == "delete")
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+	eval("echo \"" . getTemplate('autoresponder/autoresponder_edit') . "\";");
+} elseif ($action == 'delete') {
+	// Delete autoresponder
+	if (isset($_POST['send'])
+	   && $_POST['send'] == 'send'
+	) {
 		$account = trim($_POST['account']);
 
 		// Does autoresponder exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
-		{
+		if ($db->num_rows($result) == 0) {
 			standard_error('invalidautoresponder');
 		}
 
@@ -282,37 +228,25 @@ if($action == "delete")
 
 	$email = trim(htmlspecialchars($_GET['email']));
 	ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email));
-}
-
-// List existing autoresponders
-
-else
-{
+} else {
+	// List existing autoresponders
 	$autoresponder = '';
 	$count = 0;
 	$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC");
 
-	while($row = $db->fetch_array($result))
-	{
-		if($row['date_from'] == -1 && $row['date_until'] == -1)
-		{
+	while ($row = $db->fetch_array($result)) {
+		if ($row['date_from'] == -1 && $row['date_until'] == -1) {
 			$activated_date = $lng['panel']['not_activated'];
-		}
-		elseif($row['date_from'] == -1 && $row['date_until'] != -1)
-		{
+		} elseif($row['date_from'] == -1 && $row['date_until'] != -1) {
 			$activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']);
-		}
-		elseif($row['date_from'] != -1 && $row['date_until'] == -1)
-		{
+		} elseif($row['date_from'] != -1 && $row['date_until'] == -1) {
 			$activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']);
-		}
-		else
-		{
+		} else {
 			$activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']);
 		}
-		eval("\$autoresponder.=\"" . getTemplate("autoresponder/autoresponder_autoresponder") . "\";");
+		eval("\$autoresponder.=\"" . getTemplate('autoresponder/autoresponder_autoresponder') . "\";");
 		$count++;
 	}
 
-	eval("echo \"" . getTemplate("autoresponder/autoresponder") . "\";");
+	eval("echo \"" . getTemplate('autoresponder/autoresponder') . "\";");
 }

customer_domains.php

@@ -50,7 +50,7 @@ elseif($page == 'domains')
 			'd.aliasdomain' => $lng['domains']['aliasdomain']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_ipandport`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -151,6 +151,15 @@ elseif($page == 'domains')
 						$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
 					}
 
+					// get ssl-ips if activated
+					// FIXME for multi-ip later
+					$show_ssledit = false;
+					if ($settings['system']['use_ssl'] == '1'
+							&& $row['ssl_ipandport'] != 0
+							&& $row['caneditdomain'] == '1'
+					) {
+						$show_ssledit = true;
+					}
 					$row = htmlentities_array($row);
 					eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
 				}
@@ -196,7 +205,10 @@ elseif($page == 'domains')
 				$result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 				$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				inserttask('1');
+
+				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
+
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 			else
@@ -249,8 +261,17 @@ elseif($page == 'domains')
 				if(!preg_match('/^https?\:\/\//', $path)
 				   || !validateUrl($idna_convert->encode($path)))
 				{
-					$path = $userinfo['documentroot'] . '/' . $path;
-					$path = makeCorrectDir($path);
+					// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+					// set default path to subdomain or domain name
+					if((($path == '') || ($path == '/'))
+						&& $settings['system']['documentroot_use_default_value'] == 1)
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
+					}
+					else
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
+					}
 					if (strstr($path, ":") !== FALSE)
 					{
 						standard_error('pathmaynotcontaincolon');
@@ -329,8 +350,7 @@ elseif($page == 'domains')
 								`parentdomainid` = '" . (int)$domain_check['id'] . "', 
 								`isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', 
 								`openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "', 
-								`openbasedir_path` = '" . $db->escape($openbasedir_path) . "', 
-								`safemode` = '" . $db->escape($domain_check['safemode']) . "', 
+								`openbasedir_path` = '" . $db->escape($openbasedir_path) . "',
 								`speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "', 
 								`specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "', 
 								`ssl_redirect` = '" . $ssl_redirect . "', 
@@ -346,7 +366,10 @@ elseif($page == 'domains')
 					$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 					$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
 					inserttask('1');
+
+					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
+
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
@@ -378,7 +401,13 @@ elseif($page == 'domains')
 					}
 				}
 
-				#$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
+				// check if we at least have one ssl-ip/port, #1179
+				$ssl_ipsandports = '';
+				$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
+				if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
+					$ssl_ipsandports = 'notempty';
+				}
+
 				$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
 				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
 
@@ -395,7 +424,7 @@ elseif($page == 'domains')
 	elseif($action == 'edit'
 	       && $id != 0)
 	{
-		$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
+		$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `d`.`ipandport`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
 		$alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\'');
 		$alias_check = $alias_check['count'];
 		$_doredirect = false;
@@ -421,8 +450,17 @@ elseif($page == 'domains')
 				if(!preg_match('/^https?\:\/\//', $path)
 				   || !validateUrl($idna_convert->encode($path)))
 				{
-					$path = $userinfo['documentroot'] . '/' . $path;
-					$path = makeCorrectDir($path);
+					// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+					// set default path to subdomain or domain name
+					if((($path == '') || ($path == '/'))
+						&& $settings['system']['documentroot_use_default_value'] == 1)
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
+					}
+					else
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
+					}
 					if (strstr($path, ":") !== FALSE)
 					{
 						standard_error('pathmaynotcontaincolon');
@@ -521,7 +559,10 @@ elseif($page == 'domains')
 						$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
 						$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 						inserttask('1');
+
+						// Using nameserver, insert a task which rebuilds the server config
 						inserttask('4');
+
 					}
 
 					redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -570,9 +611,13 @@ elseif($page == 'domains')
 					}
 				}
 
-				#$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
-				#$iswildcarddomain = makeyesno('iswildcarddomain', '1', '0', $result['iswildcarddomain']);
-				#$isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
+				// check if we at least have one ssl-ip/port, #1179
+				$ssl_ipsandports = '';
+				$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
+				if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
+					$ssl_ipsandports = 'notempty';
+				}
+
 				$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
 
 				$result_ipandport = $db->query_first("SELECT `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` WHERE `id`='".(int)$result['ipandport']."'");
@@ -598,5 +643,127 @@ elseif($page == 'domains')
 		}
 	}
 }
+elseif ($page == 'domainssleditor') {
+
+	if ($action == ''
+			|| $action == 'view'
+	) {
+		if (isset($_POST['send'])
+				&& $_POST['send'] == 'send'
+		) {
+
+			$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
+			$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
+			$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
+			$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
+			$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
+
+			if ($ssl_cert_file != '' && $ssl_key_file == '') {
+				standard_error('sslcertificateismissingprivatekey');
+			}
+
+			$do_verify = true;
+
+			// no cert-file given -> forget everything
+			if ($ssl_cert_file == '') {
+				$ssl_key_file = '';
+				$ssl_ca_file = '';
+				$ssl_cert_chainfile = '';
+				$do_verify = false;
+			}
+
+			// verify certificate content
+			if ($do_verify) {
+				// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
+				// openssl_x509_parse() returns information about the supplied x509cert, including fields such as 
+				// subject name, issuer name, purposes, valid from and valid to dates etc.
+				$cert_content = openssl_x509_parse($ssl_cert_file);
+
+				if (is_array($cert_content)
+						&& isset($cert_content['subject'])
+						&& isset($cert_content['subject']['CN'])
+				) {
+					// TODO self-signed certs might differ and don't need/want this
+					/*
+					$domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'");
+					if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) {
+						standard_error('sslcertificatewrongdomain');
+					}
+					*/
+
+					// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
+					// Checks whether the given key is the private key that corresponds to cert.
+					if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
+						standard_error('sslcertificateinvalidcertkeypair');
+					}
+
+					// check optional stuff
+					if ($ssl_ca_file != '') {
+						$ca_content = openssl_x509_parse($ssl_ca_file);
+						if (!is_array($ca_content)) {
+							// invalid
+							standard_error('sslcertificateinvalidca');
+						}
+					}
+					if ($ssl_cert_chainfile != '') {
+						$chain_content = openssl_x509_parse($ssl_cert_chainfile);
+						if (!is_array($chain_content)) {
+							// invalid
+							standard_error('sslcertificateinvalidchain');
+						}
+					}
+				} else {
+					standard_error('sslcertificateinvalidcert');
+				}
+			}
+
+			// Add/Update database entry
+			$qrystart = "UPDATE ";
+			$qrywhere = "WHERE ";
+			if ($do_insert) {
+				$qrystart = "INSERT INTO ";
+				$qrywhere = ", ";
+			}
+			$db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
+					`ssl_cert_file` = '".$db->escape($ssl_cert_file)."',
+					`ssl_key_file` = '".$db->escape($ssl_key_file)."',
+					`ssl_ca_file` = '".$db->escape($ssl_ca_file)."',
+					`ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."'
+					".$qrywhere." `domainid`='".(int)$id."';"
+			);
+
+			// insert task to re-generate webserver-configs (#1260)
+			inserttask('1');
+
+			// back to domain overview
+			redirectTo($filename, array('page' => 'domains', 's' => $s));
+		}
+
+		$result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
+			WHERE `domainid`='".(int)$id."';"
+		);
+
+		$do_insert = false;
+		// if no entry can be found, behave like we have empty values
+		if (!is_array($result) || !isset($result['ssl_cert_file'])) {
+			$result = array(
+				'ssl_cert_file' => '',
+				'ssl_key_file' => '',
+				'ssl_ca_file' => '',
+				'ssl_cert_chainfile' => ''
+			);
+			$do_insert = true;
+		}
+
+		$result = htmlentities_array($result);
+
+		$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
+		$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
+
+		$title = $ssleditor_data['domain_ssleditor']['title'];
+		$image = $ssleditor_data['domain_ssleditor']['image'];
+
+		eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
+	}
+}
 
-?>

customer_email.php

@@ -237,7 +237,7 @@ elseif($page == 'emails')
 					standard_error('emailiswrong', $email_full);
 				}
 
-				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE ( `email`='" . $db->escape($email) . "' OR `email_full` = '" . $db->escape($email_full) . "' ) AND `customerid`='" . (int)$userinfo['customerid'] . "'");
+				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE (`email` = '" . strtolower($db->escape($email)) . "' OR `email_full` = '" . strtolower($db->escape($email_full)) . "') AND `customerid`='" . (int)$userinfo['customerid'] . "'");
 
 				if($email == ''
 				   || $email_full == ''
@@ -253,7 +253,7 @@ elseif($page == 'emails')
 				{
 					standard_error('maindomainnonexist', $domain);
 				}
-				elseif($email_check['email_full'] == $email_full)
+				elseif(strtolower($email_check['email_full']) == strtolower($email_full))
 				{
 					standard_error('emailexistalready', $email_full);
 				}
@@ -281,9 +281,15 @@ elseif($page == 'emails')
 					$domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']);
 				}
 
-				#$iscatchall = makeyesno('iscatchall', '1', '0', '0');
+				//$iscatchall = makeyesno('iscatchall', '1', '0', '0');
 
 				$email_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_add.php';
+
+				if ( $settings['catchall']['catchall_enabled'] != '1' )
+				{
+					unset($email_add_data['emails_add']['sections']['section_a']['fields']['iscatchall']);
+				}
+
 				$email_add_form = htmlform::genHTMLForm($email_add_data);
 
 				$title = $email_add_data['emails_add']['title'];
@@ -330,6 +336,12 @@ elseif($page == 'emails')
 			$result = htmlentities_array($result);
 
 			$email_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_edit.php';
+
+			if ( $settings['catchall']['catchall_enabled'] != '1' )
+			{
+				unset($email_edit_data['emails_edit']['sections']['section_a']['fields']['mail_catchall']);
+			}
+
 			$email_edit_form = htmlform::genHTMLForm($email_edit_data);
 
 			$title = $email_edit_data['emails_edit']['title'];
@@ -341,34 +353,41 @@ elseif($page == 'emails')
 	elseif($action == 'togglecatchall'
 	       && $id != 0)
 	{
-		$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-
-		if(isset($result['email'])
-		   && $result['email'] != '')
+		if ( $settings['catchall']['catchall_enabled'] == '1' )
 		{
-			if($result['iscatchall'] == '1')
-			{
-				$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
-			}
-			else
-			{
-				$email_parts = explode('@', $result['email_full']);
-				$email = '@' . $email_parts[1];
-				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
+			$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 
-				if($email_check['email'] == $email)
+			if(isset($result['email'])
+			   && $result['email'] != '')
+			{
+				if($result['iscatchall'] == '1')
 				{
-					standard_error('youhavealreadyacatchallforthisdomain');
-					exit;
+					$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
 				}
 				else
 				{
-					$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
-					$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
-				}
-			}
+					$email_parts = explode('@', $result['email_full']);
+					$email = '@' . $email_parts[1];
+					$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
 
-			redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
+					if($email_check['email'] == $email)
+					{
+						standard_error('youhavealreadyacatchallforthisdomain');
+						exit;
+					}
+					else
+					{
+						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
+						$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
+					}
+				}
+
+				redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
+			}
+		}
+		else
+		{
+			standard_error(array('operationnotpermitted', 'featureisdisabled'), 'Catchall');
 		}
 	}
 }
@@ -439,11 +458,42 @@ elseif($page == 'accounts')
 							$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
 						}
 
-						$db->query("INSERT INTO `" . TABLE_MAIL_USERS . "` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($email_full) . "', '" . $db->escape($username) . "', " . ($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "'," : '') . " ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_full . '/') . "', '" . (int)$settings['system']['vmail_uid'] . "', '" . (int)$settings['system']['vmail_gid'] . "', '" . (int)$result['domainid'] . "', 'y', '" . (int)$quota . "', '" . (int)$userinfo['imap'] . "', '" . (int)$userinfo['pop3'] . "')");
+						$cryptPassword = makeCryptPassword($password);
+
+						$email_user=substr($email_full,0,strrpos($email_full,"@"));
+						$email_domain=substr($email_full,strrpos($email_full,"@")+1);
+						$maildirname=trim($settings['system']['vmail_maildirname']);
+						// Add trailing slash to Maildir if needed
+						$maildirpath=$maildirname;
+						if (!empty($maildirname) and substr($maildirname,-1) != "/") $maildirpath.="/";
+
+						$db->query("INSERT INTO `" . TABLE_MAIL_USERS . 
+							"` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) ".
+							"VALUES (".
+							"'" . (int)$userinfo['customerid'] . "', ".
+							"'" . $db->escape($email_full) . "', ".
+							"'" . $db->escape($username) . "', " .
+							($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "', " : '') .
+							"'" . $db->escape($cryptPassword) . "', ".
+							"'" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_domain . "/" . $email_user . "/" . $maildirpath) . "', ".
+							"'" . (int)$settings['system']['vmail_uid'] . "', ".
+							"'" . (int)$settings['system']['vmail_gid'] . "', ".
+							"'" . (int)$result['domainid'] . "', ".
+							"'y', ".
+							"'" . (int)$quota . "', ".
+							"'" . (int)$userinfo['imap'] . "', ".
+							"'" . (int)$userinfo['pop3'] . "')");
+
 						$popaccountid = $db->insert_id();
 						$result['destination'].= ' ' . $email_full;
-						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', `popaccountid` = '" . (int)$popaccountid . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used`=`email_accounts_used`+1, `email_quota_used`=`email_quota_used`+" . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
+						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET ".
+							"`destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', ".
+							"`popaccountid` = '" . (int)$popaccountid . "' ".
+							"WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET ".
+							"`email_accounts_used`=`email_accounts_used`+1, ".
+							"`email_quota_used`=`email_quota_used`+" . (int)$quota . " ".
+							"WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 						$log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'");
 						$replace_arr = array(
 							'EMAIL' => $email_full,
@@ -462,7 +512,7 @@ elseif($page == 'accounts')
 							$mail->Subject = $mail_subject;
 							$mail->AltBody = $mail_body;
 							$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
-							$mail->AddAddress($email_full, getCorrectUserSalutation($userinfo));
+							$mail->AddAddress($email_full);
 							$mail->Send();
 						} catch(phpmailerException $e) {
 							$mailerr_msg = $e->errorMessage();
@@ -557,7 +607,8 @@ elseif($page == 'accounts')
 				$password = validatePassword($password);
 				
 				$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'");
-				$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
+				$cryptPassword = makeCryptPassword($password);
+				$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
 				redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
 			}
 			else

customer_extras.php

@@ -50,7 +50,6 @@ elseif($page == 'backup')
 
     if(isset($_POST['send']) && $_POST['send'] == 'send'){
 	$backup_enabled = ($_POST['backup_enabled'] == '1' ? '1' : '0');
-	$backup_ftp_enabled = ($_POST['backup_ftp_enabled'] == '1' ? '1' : '0');
 	
         $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `backup_enabled`='" . $backup_enabled . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 	redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -353,18 +352,28 @@ elseif($page == 'htaccess')
 				standard_error('invalidpath');
 			}
 
-			if(isset($_POST['options_cgi']))
-			{
-				$options_cgi = intval($_POST['options_cgi']);
+			if(isset($_POST['options_cgi'])
+				&& (int)$_POST['options_cgi'] != 0
+			) {
+				$options_cgi = '1';
 			}
 			else
 			{
 				$options_cgi = '0';
 			} 
 
-			$error404path = correctErrorDocument($_POST['error404path']);
-			$error403path = correctErrorDocument($_POST['error403path']);
-			$error500path = correctErrorDocument($_POST['error500path']);
+			$error404path = '';
+			if (isset($_POST['error404path'])) {
+				$error404path = correctErrorDocument($_POST['error404path']);
+			}
+			$error403path = '';
+			if (isset($_POST['error403path'])) {
+				$error403path = correctErrorDocument($_POST['error403path']);
+			}
+			$error500path = '';
+			if (isset($_POST['error500path'])) {
+				$error500path = correctErrorDocument($_POST['error500path']);
+			}
 
 			if($path_dupe_check['path'] == $path)
 			{
@@ -393,9 +402,11 @@ elseif($page == 'htaccess')
 		else
 		{
 			$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
-			#$options_indexes = makeyesno('options_indexes', '1', '0', '0');
 			$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
-			#$options_cgi = makeyesno('options_cgi', '1', '0', '0');
+			/*
+			$options_indexes = makeyesno('options_indexes', '1', '0', '0');
+			$options_cgi = makeyesno('options_cgi', '1', '0', '0');
+			*/
 
 			$htaccess_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_add.php';
 			$htaccess_add_form = htmlform::genHTMLForm($htaccess_add_data);
@@ -460,9 +471,11 @@ elseif($page == 'htaccess')
 				$result['error404path'] = $result['error404path'];
 				$result['error403path'] = $result['error403path'];
 				$result['error500path'] = $result['error500path'];
-				#$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
 				$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
-				#$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
+				/*
+				$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
+				$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
+				*/
 				$result = htmlentities_array($result);
 
 				$htaccess_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_edit.php';

customer_ftp.php

@@ -22,27 +22,20 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
+require('./lib/init.php');
 
-require ("./lib/init.php");
-
-if(isset($_POST['id']))
-{
+$id = 0;
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif(isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }
 
-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
-	eval("echo \"" . getTemplate("ftp/ftp") . "\";");
-}
-elseif($page == 'accounts')
-{
-	if($action == '')
-	{
+	eval("echo \"" . getTemplate('ftp/ftp') . "\";");
+} elseif ($page == 'accounts') {
+	if ($action == '') {
 		$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
 		$fields = array(
 			'username' => $lng['login']['username'],
@@ -59,23 +52,18 @@ elseif($page == 'accounts')
 		$count = 0;
 		$accounts = '';
 
-		while($row = $db->fetch_array($result))
-		{
-			if($paging->checkDisplay($i))
-			{
-				if(strpos($row['homedir'], $userinfo['documentroot']) === 0)
-				{
+		while ($row = $db->fetch_array($result)) {
+			if ($paging->checkDisplay($i)) {
+				if (strpos($row['homedir'], $userinfo['documentroot']) === 0) {
 					$row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot']));
-				}
-				else
-				{
+				} else {
 					$row['documentroot'] = $row['homedir'];
 				}
 
 				$row['documentroot'] = makeCorrectDir($row['documentroot']);
 				
 				$row = htmlentities_array($row);
-				eval("\$accounts.=\"" . getTemplate("ftp/accounts_account") . "\";");
+				eval("\$accounts.=\"" . getTemplate('ftp/accounts_account') . "\";");
 				$count++;
 			}
 
@@ -83,19 +71,16 @@ elseif($page == 'accounts')
 		}
 
 		$ftps_count = $db->num_rows($result);
-		eval("echo \"" . getTemplate("ftp/accounts") . "\";");
-	}
-	elseif($action == 'delete'
-	       && $id != 0)
-	{
+		eval("echo \"" . getTemplate('ftp/accounts') . "\";");
+	} elseif ($action == 'delete' && $id != 0) {
 		$result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 
-		if(isset($result['username'])
-		   && $result['username'] != $userinfo['loginname'])
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+		if (isset($result['username'])
+		   && $result['username'] != $userinfo['loginname']
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'");
 				$result = $db->query_first("SELECT `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 				$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($result['username']) . "'");
@@ -103,95 +88,69 @@ elseif($page == 'accounts')
 				$log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'");
 				$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 
-				if($userinfo['ftps_used'] == '1')
-				{
-					$resetaccnumber = " , `ftp_lastaccountnumber`='0'";
-				}
-				else
-				{
-					$resetaccnumber = '';
-				}
+				$resetaccnumber = ($userinfo['ftps_used'] == '1') ? " , `ftp_lastaccountnumber`='0'" : '';
 
 				// refs #293
-				if(isset($_POST['delete_userfiles'])
-				  && (int)$_POST['delete_userfiles'] == 1)
-				{
+				if (isset($_POST['delete_userfiles'])
+				  && (int)$_POST['delete_userfiles'] == 1
+				) {
 					inserttask('8', $userinfo['loginname'], $result['homedir']);
 				}
 
 				$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			}
-			else
-			{
+			} else {
 				ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
 			}
-		}
-		else
-		{
+		} else {
 			standard_error('ftp_cantdeletemainaccount');
 		}
-	}
-	elseif($action == 'add')
-	{
-		if($userinfo['ftps_used'] < $userinfo['ftps']
-		   || $userinfo['ftps'] == '-1')
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+	} elseif ($action == 'add') {
+		if ($userinfo['ftps_used'] < $userinfo['ftps']
+		   || $userinfo['ftps'] == '-1'
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				$path = validate($_POST['path'], 'path');
 				$password = validate($_POST['ftp_password'], 'password');
 				$password = validatePassword($password);
 
-				$sendinfomail = intval($_POST['sendinfomail']);
-				if($sendinfomail != 1)
-				{
+				$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
+				if ($sendinfomail != 1) {
 					$sendinfomail = 0;
 				}
 
-				if($settings['customer']['ftpatdomain'] == '1')
-				{
+				if ($settings['customer']['ftpatdomain'] == '1') {
 					$ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
-					if($ftpusername == '')
-					{
+					if ($ftpusername == '') {
 						standard_error(array('stringisempty', 'username'));
 					}
 					$ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain'));
 					$ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
-					if($ftpdomain_check['domain'] != $ftpdomain)
-					{
+					if ($ftpdomain_check['domain'] != $ftpdomain) {
 						standard_error('maindomainnonexist', $domain);
 					}
 					$username = $ftpusername . "@" . $ftpdomain;
-				}
-				else
-				{
+				} else {
 					$username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1);
 				}
 				
 				$username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\'');
 				
-				if(!empty($username_check) && $username_check['username'] = $username)
-				{
+				if (!empty($username_check) && $username_check['username'] = $username) {
 					standard_error('usernamealreadyexists', $username);
-				}
-				elseif($password == '')
-				{
+				} elseif ($password == '') {
 					standard_error(array('stringisempty', 'mypassword'));
-				}
-				elseif($path == '')
-				{
+				} elseif ($path == '') {
 					standard_error('patherror');
-				}
-				else
-				{
+				} else {
 					$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
-					
-					$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
+
+					$cryptPassword = makeCryptPassword($password);
+					$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
 					$result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'");
-					while($row = $db->fetch_array($result))
-					{
+					while ($row = $db->fetch_array($result)) {
 						$db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')");
 					}
 					$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'");
@@ -200,10 +159,10 @@ elseif($page == 'accounts')
 					$log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'");
 					inserttask(5);
 
-					if($sendinfomail == 1)
-					{
+					if ($sendinfomail == 1) {
 						$replace_arr = array(
-							'CUST_NAME' => getCorrectUserSalutation($userinfo),
+							'SALUTATION' => getCorrectUserSalutation($userinfo),
+							'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
 							'USR_NAME' => $username,
 							'USR_PASS' => $password,
 							'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot'])))
@@ -240,35 +199,29 @@ elseif($page == 'accounts')
 
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
-			}
-			else
-			{
+			} else {
 				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/');
 
-				if($settings['customer']['ftpatdomain'] == '1')
-				{
+				if ($settings['customer']['ftpatdomain'] == '1') {
 					$domainlist = array();
 					$domains = '';
 
 					$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 
-					while($row_domain = $db->fetch_array($result_domains))
-					{
+					while ($row_domain = $db->fetch_array($result_domains)) {
 						$domainlist[] =  $row_domain['domain'];
 					}
 
 					sort($domainlist);
 
-					if(isset($domainlist[0]) && $domainlist[0] != '')
-					{
-						foreach($domainlist as $dom)
-						{
+					if (isset($domainlist[0]) && $domainlist[0] != '') {
+						foreach ($domainlist as $dom) {
 							$domains .= makeoption($idna_convert->decode($dom), $dom);
 						}
 					}
 				}
 
-				#$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
+				//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
 
 				$ftp_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_add.php';
 				$ftp_add_form = htmlform::genHTMLForm($ftp_add_data);
@@ -276,60 +229,50 @@ elseif($page == 'accounts')
 				$title = $ftp_add_data['ftp_add']['title'];
 				$image = $ftp_add_data['ftp_add']['image'];
 
-				eval("echo \"" . getTemplate("ftp/accounts_add") . "\";");
+				eval("echo \"" . getTemplate('ftp/accounts_add') . "\";");
 			}
 		}
-	}
-	elseif($action == 'edit'
-	       && $id != 0)
-	{
+	} elseif ($action == 'edit' && $id != 0) {
 		$result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 
-		if(isset($result['username'])
-		   && $result['username'] != '')
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+		if (isset($result['username'])
+		   && $result['username'] != ''
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				$path = validate($_POST['path'], 'path');
 				
 				$_setnewpass = false;
-				if(isset($_POST['ftp_password']) && $_POST['ftp_password'] != '')
-				{
+				if (isset($_POST['ftp_password']) && $_POST['ftp_password'] != '') {
 					$password = validate($_POST['ftp_password'], 'password');
 					$password = validatePassword($password);
 					$_setnewpass = true;
 				}
 
-				if($_setnewpass)
-				{
-					if($password == '')
-					{
+				if ($_setnewpass) {
+					if ($password == '') {
 						standard_error(array('stringisempty', 'mypassword'));
 						exit;
 					}
-					else
-					{
-						$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
-						$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+					$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
+					$cryptPassword = makeCryptPassword($password);
+					$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 						
-						// also update customers backup user password if password of main ftp user is changed
-						if(!preg_match('/' . $settings['customer']['ftpprefix'] . '/', $result['username'])){
-						    $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $result['username'] . "_backup'");
-						}
+					// also update customers backup user password if password of main ftp user is changed
+					if(!preg_match('/' . $settings['customer']['ftpprefix'] . '/', $result['username'])){
+					    $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $result['username'] . "_backup'");
 					}
 				}
 				
-				if($path != '')
-				{
+				if ($path != '') {
 					$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
-					
-					if($path != $result['homedir'])
-					{
-						if(!file_exists($path))
-						{
-							mkDirWithCorrectOwnership($userinfo['documentroot'], $path, $result['uid'], $result['gid']);
-							inserttask(5); /* Let the cronjob do the rest */
+
+					if ($path != $result['homedir']) {
+						if (!file_exists($path)) {
+							// it's the task for "new ftp" but that will 
+							// create all directories and correct their permissions
+							inserttask(5);
 						}
 
 						$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'");
@@ -338,30 +281,23 @@ elseif($page == 'accounts')
 				}
 
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			}
-			else
-			{
-				if(strpos($result['homedir'], $userinfo['documentroot']) === 0)
-				{
+			} else {
+				if (strpos($result['homedir'], $userinfo['documentroot']) === 0) {
 					$homedir = substr($result['homedir'], strlen($userinfo['documentroot']));
-				}
-				else
-				{
+				} else {
 					$homedir = $result['homedir'];
 				}
 				$homedir = makeCorrectDir($homedir);
 
 				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir);
 
-				if($settings['customer']['ftpatdomain'] == '1')
-				{
+				if ($settings['customer']['ftpatdomain'] == '1') {
 					$domains = '';
 
 					$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 
-					while($row_domain = $db->fetch_array($result_domains))
-					{
-						$domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
+					while ($row_domain = $db->fetch_array($result_domains)) {
+						$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
 					}
 				}
 
@@ -371,10 +307,8 @@ elseif($page == 'accounts')
 				$title = $ftp_edit_data['ftp_edit']['title'];
 				$image = $ftp_edit_data['ftp_edit']['image'];
 
-				eval("echo \"" . getTemplate("ftp/accounts_edit") . "\";");
+				eval("echo \"" . getTemplate('ftp/accounts_edit') . "\";");
 			}
 		}
 	}
 }
-
-?>

customer_index.php

@@ -22,40 +22,32 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
+require('./lib/init.php');
 
-require ("./lib/init.php");
+if ($action == 'logout') {
+	$log->logAction(USR_ACTION, LOG_NOTICE, 'logged out');
 
-if($action == 'logout')
-{
-	$log->logAction(USR_ACTION, LOG_NOTICE, "logged out");
-
-	if($settings['session']['allow_multiple_login'] == '1')
-	{
-		$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0' AND `hash` = '" . $s . "'");
+        $query = "DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'";
+	if ($settings['session']['allow_multiple_login'] == '1') {
+		$query .= " AND `hash` = '" . $s . "'";
 	}
-	else
-	{
-		$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'");
-	}
-
+	$db->query($query);
 	redirectTo('index.php');
 	exit;
 }
 
-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index");
 	$domains = '';
 	$result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' ");
 	$domainArray = array();
 
-	while($row = $db->fetch_array($result))
-	{
+	while ($row = $db->fetch_array($result)) {
 		$domainArray[] = $idna_convert->decode($row['domain']);
 	}
 
 	natsort($domainArray);
-	$domains = implode(', ', $domainArray);
+	$domains = implode(',<br />', $domainArray);
 	$userinfo['email'] = $idna_convert->decode($userinfo['email']);
 	$yesterday = time() - (60 * 60 * 24);
 	$month = date('M Y', $yesterday);
@@ -77,67 +69,49 @@ if($page == 'overview')
 	$awaitingtickets = $opentickets['count'];
 	$awaitingtickets_text = '';
 
-	if($opentickets > 0)
-	{
+	if ($opentickets > 0) {
 		$awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>'));
 	}
 
-	eval("echo \"" . getTemplate("index/index") . "\";");
-}
-elseif($page == 'change_password')
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+	eval("echo \"" . getTemplate('index/index') . "\";");
+} elseif ($page == 'change_password') {
+	if (isset($_POST['send']) && $_POST['send'] == 'send') {
 		$old_password = validate($_POST['old_password'], 'old password');
-
-		if(md5($old_password) != $userinfo['password'])
-		{
+		if (md5($old_password) != $userinfo['password']) {
 			standard_error('oldpasswordnotcorrect');
 			exit;
 		}
 
-		$new_password = validate($_POST['new_password'], 'new password');
-		$new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
+		$new_password = validatePassword($_POST['new_password'], 'new password');
+		$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm');
 
-		if($old_password == '')
-		{
+		if ($old_password == '') {
 			standard_error(array('stringisempty', 'oldpassword'));
-		}
-		elseif($new_password == '')
-		{
+		} elseif($new_password == '') {
 			standard_error(array('stringisempty', 'newpassword'));
-		}
-		elseif($new_password_confirm == '')
-		{
+		} elseif($new_password_confirm == '') {
 			standard_error(array('stringisempty', 'newpasswordconfirm'));
-		}
-		elseif($new_password != $new_password_confirm)
-		{
+		} elseif($new_password != $new_password_confirm) {
 			standard_error('newpasswordconfirmerror');
-		}
-		else
-		{
+		} else {
 			$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'");
 			$log->logAction(USR_ACTION, LOG_NOTICE, 'changed password');
 
-			if(isset($_POST['change_main_ftp'])
-			   && $_POST['change_main_ftp'] == 'true')
-			{
-				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($new_password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
+			if (isset($_POST['change_main_ftp'])
+			   && $_POST['change_main_ftp'] == 'true'
+			) {
+				$cryptPassword = makeCryptPassword($new_password);
+				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
 				$log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password');
 			}
 
-			if(isset($_POST['change_webalizer'])
-			   && $_POST['change_webalizer'] == 'true')
-			{
-				if(CRYPT_STD_DES == 1)
-				{
+			if (isset($_POST['change_webalizer'])
+			   && $_POST['change_webalizer'] == 'true'
+			) {
+				if (CRYPT_STD_DES == 1) {
 					$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
 					$new_webalizer_password = crypt($new_password, $saltfordescrypt);
-				}
-				else
-				{
+				} else {
 					$new_webalizer_password = crypt($new_password);
 				}
 
@@ -146,72 +120,52 @@ elseif($page == 'change_password')
 
 			redirectTo($filename, Array('s' => $s));
 		}
+	} else {
+		eval("echo \"" . getTemplate('index/change_password') . "\";");
 	}
-	else
-	{
-		eval("echo \"" . getTemplate("index/change_password") . "\";");
-	}
-}
-elseif($page == 'change_language')
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+} elseif ($page == 'change_language') {
+	if (isset($_POST['send']) && $_POST['send'] == 'send') {
 		$def_language = validate($_POST['def_language'], 'default language');
-
-		if(isset($languages[$def_language]))
-		{
+		if (isset($languages[$def_language])) {
 			$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 			$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'");
 			$log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
 		}
 
 		redirectTo($filename, Array('s' => $s));
-	}
-	else
-	{
-		$language_options = '';
-
+	} else {
 		$default_lang = $settings['panel']['standardlanguage'];
-		if($userinfo['def_language'] != '') { 
+		if ($userinfo['def_language'] != '') { 
 			$default_lang = $userinfo['def_language'];
 		}
 
-		while(list($language_file, $language_name) = each($languages))
-		{
-			$language_options.= makeoption($language_name, $language_file, $default_lang, true);
+		$language_options = '';
+		while (list($language_file, $language_name) = each($languages)) {
+			$language_options .= makeoption($language_name, $language_file, $default_lang, true);
 		}
 
-		eval("echo \"" . getTemplate("index/change_language") . "\";");
+		eval("echo \"" . getTemplate('index/change_language') . "\";");
 	}
-}
-elseif($page == 'change_theme')
-{
-	if(isset($_POST['send'])
-		&& $_POST['send'] == 'send'
-	) {
+} elseif ($page == 'change_theme') {
+	if (isset($_POST['send']) && $_POST['send'] == 'send') {
 		$theme = validate($_POST['theme'], 'theme');
  
 		$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 		$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
 		$log->logAction(USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'");
 		redirectTo($filename, Array('s' => $s));
-	}
-	else
-	{
-		$theme_options = '';
-
+	} else {
 		$default_theme = $settings['panel']['default_theme'];
-		if($userinfo['theme'] != '') {
+		if ($userinfo['theme'] != '') {
 			$default_theme = $userinfo['theme'];
 		}
 
+		$theme_options = '';
 		$themes_avail = getThemes();
-		foreach($themes_avail as $t)
-		{
-			$theme_options.= makeoption($t, $t, $default_theme, true);
+		foreach ($themes_avail as $t) {
+			$theme_options .= makeoption($t, $t, $default_theme, true);
 		}
 
-		eval("echo \"" . getTemplate("index/change_theme") . "\";");
+		eval("echo \"" . getTemplate('index/change_theme') . "\";");
 	}
 }

customer_mysql.php

@@ -22,30 +22,22 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-
 $need_db_sql_data = true;
 $need_root_db_sql_data = true;
-require ("./lib/init.php");
+require('./lib/init.php');
 
-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif(isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }
 
-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
 	$lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']);
-	eval("echo \"" . getTemplate("mysql/mysql") . "\";");
-}
-elseif($page == 'mysqls')
-{
-	if($action == '')
-	{
+	eval("echo \"" . getTemplate('mysql/mysql') . "\";");
+} elseif($page == 'mysqls') {
+	if ($action == '') {
 		$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
 		$fields = array(
 			'databasename' => $lng['mysql']['databasename'],
@@ -64,130 +56,115 @@ elseif($page == 'mysqls')
 
 		// Begin root-session
 		$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
-		unset($db_root->password);
-		while($row = $db->fetch_array($result))
-		{
-			if($paging->checkDisplay($i))
-			{
+		while ($row = $db->fetch_array($result)) {
+			if ($paging->checkDisplay($i)) {
 				$row = htmlentities_array($row);
 				$mbdata = $db_root->query_first("SELECT SUM( data_length + index_length) / 1024 / 1024 'MB' FROM information_schema.TABLES WHERE table_schema = '" . $db_root->escape($row['databasename']) . "' GROUP BY table_schema ;");
 				$row['size'] = number_format($mbdata['MB'], 3, '.', '');
-				eval("\$mysqls.=\"" . getTemplate("mysql/mysqls_database") . "\";");
+				eval("\$mysqls.=\"" . getTemplate('mysql/mysqls_database') . "\";");
 				$count++;
 			}
-
 			$i++;
 		}
 		$db_root->close();
 		// End root-session
 
 		$mysqls_count = $db->num_rows($result);
-		eval("echo \"" . getTemplate("mysql/mysqls") . "\";");
-	}
-	elseif($action == 'delete'
-	       && $id != 0)
-	{
+		eval("echo \"" . getTemplate('mysql/mysqls') . "\";");
+	} elseif($action == 'delete' && $id != 0) {
 		$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
 
-		if(isset($result['databasename'])
-		   && $result['databasename'] != '')
-		{
-			if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
-			{
+		if (isset($result['databasename'])
+		   && $result['databasename'] != ''
+		) {
+			if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) {
 				$result['dbserver'] = 0;
 			}
 
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				// Begin root-session
-
 				$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
-				unset($db_root->password);
-				foreach(array_map('trim', array_unique(explode(',', $settings['system']['mysql_access_host']))) as $mysql_access_host)
-				{
-					$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-					$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($result['databasename'])) . '` . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-					$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($result['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
+				$log->logAction(USR_ACTION, LOG_INFO, "deleted database '" . $result['databasename'] . "'");
+				if (mysql_get_server_info() < '5.0.2') { 
+					// Revoke privileges (only required for MySQL 4.1.2 - 5.0.1)
+					$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($result['databasename']) .'\'',false,true);
+				}
+
+				$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($result['databasename']) . "'");
+				while ($host = $db_root->fetch_array($host_res)) {
+					// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+)
+					$db_root->query('DROP USER \'' . $db_root->escape($result['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true);
 				}
 
 				$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`');
 				$db_root->query('FLUSH PRIVILEGES');
 				$db_root->close();
-
 				// End root-session
 
 				$db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
 
-				if($userinfo['mysqls_used'] == '1')
-				{
-					$resetaccnumber = " , `mysql_lastaccountnumber`='0' ";
-				}
-				else
-				{
-					$resetaccnumber = '';
-				}
+				$resetaccnumber = ($userinfo['mysqls_used'] == '1') ? " , `mysql_lastaccountnumber`='0' " : '';
 
 				$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			}
-			else
-			{
+			} else {
 				$dbnamedesc = $result['databasename'];
-				if(isset($result['description']) && $result['description'] != '') {
-					$dbnamedesc.= ' ('.$result['description'].')';
+				if (isset($result['description']) && $result['description'] != '') {
+					$dbnamedesc .= ' ('.$result['description'].')';
 				}
 				ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc);
 			}
 		}
-	}
-	elseif($action == 'add')
-	{
-		if($userinfo['mysqls_used'] < $userinfo['mysqls']
-		   || $userinfo['mysqls'] == '-1')
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+	} elseif ($action == 'add') {
+		if ($userinfo['mysqls_used'] < $userinfo['mysqls']
+		   || $userinfo['mysqls'] == '-1'
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				$password = validate($_POST['mysql_password'], 'password');
 				$password = validatePassword($password);
 
-				$sendinfomail = intval($_POST['sendinfomail']);
-				if($sendinfomail != 1)
-				{
+				$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
+				if ($sendinfomail != 1) {
 					$sendinfomail = 0;
 				}
 
-				if($password == '')
-				{
+				if ($password == '') {
 					standard_error(array('stringisempty', 'mypassword'));
-				}
-				else
-				{
-					$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
-
-					if(count($sql_root) > 1)
-					{
+				} else {
+					$dbserver = 0;
+					if (count($sql_root) > 1) {
 						$dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0);
-
-						if(!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver]))
-						{
+						if (!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver])) {
 							$dbserver = 0;
 						}
 					}
-					else
-					{
-						$dbserver = 0;
-					}
+					
+					// validate description before actual adding the database, #1052
+					$databasedescription = validate(trim($_POST['description']), 'description');
 
 					// Begin root-session
-
 					$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
-					unset($db_root->password);
+
+					if (strtoupper($settings['customer']['mysqlprefix']) == 'RANDOM') {
+						$result = $db_root->query('SELECT `User` FROM mysql.user');
+						while ($row = $db_root->fetch_array($result)) {
+							$allsqlusers[] = $row[User];
+						}
+						$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
+						while (in_array($username , $allsqlusers)) {
+							$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
+						}
+					} else {
+						$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
+					}
+
 					$db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`');
 					$log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'");
-					foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
-					{
+					foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) {
 						$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\'');
 						$db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
 						$log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'");
@@ -195,24 +172,21 @@ elseif($page == 'mysqls')
 
 					$db_root->query('FLUSH PRIVILEGES');
 					$db_root->close();
-
 					// End root-session
-					// Statement modifyed for Database description -- PH 2004-11-29
 
-					$databasedescription = validate($_POST['description'], 'description');
+					// Statement modified for Database description -- PH 2004-11-29
 					$result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")');
 					$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
 
-					if($sendinfomail == 1)
-					{
+					if ($sendinfomail == 1) {
 						$pma = $lng['admin']['notgiven'];
-						if($settings['panel']['phpmyadmin_url'] != '')
-						{
+						if ($settings['panel']['phpmyadmin_url'] != '') {
 							$pma = $settings['panel']['phpmyadmin_url'];
 						}
 
 						$replace_arr = array(
-							'CUST_NAME' => getCorrectUserSalutation($userinfo),
+							'SALUTATION' => getCorrectUserSalutation($userinfo),
+							'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
 							'DB_NAME' => $username,
 							'DB_PASS' => $password,
 							'DB_DESC' => $databasedescription,
@@ -251,17 +225,14 @@ elseif($page == 'mysqls')
 
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
-			}
-			else
-			{
+			} else {
 				$mysql_servers = '';
 
-				foreach($sql_root as $mysql_server => $mysql_server_details)
-				{
+				foreach ($sql_root as $mysql_server => $mysql_server_details) {
 					$mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server);
 				}
 
-				#$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
+				//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
 
 				$mysql_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_add.php';
 				$mysql_add_form = htmlform::genHTMLForm($mysql_add_data);
@@ -269,67 +240,53 @@ elseif($page == 'mysqls')
 				$title = $mysql_add_data['mysql_add']['title'];
 				$image = $mysql_add_data['mysql_add']['image'];
 
-				eval("echo \"" . getTemplate("mysql/mysqls_add") . "\";");
+				eval("echo \"" . getTemplate('mysql/mysqls_add') . "\";");
 			}
 		}
-	}
-	elseif($action == 'edit'
-	       && $id != 0)
-	{
+	} elseif ($action == 'edit' && $id != 0) {
 		$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"');
 
-		if(isset($result['databasename'])
-		   && $result['databasename'] != '')
-		{
-			if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
-			{
+		if (isset($result['databasename'])
+		   && $result['databasename'] != ''
+		) {
+			if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) {
 				$result['dbserver'] = 0;
 			}
 
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				// Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29
 				$password = validate($_POST['mysql_password'], 'password');
-
-				if($password != '')
-				{
+				if ($password != '') {
 					// validate password
 					$password = validatePassword($password);
 
 					// Begin root-session
 					$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
-					unset($db_root->password);
-					foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
-					{
+					foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) {
 						$db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
 					}
 
 					$db_root->query('FLUSH PRIVILEGES');
 					$db_root->close();
-
 					// End root-session
 				}
 
 				// Update the Database description -- PH 2004-11-29
-
 				$log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'");
 				$databasedescription = validate($_POST['description'], 'description');
 				$result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			}
-			else
-			{
+			} else {
 				$mysql_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_edit.php';
 				$mysql_edit_form = htmlform::genHTMLForm($mysql_edit_data);
 
 				$title = $mysql_edit_data['mysql_edit']['title'];
 				$image = $mysql_edit_data['mysql_edit']['image'];
 
-				eval("echo \"" . getTemplate("mysql/mysqls_edit") . "\";");
+				eval("echo \"" . getTemplate('mysql/mysqls_edit') . "\";");
 			}
 		}
 	}
 }
-
-?>

customer_tickets.php

@@ -28,6 +28,17 @@ require ("./lib/init.php");
 if(isset($_POST['id']))
 {
 	$id = intval($_POST['id']);
+	
+	/*
+	 * Check if the current user is allowed to see the current ticket.
+	 */
+	$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `customerid` = '".$userinfo['customerid']."'";
+	
+	$result = $db->query_first($sql);
+	if ($result == null) {
+		// no rights to see the requested ticket
+		standard_error(array('ticketnotaccessible'));
+	}
 }
 elseif(isset($_GET['id']))
 {
@@ -55,7 +66,7 @@ elseif($page == 'tickets')
 		$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$paging->sortfield = 'lastchange';
 		$paging->sortorder = 'desc';
-		$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" AND `adminid`="' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -210,12 +221,12 @@ elseif($page == 'tickets')
 			else
 			{
 				$categories = '';
-				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
+				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
 
 				if(isset($result['name'])
 				   && $result['name'] != '')
 				{
-					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `logicalorder`, `name` ASC');
+					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');
 
 					while($row = $db->fetch_array($result2))
 					{
@@ -329,7 +340,13 @@ elseif($page == 'tickets')
 			}
 			else
 			{
-				$by = $lng['ticket']['customer'];
+				$cid = $mainticket->Get('customer');
+				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+				);
+				$by = getCorrectFullUserDetails($usr);
+				//$by = $lng['ticket']['customer'];
 			}
 
 			$subject = $mainticket->Get('subject');
@@ -351,7 +368,8 @@ elseif($page == 'tickets')
 				}
 				else
 				{
-					$by = $lng['ticket']['customer'];
+					$by = getCorrectFullUserDetails($usr);
+					//$by = $lng['ticket']['customer'];
 				}
 
 				$subject = $subticket->Get('subject');

customer_traffic.php

@@ -22,21 +22,20 @@ define('AREA', 'customer');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
-
-require ("./lib/init.php");
+$intrafficpage = 1;
+require('./lib/init.php');
 $traffic = '';
 $month = null;
 $year = null;
 
-if(isset($_POST['month'])
-   && isset($_POST['year']))
-{
+if (isset($_POST['month'])
+	&& isset($_POST['year'])
+) {
 	$month = intval($_POST['month']);
 	$year = intval($_POST['year']);
-}
-elseif(isset($_GET['month'])
-       && isset($_GET['year']))
-{
+} elseif (isset($_GET['month'])
+	&& isset($_GET['year'])
+) {
 	$month = intval($_GET['month']);
 	$year = intval($_GET['year']);
 }
@@ -44,40 +43,25 @@ elseif(isset($_GET['month'])
 //BAM! $_GET???
 
 elseif (isset($_GET['page'])
-       && $_GET['page'] == "current")
-{
-	if(date('d') != '01')
-	{
+	&& $_GET['page'] == 'current'
+) {
+	if (date('d') != '01') {
 		$month = date('m');
 		$year = date('Y');
-	}
-	else
-	{
-		if(date('m') == '01')
-		{
+	} else {
+		if (date('m') == '01') {
 			$month = 12;
 			$year = date('Y') - 1;
-		}
-		else
-		{
+		} else {
 			$month = date('m') - 1;
 			$year = date('Y');
 		}
 	}
 }
 
-if(!is_null($month)
-   && !is_null($year))
-{
+if (!is_null($month)
+	&& !is_null($year)) {
 	$traf['byte'] = 0;
-	$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
-	                     FROM `" . TABLE_PANEL_TRAFFIC . "`
-	                     WHERE `customerid`='" . $userinfo['customerid'] . "'
-	                     AND `month` = '" . $month . "'
-	                     AND `year` = '" . $year . "'");
-	$row = mysql_fetch_row($result);
-	rsort($row);
-	$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));;
 	$result = $db->query("SELECT
                                 SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail',
                                 `day`, `month`, `year`
@@ -90,106 +74,50 @@ if(!is_null($month)
 	$traffic_complete['mail'] = 0;
 	$show = '';
 
-	while($row = $db->fetch_array($result))
-	{
+	while ($row = $db->fetch_array($result)) {
 		$http = $row['http'];
 		$ftp = $row['ftp_up'] + $row['ftp_down'];
 		$mail = $row['mail'];
 		$traf['byte'] = $http + $ftp + $mail;
-		$traffic_complete['http']+= $http;
-		$traffic_complete['ftp']+= $ftp;
-		$traffic_complete['mail']+= $mail;
-		$traf['day'] = $row['day'];
+		$traffic_complete['http'] += $http;
+		$traffic_complete['ftp'] += $ftp;
+		$traffic_complete['mail'] += $mail;
+		$traf['day'] = $row['day'] . '.';
 
-		if(extension_loaded('bcmath'))
-		{
+		if (extension_loaded('bcmath')) {
 			$traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
 			$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
 			$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
-		}
-		else
-		{
+			$traf['ftp'] = bcdiv($ftp, 1024, $settings['panel']['decimal_places']);
+			$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']);
+			$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']);
+			$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
+		} else {
 			$traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
 			$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
 			$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
-		}
-
-		if($traf['byte'] != 0
-		   && $traf['max'] != 0)
-		{
-			$proz = $traf['max'] / 100;
-			$traf['http'] = round($http / $proz, 0);
-			$traf['ftp'] = round($ftp / $proz, 0);
-			$traf['mail'] = round($mail / $proz, 0);
-
-			if($traf['http'] == 0)
-			{
-				$traf['http'] = 1;
-			}
-
-			if($traf['ftp'] == 0)
-			{
-				$traf['ftp'] = 1;
-			}
-
-			if($traf['mail'] == 0)
-			{
-				$traf['mail'] = 1;
-			}
-		}
-		else
-		{
-			$traf['http'] = 0;
-			$traf['ftp'] = 0;
-			$traf['mail'] = 0;
-		}
-
-		if(extension_loaded('bcmath'))
-		{
-			$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
-		}
-		else
-		{
+			$traf['http'] = round($http, $settings['panel']['decimal_places']);
+			$traf['ftp'] = round($ftp, $settings['panel']['decimal_places']);
+			$traf['mail'] = round($mail, $settings['panel']['decimal_places']);
 			$traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']);
 		}
 
-		eval("\$traffic.=\"" . getTemplate("traffic/traffic_month") . "\";");
-		$show = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
+		eval("\$traffic.=\"" . getTemplate('traffic/traffic_month') . "\";");
+		$show = $lng['traffic']['months'][intval($row['month'])] . ' ' . $row['year'];
 	}
 
-	if(extension_loaded('bcmath'))
-	{
+	if (extension_loaded('bcmath')) {
 		$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']);
-	}
-	else
-	{
+	} else {
 		$traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']);
 	}
 
-	eval("echo \"" . getTemplate("traffic/traffic_details") . "\";");
-}
-else
-{
-	$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
-	                     FROM `" . TABLE_PANEL_TRAFFIC . "`
-	                     WHERE `customerid`='" . $userinfo['customerid'] . "'
-	                     GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
-	
-	$nums = mysql_num_rows($result);
-	if($nums > 0)
-	{
-		$row = mysql_fetch_row($result);
-		rsort($row);
-		$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));
-	} else {
-		// no records yet
-		$traf['max'] = 0;
-	}
-	
+	eval("echo \"" . getTemplate('traffic/traffic_details') . "\";");
+} else {
 	$result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail
 	                     FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "'
 	                     GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
@@ -197,88 +125,49 @@ else
 	$traffic_complete['ftp'] = 0;
 	$traffic_complete['mail'] = 0;
 
-	while($row = $db->fetch_array($result))
-	{
+	while ($row = $db->fetch_array($result)) {
 		$http = $row['http'];
 		$ftp_up = $row['ftp_up'];
 		$ftp_down = $row['ftp_down'];
 		$mail = $row['mail'];
-		$traffic_complete['http']+= $http;
-		$traffic_complete['ftp']+= $ftp_up + $ftp_down;
-		$traffic_complete['mail']+= $mail;
+		$traffic_complete['http'] += $http;
+		$traffic_complete['ftp'] += $ftp_up + $ftp_down;
+		$traffic_complete['mail'] += $mail;
 		$traf['month'] = $row['month'];
 		$traf['year'] = $row['year'];
 		$traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
 		$traf['byte'] = $http + $ftp_up + $ftp_down + $mail;
 
-		if(extension_loaded('bcmath'))
-		{
-			$traf['ftptext'] = bcdiv($ftp_up, 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . bcdiv($ftp_down, 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
-			$traf['httptext'] = bcdiv($http, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
-			$traf['mailtext'] = bcdiv($mail, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
-		}
-		else
-		{
-			$traf['ftptext'] = round($ftp_up / 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . round($ftp_down / 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
-			$traf['httptext'] = round($http / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
-			$traf['mailtext'] = round($mail / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
+		if (extension_loaded('bcmath')) {
+			$traf['ftptext'] = bcdiv($ftp_up, 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($ftp_down, 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
+			$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
+			$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
+			$traf['ftp'] = bcdiv(($ftp_up + $ftp_down), 1024, $settings['panel']['decimal_places']);
+			$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']);
+			$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']);
+			$traf['byte'] = bcdiv($traf['byte'], 1024 * 1024, $settings['panel']['decimal_places']);
+		} else {
+			$traf['ftptext'] = round($ftp_up / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($ftp_down / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
+			$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
+			$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
+			$traf['ftp'] = round(($ftp_up + $ftp_down) / 1024, $settings['panel']['decimal_places']);
+			$traf['http'] = round($http / 1024, $settings['panel']['decimal_places']);
+			$traf['mail'] = round($mail / 1024, $settings['panel']['decimal_places']);
+			$traf['byte'] = round($traf['byte'] / (1024 * 1024), $settings['panel']['decimal_places']);
 		}
 
-		if($traf['max'] != 0)
-		{
-			$proz = $traf['max'] / 100;
-			$traf['ftp'] = round(($ftp_up + $ftp_down) / $proz, 0);
-			$traf['http'] = round($http / $proz, 0);
-			$traf['mail'] = round($mail / $proz, 0);
-
-			if($traf['http'] == 0)
-			{
-				$traf['http'] = 1;
-			}
-
-			if($traf['ftp'] == 0)
-			{
-				$traf['ftp'] = 1;
-			}
-
-			if($traf['mail'] == 0)
-			{
-				$traf['mail'] = 1;
-			}
-		}
-		else
-		{
-			$traf['ftp'] = 0;
-			$traf['http'] = 0;
-			$traf['mail'] = 0;
-		}
-
-		if(extension_loaded('bcmath'))
-		{
-			$traf['byte'] = bcadd($traf['byte'] / (1024 * 1024), 0.0000, 4);
-		}
-		else
-		{
-			$traf['byte'] = round($traf['byte'] + (1024 * 1024), 4);
-		}
-
-		eval("\$traffic.=\"" . getTemplate("traffic/traffic_traffic") . "\";");
+		eval("\$traffic.=\"" . getTemplate('traffic/traffic_traffic') . "\";");
 	}
 
-	if(extension_loaded('bcmath'))
-	{
+	if (extension_loaded('bcmath')) {
 		$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']);
-	}
-	else
-	{
-		$traffic_complete['http'] = round($traffic_complete['http'] / 1024 * 1024, $settings['panel']['decimal_places']);
-		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024 * 1024, $settings['panel']['decimal_places']);
-		$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024 * 1024, $settings['panel']['decimal_places']);
+	} else {
+		$traffic_complete['http'] = round($traffic_complete['http'] / (1024 * 1024), $settings['panel']['decimal_places']);
+		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / (1024 * 1024), $settings['panel']['decimal_places']);
+		$traffic_complete['mail'] = round($traffic_complete['mail'] / (1024 * 1024), $settings['panel']['decimal_places']);
 	}
 
-	eval("echo \"" . getTemplate("traffic/traffic") . "\";");
+	eval("echo \"" . getTemplate('traffic/traffic') . "\";");
 }
-
-?>

index.php

@@ -22,106 +22,74 @@ define('AREA', 'login');
 /**
  * Include our init.php, which manages Sessions, Language etc.
  */
+require ('./lib/init.php');
 
-require ("./lib/init.php");
-
-if($action == '')
-{
+if ($action == '') {
 	$action = 'login';
 }
 
-if($action == 'login')
-{
-	if(isset($_POST['send'])
-	&& $_POST['send'] == 'send')
-	{
+if ($action == 'login') {
+	if (isset($_POST['send'])
+		&& $_POST['send'] == 'send'
+	) {
 		$loginname = validate($_POST['loginname'], 'loginname');
 		$password = validate($_POST['password'], 'password');
 
 		$row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
 
-		if($row['customer'] == $loginname)
-		{
+		if ($row['customer'] == $loginname) {
 			$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
 			$uid = 'customerid';
 			$adminsession = '0';
 			$is_admin = false;
-		}
-		else
-		{
-			if((int)$settings['login']['domain_login'] == 1)
-			{
+		} else {
+			$is_admin = true;
+			if ((int)$settings['login']['domain_login'] == 1) {
 				/**
 				 * check if the customer tries to login with a domain, #374
 				 */
 				$domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname));
 				$row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'");
 	
-				if(isset($row2['customerid']) && $row2['customerid'] > 0)
-				{
+				if (isset($row2['customerid']) && $row2['customerid'] > 0) {
 					$loginname = getCustomerDetail($row2['customerid'], 'loginname');
-					
-					if($loginname !== false)
-					{
+					if ($loginname !== false) {
 						$row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
-		
-						if($row3['customer'] == $loginname)
-						{
+						if ($row3['customer'] == $loginname) {
 							$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
 							$uid = 'customerid';
 							$adminsession = '0';
 							$is_admin = false;
 						}
 					}
-					else
-					{
-						$is_admin = true;
-					}
 				}
-				else
-				{
-					$is_admin = true;
-				}
-			}
-			else
-			{
-				$is_admin = true;
 			}
 		}
 
-		if(hasUpdates($version) && $is_admin == false)
-		{
+		if (hasUpdates($version) && $is_admin == false) {
 			redirectTo('index.php');
 			exit;
 		}
 
-		if($is_admin)
-		{
-			if(hasUpdates($version))
-			{
+		if ($is_admin) {
+			if (hasUpdates($version)) {
 				$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'");
 				/*
 				 * not an admin who can see updates
 				 */
-				if(!isset($row['admin']))
-				{
+				if (!isset($row['admin'])) {
 					redirectTo('index.php');
 					exit;
 				}
-			}
-			else
-			{
+			} else {
 				$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
 			}
 
-			if($row['admin'] == $loginname)
-			{
+			if ($row['admin'] == $loginname) {
 				$table = "`" . TABLE_PANEL_ADMINS . "`";
 				$uid = 'adminid';
 				$adminsession = '1';
-			}
-			else
-			{
+			} else {
 				redirectTo('index.php', Array('showmessage' => '2'), true);
 				exit;
 			}
@@ -129,64 +97,48 @@ if($action == 'login')
 
 		$userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'");
 
-		if($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
-		&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']))
-		{
+		if ($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
+			&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime'])
+		) {
 			redirectTo('index.php', Array('showmessage' => '3'), true);
 			exit;
-		}
-		elseif($userinfo['password'] == md5($password))
-		{
+		} elseif($userinfo['password'] == md5($password)) {
 			// login correct
 			// reset loginfail_counter, set lastlogin_succ
-
 			$db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
 			$userinfo['userid'] = $userinfo[$uid];
 			$userinfo['adminsession'] = $adminsession;
-		}
-		else
-		{
+		} else {
 			// login incorrect
-
 			$db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
 			unset($userinfo);
 			redirectTo('index.php', Array('showmessage' => '2'), true);
 			exit;
 		}
 
-		if(isset($userinfo['userid'])
-		&& $userinfo['userid'] != '')
-		{
+		if (isset($userinfo['userid'])
+			&& $userinfo['userid'] != ''
+		) {
 			$s = md5(uniqid(microtime(), 1));
 
-			if(isset($_POST['language']))
-			{
+			if (isset($_POST['language'])) {
 				$language = validate($_POST['language'], 'language');
-
-				if($language == 'profile')
-				{
+				if ($language == 'profile') {
 					$language = $userinfo['def_language'];
-				}
-				elseif(!isset($languages[$language]))
-				{
+				} elseif(!isset($languages[$language])) {
 					$language = $settings['panel']['standardlanguage'];
 				}
-			}
-			else
-			{
+			} else {
 				$language = $settings['panel']['standardlanguage'];
 			}
 
-			if(isset($userinfo['theme']) && $userinfo['theme'] != '') {
+			if (isset($userinfo['theme']) && $userinfo['theme'] != '') {
 				$theme = $userinfo['theme'];
-			}
-			else
-			{
+			} else {
 				$theme = $settings['panel']['default_theme'];
 			}
 
-			if($settings['session']['allow_multiple_login'] != '1')
-			{
+			if ($settings['session']['allow_multiple_login'] != '1') {
 				$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'");
 			}
 
@@ -195,56 +147,41 @@ if($action == 'login')
 			$columns = mysql_num_fields($fields);
 			$field_array = array();
 			for ($i = 0; $i < $columns; $i++) {
-    			$field_array[] = mysql_field_name($fields, $i);
+				$field_array[] = mysql_field_name($fields, $i);
 			}
 
-    		if (!in_array('theme', $field_array)) {
+			if (!in_array('theme', $field_array)) {
 				$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
-    		} else {
-    			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "', '" . $db->escape($theme) . "')");
-    		}
+    			} else {
+    				$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "', '" . $db->escape($theme) . "')");
+    			}
 
-			if($userinfo['adminsession'] == '1')
-			{
-				if(hasUpdates($version))
-				{
+			if ($userinfo['adminsession'] == '1') {
+				if (hasUpdates($version)) {
 					redirectTo('admin_updates.php', Array('s' => $s), true);
-					exit;
-				}
-				else
-				{
+				} else {
 					redirectTo('admin_index.php', Array('s' => $s), true);
-					exit;
 				}
-			}
-			else
-			{
+			} else {
 				redirectTo('customer_index.php', Array('s' => $s), true);
-				exit;
 			}
-		}
-		else
-		{
+		} else {
 			redirectTo('index.php', Array('showmessage' => '2'), true);
-			exit;
 		}
-	}
-	else
-	{
+		exit;
+	} else {
 		$language_options = '';
-		$language_options.= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
+		$language_options .= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
 
-		while(list($language_file, $language_name) = each($languages))
-		{
-			$language_options.= makeoption($language_name, $language_file, 'profile', true);
+		while (list($language_file, $language_name) = each($languages)) {
+			$language_options .= makeoption($language_name, $language_file, 'profile', true);
 		}
 
 		$smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0;
 		$message = '';
 		$successmessage = '';
 
-		switch($smessage)
-		{
+		switch ($smessage) {
 			case 1:
 				$successmessage = $lng['pwdreminder']['success'];
 				break;
@@ -252,7 +189,7 @@ if($action == 'login')
 				$message = $lng['error']['login'];
 				break;
 			case 3:
-				$message = $lng['error']['login_blocked'];
+				$message = sprintf($lng['error']['login_blocked'],$settings['login']['deactivatetime']);
 				break;
 			case 4:
 				$cmail = isset($_GET['customermail']) ? $_GET['customermail'] : 'unknown';
@@ -264,23 +201,21 @@ if($action == 'login')
 		}
 
 		$update_in_progress = '';
-		if(hasUpdates($version))
-		{
+		if (hasUpdates($version)) {
 			$update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin'];
 		}
 
-		eval("echo \"" . getTemplate("login") . "\";");
+		eval("echo \"" . getTemplate('login') . "\";");
 	}
 }
 
-if($action == 'forgotpwd')
-{
+if ($action == 'forgotpwd') {
 	$adminchecked = false;
 	$message = '';
 
-	if(isset($_POST['send'])
-	&& $_POST['send'] == 'send')
-	{
+	if (isset($_POST['send'])
+		&& $_POST['send'] == 'send'
+	) {
 		$loginname = validate($_POST['loginname'], 'loginname');
 		$email = validateEmail($_POST['loginemail'], 'email');
 		$sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_CUSTOMERS . "`
@@ -288,64 +223,48 @@ if($action == 'forgotpwd')
 				AND `email`='" . $db->escape($email) . "'";
 		$result = $db->query($sql);
 
-		if($db->num_rows() == 0)
-		{
+		if ($db->num_rows() == 0) {
 			$sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "`
 				WHERE `loginname`='" . $db->escape($loginname) . "'
 				AND `email`='" . $db->escape($email) . "'";
 			$result = $db->query($sql);
 				
-			if($db->num_rows() > 0)
-			{
+			if ($db->num_rows() > 0) {
 				$adminchecked = true;
-			}
-			else
-			{
+			} else {
 				$result = null;
 			}
 		}
 
-		if($result !== null)
-		{
+		if ($result !== null) {
 			$user = $db->fetch_array($result);
 			
 			/* Check whether user is banned */
-			if($user['deactivated'])
-			{
+			if ($user['deactivated']) {
 				$message = $lng['pwdreminder']['notallowed'];
 				redirectTo('index.php', Array('showmessage' => '5'), true);
 			}
 
-			if(($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
-			|| $adminchecked == false)
-			{
-				if($user !== false)
-				{
+			if (($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
+				|| $adminchecked == false
+			) {
+				if ($user !== false) {
 					if ($settings['panel']['password_min_length'] <= 6) {
 						$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
 					} else {
 						// make it two times larger than password_min_length
 						$rnd = '';
 						$minlength = $settings['panel']['password_min_length'];
-						while (strlen($rnd) < ($minlength * 2))
-						{
+						while (strlen($rnd) < ($minlength * 2)) {
 							$rnd .= md5(uniqid(microtime(), 1));
 						}
 						$password = substr($rnd, (int)($minlength / 2), $minlength);
 					}
 
-					if($adminchecked)
-					{
-						$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `password`='" . md5($password) . "'
-								WHERE `loginname`='" . $user['loginname'] . "'
-								AND `email`='" . $user['email'] . "'");
-					}
-					else
-					{
-						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($password) . "'
-								WHERE `loginname`='" . $user['loginname'] . "'
-								AND `email`='" . $user['email'] . "'");
-					}
+					$passwordTable = $adminchecked ? TABLE_PANEL_ADMINS : TABLE_PANEL_CUSTOMERS;
+					$db->query("UPDATE `" . $passwordTable . "` SET `password`='" . md5($password) . "'
+							WHERE `loginname`='" . $user['loginname'] . "'
+							AND `email`='" . $user['email'] . "'");
 
 					$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
 					$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
@@ -389,9 +308,7 @@ if($action == 'forgotpwd')
 					$mail->ClearAddresses();
 					redirectTo('index.php', Array('showmessage' => '1'), true);
 					exit;
-				}
-				else
-				{
+				} else {
 					$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
 					$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
 					$message = $lng['login']['combination_not_found'];
@@ -399,28 +316,21 @@ if($action == 'forgotpwd')
 
 				unset($user);
 			}
-		}
-		else
-		{
+		} else {
 			$message = $lng['login']['usernotfound'];
 		}
 	}
 
-	if($adminchecked)
-	{
-		if($settings['panel']['allow_preset_admin'] != '1')
-		{
+	if ($adminchecked) {
+		if ($settings['panel']['allow_preset_admin'] != '1') {
 			$message = $lng['pwdreminder']['notallowed'];
 			unset ($adminchecked);
 		}
-	}
-	else
-	{
-		if($settings['panel']['allow_preset'] != '1')
-		{
+	} else {
+		if ($settings['panel']['allow_preset'] != '1') {
 			$message = $lng['pwdreminder']['notallowed'];
 		}
 	}
 
-	eval("echo \"" . getTemplate("fpwd") . "\";");
+	eval("echo \"" . getTemplate('fpwd') . "\";");
 }

install/install.php

@@ -100,23 +100,27 @@ function page_header() {
 <!DOCTYPE html>
 <html lang="en">
 <head>
-	<meta charset="iso-8859-1" />
+	<meta charset="utf-8" />
 	<meta http-equiv="Default-Style" content="text/css" />
-	<link rel="stylesheet" href="../templates/Froxlor/froxlor.css"  />
-	<!--[if IE]><link rel="stylesheet" href="../templates/Froxlor/froxlor_ie.css"  /><![endif]-->
+	<link rel="stylesheet" href="../templates/Froxlor/assets/css/main.css"  />
+	<!--[if IE]><link rel="stylesheet" href="../templates/Froxlor/assets/css/main_ie.css"  /><![endif]-->
 	<!--[if lt IE 9]><script src="http://html5shiv.googlecode.com/svn/trunk/html5.js"></script><![endif]-->
-	<script type="text/javascript" src="../templates/Froxlor/js/jquery.min.js"></script>
-	<script type="text/javascript" src="../templates/Froxlor/js/froxlor.js"></script>
+	<script type="text/javascript" src="../js/jquery.min.js"></script>
+	<script type="text/javascript" src="../templates/Froxlor/assets/js/main.js"></script>
+	<link href="../templates/Froxlor/assets/img/favicon.ico" rel="icon" type="image/x-icon" />
 	<title>Froxlor Server Management Panel - Installation</title>
 	<style>
+	body {
+        font-family: Verdana, Geneva, sans-serif;
+	}
 	input {
-		background: #dae7ee url('../images/Froxlor/icons/text_align_left.png') no-repeat 5px 4px;
+		background: #dae7ee url('../templates/Froxlor/assets/img/icons/text_align_left.png') no-repeat 5px 4px;
 	}
 	input[type="password"] {
-		background: #dae7ee url('../images/Froxlor/icons/password.png') no-repeat 4px 4px;
+		background: #dae7ee url('../templates/Froxlor/assets/img/icons/password.png') no-repeat 4px 4px;
 	}
 	input[type="submit"] {
-		background: #ccc url('../images/Froxlor/icons/button_ok.png') no-repeat 4px 8px;
+		background: #ccc url('../templates/Froxlor/assets/img/icons/button_ok.png') no-repeat 4px 8px;
 	}
 	</style>
 </head>
@@ -154,13 +158,13 @@ function status_message($case, $text)
 
 function requirement_checks() {
 
-	global $lng;
+	global $lng, $theme;
 	page_header();
 
 ?>
 	<article class="install bradius">
 		<header class="dark">
-			<img src="../images/Froxlor/logo.png" alt="Froxlor Server Management Panel" />
+			<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" />
 		</header>
 
 		<section class="installsec">
@@ -198,7 +202,7 @@ function requirement_checks() {
 	// check for mysql-extension
 	status_message('begin', $lng['install']['phpmysql']);
 
-	if(!extension_loaded('mysql'))
+	if(!extension_loaded('mysql') && !extension_loaded('mysqlnd'))
 	{
 		status_message('red', $lng['install']['notinstalled']);
 		$_die = true;
@@ -520,7 +524,7 @@ if(isset($_POST['installstep'])
 ?>
 	<article class="install bradius">
 		<header class="dark">
-			<img src="../images/Froxlor/logo.png" alt="Froxlor Server Management Panel" />
+			<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" />
 		</header>
 
 		<section class="installsec">
@@ -673,8 +677,6 @@ if(isset($_POST['installstep'])
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($languages[$language]) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'standardlanguage'");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($mysql_access_host) . "' WHERE `settinggroup` = 'system' AND `varname` = 'mysql_access_host'");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
-
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpuser) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpuser'");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpgroup) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'");
 
@@ -692,23 +694,20 @@ if(isset($_POST['installstep'])
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/lighttpd reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/lighttpd.pem' WHERE `settinggroup` = 'system' AND `varname` = 'ssl_cert_file'");
-		$ssettings = '';
 	}
-        elseif($webserver == "nginx")
+	elseif($webserver == "nginx")
 	{
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/nginx/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/nginx reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
-		$ssettings = '';
 	}
 
 	// insert the lastcronrun to be the installation date
-
 	$query = 'UPDATE `%s` SET `value` = UNIX_TIMESTAMP() WHERE `settinggroup` = \'system\'  AND `varname` = \'lastcronrun\'';
 	$query = sprintf($query, TABLE_PANEL_SETTINGS);
 	$db->query($query);
-	
+
 	// set specific times for some crons (traffic only at night, etc.)
 	$ts = mktime(0, 0, 0, date('m', time()), date('d', time()), date('Y', time()));
 	$db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_traffic.php';");
@@ -717,7 +716,6 @@ if(isset($_POST['installstep'])
 	$db->query("UPDATE `".TABLE_PANEL_CRONRUNS."` SET `lastrun` = '".$ts."' WHERE `cronfile` ='cron_ticketarchive.php';");
 
 	// and lets insert the default ip and port
-
 	$query = "INSERT INTO `".TABLE_PANEL_IPSANDPORTS."` 
 			 SET `ip`= '".$db->escape($serverip)."', 
 			 `port` = '80',
@@ -728,14 +726,12 @@ if(isset($_POST['installstep'])
 	$defaultip = $db->insert_id();
 
 	// insert the defaultip
-
 	$query = 'UPDATE `%s` SET `value` = \'%s\' WHERE `settinggroup` = \'system\'  AND `varname` = \'defaultip\'';
 	$query = sprintf($query, TABLE_PANEL_SETTINGS, $db->escape($defaultip));
 	$db->query($query);
 	status_message('green', 'OK');
 
 	//last but not least create the main admin
-
 	status_message('begin', $lng['install']['adding_admin_user']);
 	$db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET
 		`loginname` = '" . $db->escape($admin_user) . "',
@@ -767,6 +763,7 @@ if(isset($_POST['installstep'])
 		`ftps_used` = 0,
 		`tickets` = -1,
 		`tickets_used` = 0,
+		`tickets_see_all` = 1,
 		`subdomains` = -1,
 		`subdomains_used` = 0,
 		`traffic` = -1048576,
@@ -779,7 +776,6 @@ if(isset($_POST['installstep'])
 	status_message('green', 'OK');
 
 	//now we create the userdata.inc.php with the mysql-accounts
-
 	status_message('begin', $lng['install']['creating_configfile']);
 	$userdata = "<?php\n";
 	$userdata.= "//automatically generated userdata.inc.php for Froxlor\n";
@@ -794,7 +790,6 @@ if(isset($_POST['installstep'])
 	$userdata.= "?>";
 
 	//we test now if we can store the userdata.inc.php in ../lib
-
 	if($fp = @fopen('../lib/userdata.inc.php', 'w'))
 	{
 		$result = @fputs($fp, $userdata, strlen($userdata));
@@ -841,7 +836,7 @@ else
 ?>
 	<article class="install bradius">
 		<header class="dark">
-			<img src="../images/Froxlor/logo.png" alt="Froxlor Server Management Panel" />
+			<img src="../templates/Froxlor/assets/img/logo.png" alt="Froxlor Server Management Panel" />
 		</header>
 		<section class="installsec">
 			<h2><?php echo $lng['install']['language']; ?></h2>

install/lng/english.lng.php

@@ -73,6 +73,12 @@ $lng['install']['bcmathdescription'] = 'Traffic-calculation related functions wi
 $lng['install']['openbasedir'] = 'Testing if open_basedir is enabled...';
 $lng['install']['openbasedirenabled'] = 'enabled. Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor';
 
+/**
+ * ADDED IN 1.2.19-svn7
+ */
+
+$lng['install']['servername_should_be_fqdn'] = 'The servername should be a FQDN and not an IP address';
+
 /**
  * Renamed in 1.2.19-svn40
  */

install/lng/french.lng.php

@@ -63,6 +63,12 @@ $lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'in
 $lng['install']['httpuser'] = 'Nom du utilisateur du HTTP';
 $lng['install']['httpgroup'] = 'Nom du la group du HTTP';
 
+/**
+ * ADDED IN 1.2.19-svn7
+ */
+
+$lng['install']['servername_should_be_fqdn'] = 'Le nom du serveur doit être un nom FQDN, pas une adresse IP';
+
 /**
  * Renamed in 1.2.19-svn40
  */

install/lng/german.lng.php

@@ -73,6 +73,12 @@ $lng['install']['openbasedirenabled'] = 'aktiviert. Froxlor wird mit aktiviertem
 $lng['install']['httpuser'] = 'HTTP Username';
 $lng['install']['httpgroup'] = 'HTTP Gruppenname';
 
+/**
+ * ADDED IN 1.2.19-svn7
+ */
+
+$lng['install']['servername_should_be_fqdn'] = 'Der Servername sollte eine FQDN sein und keine IP Adresse sein';
+
 /**
  * Renamed in 1.2.19-svn40
  */

install/updates/froxlor/0.9/update_0.9.inc.php

@@ -21,7 +21,7 @@ if(isFroxlorVersion('0.9-r0'))
 	showUpdateStep("Performing database updates");
 	/*
 	 * add missing database-updates if necessary (old: update/update_database.php)
-	 */
+	*/
 	if(isset($settings['system']['dbversion']) && (int)$settings['system']['dbversion'] < 1)
 	{
 		$db->query("ALTER TABLE `panel_databases` ADD `dbserver` INT( 11 ) UNSIGNED NOT NULL default '0';");
@@ -29,9 +29,9 @@ if(isFroxlorVersion('0.9-r0'))
 	if(isset($settings['system']['dbversion']) && (int)$settings['system']['dbversion'] < 2)
 	{
 		$db->query("ALTER TABLE `panel_ipsandports` CHANGE `ssl_cert` `ssl_cert_file` VARCHAR( 255 ) NOT NULL,
-						ADD `ssl_key_file` VARCHAR( 255 ) NOT NULL,
-						ADD `ssl_ca_file` VARCHAR( 255 ) NOT NULL,
-						ADD `default_vhostconf_domain` TEXT NOT NULL;");
+				ADD `ssl_key_file` VARCHAR( 255 ) NOT NULL,
+				ADD `ssl_ca_file` VARCHAR( 255 ) NOT NULL,
+				ADD `default_vhostconf_domain` TEXT NOT NULL;");
 
 		$db->query("INSERT INTO `panel_settings` SET `settinggroup` = 'system', `varname` = 'ssl_key_file', `value` = '';");
 		$db->query("INSERT INTO `panel_settings` SET `settinggroup` = 'system', `varname` = 'ssl_ca_file', `value` = '';");
@@ -40,7 +40,7 @@ if(isFroxlorVersion('0.9-r0'))
 
 	/*
 	 * remove billing tables in database
-	 */
+	*/
 	define('TABLE_BILLING_INVOICES', 'billing_invoices');
 	define('TABLE_BILLING_INVOICES_ADMINS', 'billing_invoices_admins');
 	define('TABLE_BILLING_INVOICE_CHANGES', 'billing_invoice_changes');
@@ -53,130 +53,130 @@ if(isFroxlorVersion('0.9-r0'))
 	define('TABLE_BILLING_TAXCLASSES', 'billing_taxclasses');
 	define('TABLE_BILLING_TAXRATES', 'billing_taxrates');
 
-	$db->query("DROP TABLE  `" . TABLE_BILLING_SERVICE_CATEGORIES . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_SERVICE_CATEGORIES_ADMINS . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_SERVICE_DOMAINS_TEMPLATES . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_SERVICE_OTHER . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_SERVICE_OTHER_TEMPLATES . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_TAXCLASSES . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_TAXRATES . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_INVOICES . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_INVOICES_ADMINS . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_INVOICE_CHANGES . "`;");
-	$db->query("DROP TABLE  `" . TABLE_BILLING_INVOICE_CHANGES_ADMINS . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_SERVICE_CATEGORIES . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_SERVICE_CATEGORIES_ADMINS . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_SERVICE_DOMAINS_TEMPLATES . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_SERVICE_OTHER . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_SERVICE_OTHER_TEMPLATES . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_TAXCLASSES . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_TAXRATES . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_INVOICES . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_INVOICES_ADMINS . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_INVOICE_CHANGES . "`;");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_BILLING_INVOICE_CHANGES_ADMINS . "`;");
 
 	/*
 	 * update panel_domains, panel_customers, panel_admins
-	 */
+	*/
 	$db->query("ALTER TABLE `" . TABLE_PANEL_ADMINS . "`
-		  DROP `firstname`,
-		  DROP `title`,
-		  DROP `company`,
-		  DROP `street`,
-		  DROP `zipcode`,
-		  DROP `city`,
-		  DROP `country`,
-		  DROP `phone`,
-		  DROP `fax`,
-		  DROP `taxid`,
-		  DROP `contract_date`,
-		  DROP `contract_number`,
-		  DROP `contract_details`,
-		  DROP `included_domains_qty`,
-		  DROP `included_domains_tld`,
-		  DROP `additional_traffic_fee`,
-		  DROP `additional_traffic_unit`,
-		  DROP `additional_diskspace_fee`,
-		  DROP `additional_diskspace_unit`,
-		  DROP `taxclass`,
-		  DROP `setup_fee`,
-		  DROP `interval_fee`,
-		  DROP `interval_length`,
-		  DROP `interval_type`,
-		  DROP `interval_payment`,
-		  DROP `calc_tax`,
-		  DROP `term_of_payment`,
-		  DROP `payment_every`,
-		  DROP `payment_method`,
-		  DROP `bankaccount_holder`,
-		  DROP `bankaccount_number`,
-		  DROP `bankaccount_blz`,
-		  DROP `bankaccount_bank`,
-		  DROP `service_active`,
-		  DROP `servicestart_date`,
-		  DROP `serviceend_date`,
-		  DROP `lastinvoiced_date`,
-		  DROP `lastinvoiced_date_traffic`,
-		  DROP `lastinvoiced_date_diskspace`,
-		  DROP `customer_categories_once`,
-		  DROP `customer_categories_period`,
-		  DROP `invoice_fee`,
-		  DROP `invoice_fee_hosting`,
-		  DROP `invoice_fee_hosting_customers`,
-		  DROP `invoice_fee_domains`,
-		  DROP `invoice_fee_traffic`,
-		  DROP `invoice_fee_diskspace`,
-		  DROP `invoice_fee_other`,
-		  DROP `edit_billingdata`;");
+			DROP `firstname`,
+			DROP `title`,
+			DROP `company`,
+			DROP `street`,
+			DROP `zipcode`,
+			DROP `city`,
+			DROP `country`,
+			DROP `phone`,
+			DROP `fax`,
+			DROP `taxid`,
+			DROP `contract_date`,
+			DROP `contract_number`,
+			DROP `contract_details`,
+			DROP `included_domains_qty`,
+			DROP `included_domains_tld`,
+			DROP `additional_traffic_fee`,
+			DROP `additional_traffic_unit`,
+			DROP `additional_diskspace_fee`,
+			DROP `additional_diskspace_unit`,
+			DROP `taxclass`,
+			DROP `setup_fee`,
+			DROP `interval_fee`,
+			DROP `interval_length`,
+			DROP `interval_type`,
+			DROP `interval_payment`,
+			DROP `calc_tax`,
+			DROP `term_of_payment`,
+			DROP `payment_every`,
+			DROP `payment_method`,
+			DROP `bankaccount_holder`,
+			DROP `bankaccount_number`,
+			DROP `bankaccount_blz`,
+			DROP `bankaccount_bank`,
+			DROP `service_active`,
+			DROP `servicestart_date`,
+			DROP `serviceend_date`,
+			DROP `lastinvoiced_date`,
+			DROP `lastinvoiced_date_traffic`,
+			DROP `lastinvoiced_date_diskspace`,
+			DROP `customer_categories_once`,
+			DROP `customer_categories_period`,
+			DROP `invoice_fee`,
+			DROP `invoice_fee_hosting`,
+			DROP `invoice_fee_hosting_customers`,
+			DROP `invoice_fee_domains`,
+			DROP `invoice_fee_traffic`,
+			DROP `invoice_fee_diskspace`,
+			DROP `invoice_fee_other`,
+			DROP `edit_billingdata`;");
 
 	$db->query("ALTER TABLE `" . TABLE_PANEL_CUSTOMERS . "`
-		  DROP `taxid`,
-		  DROP `title`,
-		  DROP `country`,
-		  DROP `additional_service_description`,
-		  DROP `contract_date`,
-		  DROP `contract_number`,
-		  DROP `contract_details`,
-		  DROP `included_domains_qty`,
-		  DROP `included_domains_tld`,
-		  DROP `additional_traffic_fee`,
-		  DROP `additional_traffic_unit`,
-		  DROP `additional_diskspace_fee`,
-		  DROP `additional_diskspace_unit`,
-		  DROP `taxclass`,
-		  DROP `setup_fee`,
-		  DROP `interval_fee`,
-		  DROP `interval_length`,
-		  DROP `interval_type`,
-		  DROP `interval_payment`,
-		  DROP `calc_tax`,
-		  DROP `term_of_payment`,
-		  DROP `payment_every`,
-		  DROP `payment_method`,
-		  DROP `bankaccount_holder`,
-		  DROP `bankaccount_number`,
-		  DROP `bankaccount_blz`,
-		  DROP `bankaccount_bank`,
-		  DROP `service_active`,
-		  DROP `servicestart_date`,
-		  DROP `serviceend_date`,
-		  DROP `lastinvoiced_date`,
-		  DROP `lastinvoiced_date_traffic`,
-		  DROP `lastinvoiced_date_diskspace`,
-		  DROP `invoice_fee`,
-		  DROP `invoice_fee_hosting`,
-		  DROP `invoice_fee_domains`,
-		  DROP `invoice_fee_traffic`,
-		  DROP `invoice_fee_diskspace`,
-		  DROP `invoice_fee_other`;");
+			DROP `taxid`,
+			DROP `title`,
+			DROP `country`,
+			DROP `additional_service_description`,
+			DROP `contract_date`,
+			DROP `contract_number`,
+			DROP `contract_details`,
+			DROP `included_domains_qty`,
+			DROP `included_domains_tld`,
+			DROP `additional_traffic_fee`,
+			DROP `additional_traffic_unit`,
+			DROP `additional_diskspace_fee`,
+			DROP `additional_diskspace_unit`,
+			DROP `taxclass`,
+			DROP `setup_fee`,
+			DROP `interval_fee`,
+			DROP `interval_length`,
+			DROP `interval_type`,
+			DROP `interval_payment`,
+			DROP `calc_tax`,
+			DROP `term_of_payment`,
+			DROP `payment_every`,
+			DROP `payment_method`,
+			DROP `bankaccount_holder`,
+			DROP `bankaccount_number`,
+			DROP `bankaccount_blz`,
+			DROP `bankaccount_bank`,
+			DROP `service_active`,
+			DROP `servicestart_date`,
+			DROP `serviceend_date`,
+			DROP `lastinvoiced_date`,
+			DROP `lastinvoiced_date_traffic`,
+			DROP `lastinvoiced_date_diskspace`,
+			DROP `invoice_fee`,
+			DROP `invoice_fee_hosting`,
+			DROP `invoice_fee_domains`,
+			DROP `invoice_fee_traffic`,
+			DROP `invoice_fee_diskspace`,
+			DROP `invoice_fee_other`;");
 	$db->query("ALTER TABLE `panel_domains`
-		  DROP `taxclass`,
-		  DROP `setup_fee`,
-		  DROP `interval_fee`,
-		  DROP `interval_length`,
-		  DROP `interval_type`,
-		  DROP `interval_payment`,
-		  DROP `service_active`,
-		  DROP `servicestart_date`,
-		  DROP `serviceend_date`,
-		  DROP `lastinvoiced_date`;");
+			DROP `taxclass`,
+			DROP `setup_fee`,
+			DROP `interval_fee`,
+			DROP `interval_length`,
+			DROP `interval_type`,
+			DROP `interval_payment`,
+			DROP `service_active`,
+			DROP `servicestart_date`,
+			DROP `serviceend_date`,
+			DROP `lastinvoiced_date`;");
 
 	$db->query("DELETE FROM `" . TABLE_PANEL_SETTINGS . "`
-		WHERE `settinggroup` = 'billing';");
+			WHERE `settinggroup` = 'billing';");
 
 	$db->query("ALTER TABLE `" . TABLE_PANEL_ADMINS . "`
-		  MODIFY `traffic` BIGINT(30),
-		  MODIFY `traffic_used` BIGINT(30)");
+			MODIFY `traffic` BIGINT(30),
+			MODIFY `traffic_used` BIGINT(30)");
 
 	lastStepStatus(0);
 
@@ -192,7 +192,7 @@ if(isFroxlorVersion('0.9-r1'))
 	$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('spf', 'spf_entry', '@	IN	TXT	\"v=spf1 a mx -all\"');");
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `varname` = 'froxlor_graphic' WHERE `varname` = 'syscp_graphic'");
 	if(isset($settings['admin']['syscp_graphic'])
-	&& $settings['admin']['syscp_graphic'] != ''
+			&& $settings['admin']['syscp_graphic'] != ''
 	){
 		$settings['admin']['froxlor_graphic'] = $settings['admin']['syscp_graphic'];
 	}
@@ -226,15 +226,15 @@ if(isFroxlorVersion('0.9-r3'))
 	showUpdateStep("Creating new table 'cronjobs_run'");
 
 	$db->query("CREATE TABLE IF NOT EXISTS `cronjobs_run` (
-				`id` bigint(20) NOT NULL auto_increment,
-				`module` varchar(250) NOT NULL,
-				`cronfile` varchar(250) NOT NULL,
-				`lastrun` int(15) NOT NULL DEFAULT '0',
-				`interval` varchar(100) NOT NULL DEFAULT '5 MINUTE',
-				`isactive` tinyint(1) DEFAULT '1',
-				`desc_lng_key` varchar(100) NOT NULL DEFAULT 'cron_unknown_desc',
-				PRIMARY KEY  (`id`)
-				) ENGINE=MyISAM;");
+			`id` bigint(20) NOT NULL auto_increment,
+			`module` varchar(250) NOT NULL,
+			`cronfile` varchar(250) NOT NULL,
+			`lastrun` int(15) NOT NULL DEFAULT '0',
+			`interval` varchar(100) NOT NULL DEFAULT '5 MINUTE',
+			`isactive` tinyint(1) DEFAULT '1',
+			`desc_lng_key` varchar(100) NOT NULL DEFAULT 'cron_unknown_desc',
+			PRIMARY KEY  (`id`)
+	) ENGINE=MyISAM;");
 
 	lastStepStatus(0);
 	showUpdateStep("Inserting new values into table");
@@ -305,8 +305,8 @@ if(isFroxlorVersion('0.9.1'))
 	$result = $db->query_first("SELECT MAX(`guid`) as `latestguid` FROM `".TABLE_PANEL_CUSTOMERS."`");
 
 	if (isset($result['latestguid'])
-	&& (int)$result['latestguid'] > 0
-	&& $result['latestguid'] != $settings['system']['lastguid']
+			&& (int)$result['latestguid'] > 0
+			&& $result['latestguid'] != $settings['system']['lastguid']
 	) {
 		checkLastGuid();
 		lastStepStatus(1, 'fixed');
@@ -409,9 +409,9 @@ if(isFroxlorVersion('0.9.4'))
 	 * some users might still have the setting in their database
 	 * because we already had this back in older versions.
 	 * To not confuse Froxlor, we just update old settings.
-	 */
+	*/
 	if(isset($settings['system']['awstats_path'])
-	&& $settings['system']['awstats_path'] != ''
+			&& $settings['system']['awstats_path'] != ''
 	) {
 		showUpdateStep("Updating awstats path setting");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/usr/bin/' WHERE `settinggroup` = 'system' AND `varname` = 'awstats_path';");
@@ -425,7 +425,7 @@ if(isFroxlorVersion('0.9.4'))
 	}
 
 	if(isset($settings['system']['awstats_domain_file'])
-	&& $settings['system']['awstats_domain_file'] != ''
+			&& $settings['system']['awstats_domain_file'] != ''
 	) {
 		showUpdateStep("Updating awstats configuration path setting");
 		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `varname` = 'awstats_conf' WHERE `varname` = 'awstats_domain_file';");
@@ -543,28 +543,28 @@ if(isFroxlorVersion('0.9.6-svn2'))
 		$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('defaultwebsrverrhandler', 'enabled', '1');");
 
 		if(isset($_POST['update_deferr_500'])
-		&& trim($_POST['update_deferr_500']) != ''
+				&& trim($_POST['update_deferr_500']) != ''
 		) {
 			$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('defaultwebsrverrhandler', 'err500', '".$db->escape($_POST['update_deferr_500'])."');");
 			$err500 = true;
 		}
 
 		if(isset($_POST['update_deferr_401'])
-		&& trim($_POST['update_deferr_401']) != ''
+				&& trim($_POST['update_deferr_401']) != ''
 		) {
 			$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('defaultwebsrverrhandler', 'err401', '".$db->escape($_POST['update_deferr_401'])."');");
 			$err401 = true;
 		}
 
 		if(isset($_POST['update_deferr_403'])
-		&& trim($_POST['update_deferr_403']) != ''
+				&& trim($_POST['update_deferr_403']) != ''
 		) {
 			$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('defaultwebsrverrhandler', 'err403', '".$db->escape($_POST['update_deferr_403'])."');");
 			$err403 = true;
 		}
 
 		if(isset($_POST['update_deferr_404'])
-		&& trim($_POST['update_deferr_404']) != ''
+				&& trim($_POST['update_deferr_404']) != ''
 		) {
 			$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('defaultwebsrverrhandler', 'err404', '".$db->escape($_POST['update_deferr_404'])."');");
 			$err404 = true;
@@ -672,17 +672,17 @@ if(isFroxlorVersion('0.9.6'))
 
 	showUpdateStep("Adding new tables to database");
 	$db->query("CREATE TABLE IF NOT EXISTS `redirect_codes` (
-  `id` int(5) NOT NULL auto_increment,
-  `code` varchar(3) NOT NULL,
-  `enabled` tinyint(1) DEFAULT '1',
-  PRIMARY KEY  (`id`)
-) ENGINE=MyISAM;");
+			`id` int(5) NOT NULL auto_increment,
+			`code` varchar(3) NOT NULL,
+			`enabled` tinyint(1) DEFAULT '1',
+			PRIMARY KEY  (`id`)
+	) ENGINE=MyISAM;");
 
 	$db->query("CREATE TABLE IF NOT EXISTS `domain_redirect_codes` (
-  `rid` int(5) NOT NULL,
-  `did` int(11) unsigned NOT NULL,
-  UNIQUE KEY `rc` (`rid`, `did`)
-) ENGINE=MyISAM;");
+			`rid` int(5) NOT NULL,
+			`did` int(11) unsigned NOT NULL,
+			UNIQUE KEY `rc` (`rid`, `did`)
+	) ENGINE=MyISAM;");
 	lastStepStatus(0);
 
 	showUpdateStep("Filling new tables with default data");
@@ -1202,8 +1202,8 @@ if(isFroxlorVersion('0.9.14-svn6'))
 
 /*
  * revert database changes we did for multiserver-support
- * before branching - sorry guys :/
- */
+* before branching - sorry guys :/
+*/
 if(isFroxlorVersion('0.9.14-svn9'))
 {
 	showUpdateStep("Reverting multiserver-patches (svn)", false);
@@ -1396,17 +1396,17 @@ if(isFroxlorVersion('0.9.17-svn1'))
 
 	showUpdateStep("Adding new tables to database");
 	$db->query("CREATE TABLE IF NOT EXISTS `ipsandports_docrootsettings` (
-  `id` int(5) NOT NULL auto_increment,
-  `fid` int(11) NOT NULL,
-  `docrootsettings` text NOT NULL,
-  PRIMARY KEY  (`id`)
-) ENGINE=MyISAM;");
+			`id` int(5) NOT NULL auto_increment,
+			`fid` int(11) NOT NULL,
+			`docrootsettings` text NOT NULL,
+			PRIMARY KEY  (`id`)
+	) ENGINE=MyISAM;");
 	$db->query("CREATE TABLE IF NOT EXISTS `domain_docrootsettings` (
-  `id` int(5) NOT NULL auto_increment,
-  `fid` int(11) NOT NULL,
-  `docrootsettings` text NOT NULL,
-  PRIMARY KEY  (`id`)
-) ENGINE=MyISAM;");
+			`id` int(5) NOT NULL auto_increment,
+			`fid` int(11) NOT NULL,
+			`docrootsettings` text NOT NULL,
+			PRIMARY KEY  (`id`)
+	) ENGINE=MyISAM;");
 	lastStepStatus(0);
 
 	updateToVersion('0.9.17-svn2');
@@ -1553,7 +1553,7 @@ if(isFroxlorVersion('0.9.20.1'))
 	// The customer-table may miss the columns, if installed a fresh 0.9.20 or 0.9.20.1 - add them
 	$result = $db->query("DESCRIBE `" . TABLE_PANEL_CUSTOMERS . "`");
 	$columnfound = 0;
-        while($row = $db->fetch_array($result))
+	while($row = $db->fetch_array($result))
 	{
 		if($row['Field'] == 'backup_allowed')
 		{
@@ -1640,9 +1640,9 @@ if(isFroxlorVersion('0.9.22-svn1'))
 	showUpdateStep("Updating from 0.9.22-svn1 to 0.9.22-svn2");
 	lastStepStatus(0);
 
-	/* add new settings for diskspacequota - support */
+	/* fix backup_dir for #186 */
 	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/var/customers/backups/' WHERE `varname` = 'backup_dir';");
-	
+
 	updateToVersion('0.9.22-svn2');
 }
 
@@ -1650,7 +1650,7 @@ if(isFroxlorVersion('0.9.22-svn2'))
 {
 	showUpdateStep("Updating from 0.9.22-svn2 to 0.9.22-rc1");
 	lastStepStatus(0);
-	
+
 	updateToVersion('0.9.22-rc1');
 }
 
@@ -1658,7 +1658,7 @@ if(isFroxlorVersion('0.9.22-rc1'))
 {
 	showUpdateStep("Updating from 0.9.22-rc1 to 0.9.22");
 	lastStepStatus(0);
-	
+
 	updateToVersion('0.9.22');
 }
 
@@ -1709,3 +1709,449 @@ if(isFroxlorVersion('0.9.24-rc1'))
 	updateToVersion('0.9.24');
 }
 
+if(isFroxlorVersion('0.9.24'))
+{
+	showUpdateStep("Updating from 0.9.24 to 0.9.25-rc1");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.25-rc1');
+}
+
+if(isFroxlorVersion('0.9.25-rc1'))
+{
+	showUpdateStep("Updating from 0.9.25-rc1 to 0.9.25");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.25');
+}
+
+if(isFroxlorVersion('0.9.25'))
+{
+	showUpdateStep("Updating from 0.9.25 to 0.9.26-svn1");
+	lastStepStatus(0);
+
+	// enable bind by default
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'bind_enable', '1')");
+
+	updateToVersion('0.9.26-svn1');
+}
+
+if(isFroxlorVersion('0.9.26-svn1'))
+{
+	showUpdateStep("Updating from 0.9.26-svn1 to 0.9.26-rc1");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.26-rc1');
+}
+
+if(isFroxlorVersion('0.9.26-rc1'))
+{
+	showUpdateStep("Updating from 0.9.26-rc1 to 0.9.26");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.26');
+}
+
+if(isFroxlorVersion('0.9.26'))
+{
+	showUpdateStep("Updating from 0.9.26 to 0.9.27-svn1");
+	lastStepStatus(0);
+
+	// check for multiple backup_ftp_enabled entries
+	$handle = $db->query("SELECT `value` FROM `panel_settings` WHERE `varname` = 'backup_ftp_enabled';");
+
+	// if there are more than one entry try to fix it
+	if ($db->num_rows($handle) > 1) {
+		$rows = $db->fetch_array($handle);
+		$state = false;
+
+		// iterate through all found entries
+		// and try to guess what value it should be
+		foreach ($rows as $row) {
+			$state = $state | $row['value'];
+		}
+
+		// now delete all entries
+		$db->query("DELETE FROM `panel_settings` WHERE `varname` = 'backup_ftp_enabled';");
+
+		// and re-add it
+		$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'backup_ftp_enabled', '". $state ."');");
+	}
+
+	updateToVersion('0.9.27-svn1');
+}
+
+if(isFroxlorVersion('0.9.27-svn1'))
+{
+	showUpdateStep("Updating from 0.9.27-svn1 to 0.9.27-svn2");
+	lastStepStatus(0);
+
+	// Get FastCGI timeout setting if available
+	$handle = $db->query("SELECT `value` FROM `panel_settings` WHERE `settinggroup` = 'system' AND `varname` = 'mod_fcgid_idle_timeout';");
+
+	// If timeout is set then skip
+	if ($db->num_rows($handle) < 1) {
+		$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'mod_fcgid_idle_timeout', '30');");
+	}
+
+	// Get FastCGI timeout setting if available
+	$handle = $db->query("SELECT `value` FROM `panel_settings` WHERE `settinggroup` = 'phpfpm' AND `varname` = 'idle_timeout';");
+
+	// If timeout is set then skip
+	if ($db->num_rows($handle) < 1) {
+		$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('phpfpm', 'idle_timeout', '30');");
+	}
+
+	updateToVersion('0.9.27-svn2');
+}
+
+if(isFroxlorVersion('0.9.27-svn2'))
+{
+	showUpdateStep("Updating from 0.9.27-svn2 to 0.9.27-rc1");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.27-rc1');
+}
+
+if(isFroxlorVersion('0.9.27-rc1'))
+{
+	showUpdateStep("Updating from 0.9.27-rc1 to 0.9.27");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.27');
+}
+
+if(isFroxlorVersion('0.9.27')) {
+	showUpdateStep("Updating from 0.9.27 to 0.9.28-svn1");
+	lastStepStatus(0);
+
+	// Get AliasconfigDir setting if available
+	$handle = $db->query("SELECT `value` FROM `panel_settings` WHERE `settinggroup` = 'phpfpm' AND `varname` = 'aliasconfigdir';");
+
+	// If AliasconfigDir is set then skip
+	if ($db->num_rows($handle) < 1) {
+		$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('phpfpm', 'aliasconfigdir', '/var/www/php-fpm/');");
+	}
+
+	updateToVersion('0.9.28-svn1');
+}
+
+if(isFroxlorVersion('0.9.28-svn1')) {
+	showUpdateStep("Updating from 0.9.28-svn1 to 0.9.28-svn2");
+	lastStepStatus(0);
+
+	// Insert ISO-Codes into database. Default value is foo, which is not a valid language code.
+	$db->query("ALTER TABLE  `panel_languages` ADD  `iso` CHAR( 3 ) NOT NULL DEFAULT  'foo' AFTER  `language`");
+
+	$handle = $db->query("SELECT `language` FROM `panel_languages` WHERE `iso`='foo'");
+
+	$langauges = $db->fetch_array($handle);
+	foreach($languages as $language){
+		switch ($language) {
+			case "Deutsch":
+				$db->query("UPDATE `panel_languages` SET `iso`='de' WHERE `language` = 'Deutsch'");
+				break;
+			case "English":
+				$db->query("UPDATE `panel_languages` SET `iso`='en' WHERE `language` = 'English'");
+				break;
+			case "Fran&ccedil;ais":
+				$db->query("UPDATE `panel_languages` SET `iso`='fr' WHERE `language` = 'Fran&ccedil;ais'");
+				break;
+			case "Chinese":
+				$db->query("UPDATE `panel_languages` SET `iso`='zh' WHERE `language` = 'Chinese'");
+				break;
+			case "Catalan":
+				$db->query("UPDATE `panel_languages` SET `iso`='ca' WHERE `language` = 'Catalan'");
+				break;
+			case "Espa&ntilde;ol":
+				$db->query("UPDATE `panel_languages` SET `iso`='es' WHERE `language` = 'Espa&ntilde;ol'");
+				break;
+			case "Portugu&ecirc;s":
+				$db->query("UPDATE `panel_languages` SET `iso`='pt' WHERE `language` = 'Portugu&ecirc;s'");
+				break;
+			case "Danish":
+				$db->query("UPDATE `panel_languages` SET `iso`='da' WHERE `language` = 'Danish'");
+				break;
+			case "Italian":
+				$db->query("UPDATE `panel_languages` SET `iso`='it' WHERE `language` = 'Italian'");
+				break;
+			case "Bulgarian":
+				$db->query("UPDATE `panel_languages` SET `iso`='bg' WHERE `language` = 'Bulgarian'");
+				break;
+			case "Slovak":
+				$db->query("UPDATE `panel_languages` SET `iso`='sk' WHERE `language` = 'Slovak'");
+				break;
+			case "Dutch":
+				$db->query("UPDATE `panel_languages` SET `iso`='nl' WHERE `language` = 'Dutch'");
+				break;
+			case "Russian":
+				$db->query("UPDATE `panel_languages` SET `iso`='ru' WHERE `language` = 'Russian'");
+				break;
+			case "Hungarian":
+				$db->query("UPDATE `panel_languages` SET `iso`='hu' WHERE `language` = 'Hungarian'");
+				break;
+			case "Swedish":
+				$db->query("UPDATE `panel_languages` SET `iso`='sv' WHERE `language` = 'Swedish'");
+				break;
+			case "Czech":
+				$db->query("UPDATE `panel_languages` SET `iso`='cz' WHERE `language` = 'Czech'");
+				break;
+			case "Polski":
+				$db->query("UPDATE `panel_languages` SET `iso`='pl' WHERE `language` = 'Polski'");
+				break;
+			default:
+				showUpdateStep("Sorry, but I don't know the ISO-639 language code for ".$language.". Please update the entry in `panel_languages` manually.\n");
+		}
+	}
+
+	updateToVersion('0.9.28-svn2');
+}
+
+if(isFroxlorVersion('0.9.28-svn2')) {
+	showUpdateStep("Updating from 0.9.28-svn2 to 0.9.28-svn3");
+	lastStepStatus(0);
+
+	// change lenght of passwd column
+	$db->query("ALTER TABLE `" . TABLE_FTP_USERS . "` MODIFY `password` varchar(128) NOT NULL default ''");
+
+	// Add default setting for vmail_maildirname if not already in place
+	$handle = $db->query("SELECT `value` FROM `panel_settings` WHERE `settinggroup` = 'system' AND `varname` = 'vmail_maildirname';");
+	if ($db->num_rows($handle) < 1) {
+		showUpdateStep("Adding default Maildir value into Mailserver settings.");
+		$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'vmail_maildirname', 'Maildir');");
+	}
+
+	updateToVersion('0.9.28-svn3');
+}
+
+if(isFroxlorVersion('0.9.28-svn3'))
+{
+	showUpdateStep("Updating from 0.9.28-svn3 to 0.9.28-svn4", true);
+	lastStepStatus(0);
+
+	if (isset($_POST['classic_theme_replacement']) && $_POST['classic_theme_replacement'] != '')
+	{
+		$classic_theme_replacement = $_POST['classic_theme_replacement'];
+	}
+	else
+	{
+		$classic_theme_replacement = 'Froxlor';
+	}
+	showUpdateStep('Setting replacement for the discontinued and removed Classic theme (if active)', true);
+
+	// Updating default theme setting
+	if ($settings['panel']['default_theme'] == 'Classic')
+	{
+		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '".$db->escape($classic_theme_replacement)."' WHERE varname = 'default_theme';");
+	}
+
+	// Updating admin's theme setting
+	$db->query('UPDATE `' . TABLE_PANEL_ADMINS . '` SET `theme` = \'' . $db->escape($classic_theme_replacement) . '\' WHERE `theme` = \'Classic\'');
+
+	// Updating customer's theme setting
+	$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `theme` = \'' . $db->escape($classic_theme_replacement) . '\' WHERE `theme` = \'Classic\'');
+
+	// Updating theme setting of active sessions
+	$db->query('UPDATE `' . TABLE_PANEL_SESSIONS . '` SET `theme` = \'' . $db->escape($classic_theme_replacement) . '\' WHERE `theme` = \'Classic\'');
+
+	lastStepStatus(0);
+
+	showUpdateStep('Altering Froxlor database and tables to use UTF-8. This may take a while..', true);
+
+	$db->query('ALTER DATABASE `' . $db->getDbName() . '` CHARACTER SET utf8 COLLATE utf8_general_ci');
+
+	$handle = $db->query('SHOW TABLES');
+	while ($row = $db->fetch_array($handle))
+	{
+		foreach ($row as $table)
+		{
+			$db->query('ALTER TABLE `' . $table . '` CONVERT TO CHARACTER SET utf8 COLLATE utf8_general_ci;');
+		}
+	}
+
+	lastStepStatus(0);
+
+	updateToVersion('0.9.28-svn4');
+}
+
+if(isFroxlorVersion('0.9.28-svn4')) {
+	showUpdateStep("Updating from 0.9.28-svn4 to 0.9.28-svn5");
+
+	// Catchall functionality (enabled by default) see #1114
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('catchall', 'catchall_enabled', '1');");
+
+	lastStepStatus(0);
+
+	updateToVersion('0.9.28-svn5');
+}
+
+if(isFroxlorVersion('0.9.28-svn5')) {
+	showUpdateStep("Updating from 0.9.28-svn5 to 0.9.28-svn6", true);
+	lastStepStatus(0);
+
+	$update_system_apache24 = isset($_POST['update_system_apache24']) ? (int)$_POST['update_system_apache24'] : '0';
+	showUpdateStep('Setting value for apache-2.4 modification', true);
+	// support for Apache-2.4
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'apache24', '".$update_system_apache24."');");
+	lastStepStatus(0);
+
+	showUpdateStep("Inserting new tickets-see-all field to panel_admins", true);
+	$db->query("ALTER TABLE `panel_admins` ADD `tickets_see_all` tinyint(1) NOT NULL default '0' AFTER `tickets_used`");
+	lastStepStatus(0);
+
+	showUpdateStep("Updating main admin entry", true);
+	$db->query("UPDATE `panel_admins` SET `tickets_see_all` = '1' WHERE `adminid` = '".$userinfo['adminid']."';");
+	lastStepStatus(0);
+
+	showUpdateStep("Inserting new panel webfont-settings (default: off)", true);
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('panel', 'use_webfonts', '0');");
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('panel', 'webfont', 'Numans');");
+	lastStepStatus(0);
+
+	showUpdateStep("Inserting settings for nginx fastcgi-params file", true);
+	$fastcgiparams = '/etc/nginx/fastcgi_params';
+	if (isset($_POST['nginx_fastcgi_params']) && $_POST['nginx_fastcgi_params'] != '') {
+		$fastcgiparams = makeCorrectFile($_POST['nginx_fastcgi_params']);
+	}
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('nginx', 'fastcgiparams', '".$db->escape($fastcgiparams)."')");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.28-svn6');
+}
+
+if (isFroxlorVersion('0.9.28-svn6')) {
+	showUpdateStep("Updating from 0.9.28-svn6 to 0.9.28 release candidate 1");
+	lastStepStatus(0);
+	updateToVersion('0.9.28-rc1');
+}
+
+if (isFroxlorVersion('0.9.28-rc1')) {
+	showUpdateStep("Updating from 0.9.28-rc1 to 0.9.28-rc2", true);
+	lastStepStatus(0);
+
+	$update_system_documentroot_use_default_value = isset($_POST['update_system_documentroot_use_default_value']) ? (int)$_POST['update_system_documentroot_use_default_value'] : '0';
+	showUpdateStep("Adding new settings for using domain name as default value for DocumentRoot path", true);
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'documentroot_use_default_value', '".$update_system_documentroot_use_default_value."');");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.28-rc2');
+}
+
+if (isFroxlorVersion('0.9.28-rc2')) {
+	showUpdateStep("Updating from 0.9.28-rc2 to 0.9.28 final", true);
+	$db->query("DELETE FROM `panel_settings` WHERE `settinggroup`='system' AND `varname`='mod_log_sql'");
+	$db->query("DELETE FROM `panel_settings` WHERE `settinggroup`='system' AND `varname`='openssl_cnf'");
+	$db->query("ALTER TABLE `panel_domains` DROP `safemode`");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.28');
+}
+
+if (isFroxlorVersion('0.9.28')) {
+	showUpdateStep("Updating from 0.9.28 final to 0.9.28.1");
+	lastStepStatus(0);
+	updateToVersion('0.9.28.1');
+}
+
+if (isFroxlorVersion('0.9.28.1')) {
+	showUpdateStep("Updating from 0.9.28.1 to 0.9.29-dev1", true);
+	lastStepStatus(0);
+
+	$hide_stdsubdomains = isset($_POST['hide_stdsubdomains']) ? (int)$_POST['hide_stdsubdomains'] : '0';
+	showUpdateStep('Setting value for "hide standard subdomains"', true);
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('panel', 'phpconfigs_hidestdsubdomain', '".$hide_stdsubdomains."');");
+	lastStepStatus(0);
+
+	// don't advertise security questions - just set a default silently
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'passwordcryptfunc', '1');");
+
+	$fastcgiparams = $settings['nginx']['fastcgiparams'];
+	// check the faulty value explicitly
+	if ($fastcgiparams == '/etc/nginx/fastcgi_params/') {
+		$fastcgiparams = makeCorrectFile(substr(fastcgiparams,0,-1));
+		$db->query("UPDATE TABLE `panel_settings` SET `value`='".$db->escape($fastcgiparams)."' WHERE `varname`='fastcgiparams';");
+	}
+	updateToVersion('0.9.29-dev1');
+}
+
+if (isFroxlorVersion('0.9.29-dev1')) {
+	showUpdateStep("Updating from 0.9.29-dev1 to 0.9.29-dev2", true);
+	lastStepStatus(0);
+
+	$allow_themechange_c = isset($_POST['allow_themechange_c']) ? (int)$_POST['allow_themechange_c'] : '1';
+	$allow_themechange_a = isset($_POST['allow_themechange_a']) ? (int)$_POST['allow_themechange_a'] : '1';
+	showUpdateStep("Inserting new setting to allow/disallow theme changes (default: on)", true);
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('panel', 'allow_theme_change_admin', '".$allow_themechange_a."');");
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('panel', 'allow_theme_change_customer', '".$allow_themechange_c."');");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.29-dev2');
+}
+
+if (isFroxlorVersion('0.9.29-dev2')) {
+	showUpdateStep("Updating from 0.9.29-dev2 to 0.9.29-dev3", true);
+	lastStepStatus(0);
+
+	$system_afxrservers = isset($_POST['system_afxrservers']) ? trim($_POST['system_afxrservers']) : '';
+	if ($system_afxrservers != '') {
+		$axfrservers = explode(',', $system_afxrservers);
+		$newaxfrserver = array();
+		foreach ($axfrservers as $index => $axfrserver) {
+			if (validate_ip($axfrserver, true) !== false) {
+				$newaxfrserver[] = $axfrserver;
+			}
+		}
+		$system_afxrservers = implode(", ", $newaxfrserver);
+	}
+	showUpdateStep("Inserting new setting for AFXR server", true);
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'axfrservers', '".$db->escape($system_afxrservers)."');");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.29-dev3');
+}
+
+if (isFroxlorVersion('0.9.29-dev3')) {
+	showUpdateStep("Updating from 0.9.29-dev3 to 0.9.29-dev4", true);
+	lastStepStatus(0);
+
+	showUpdateStep("Adding new tables to database", true);
+	$db->query("CREATE TABLE IF NOT EXISTS `domain_ssl_settings` (
+	`id` int(5) NOT NULL auto_increment,
+	`domainid` int(11) NOT NULL,
+	`ssl_cert_file` text NOT NULL,
+	`ssl_key_file` text NOT NULL,
+	`ssl_ca_file` text NOT NULL,
+	`ssl_cert_chainfile` text NOT NULL,
+	PRIMARY KEY  (`id`)
+	) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;");
+	lastStepStatus(0);
+
+	$system_customersslpath = isset($_POST['system_customersslpath']) ? makeCorrectDir($_POST['system_customersslpath']) : '/etc/apache2/ssl/';
+	$db->query("INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES ('system', 'customer_ssl_path', '".$db->escape($system_customersslpath)."');");
+	updateToVersion('0.9.29-dev4');
+}
+
+if (isFroxlorVersion('0.9.29-dev4')) {
+	showUpdateStep("Updating from 0.9.29-dev4 to 0.9.29-rc1", true);
+	lastStepStatus(0);
+
+	// check for wrong vmail_maildirname database-field-name (bug #1242)
+	showUpdateStep("correcting Maildir setting database-field-name (if needed).", true);
+	$db->query("UPDATE `panel_settings` SET `varname` = 'vmail_maildirname' WHERE `settinggroup` = 'system' AND `varname` = 'vmail_maildir'");
+	lastStepStatus(0);
+
+	showUpdateStep("setting default php-configuration for php-fpm", true);
+	$dval = (isset($settings['system']['mod_fcgid_defaultini']) ? $settings['system']['mod_fcgid_defaultini'] : '1');
+	$db->query("INSERT INTO `panel_settings` SET `settinggroup` = 'phpfpm', `varname` = 'defaultini', `value` = '".(int)$dval."'");
+	$dval = (isset($settings['system']['mod_fcgid_ownvhost']) ? $settings['system']['mod_fcgid_ownvhost'] : '1');
+	$db->query("INSERT INTO `panel_settings` SET `settinggroup` = 'phpfpm', `varname` = 'vhost_defaultini', `value` = '".(int)$dval."'");
+	lastStepStatus(0);
+
+	updateToVersion('0.9.29-rc1');
+}
+
+if (isFroxlorVersion('0.9.29-rc1')) {
+	showUpdateStep("Updating from 0.9.29-rc1 to 0.9.29 final", true);
+	lastStepStatus(0);
+	updateToVersion('0.9.29');
+}

install/updates/froxlor/0.9/update_1.0.inc.php

@@ -1,60 +0,0 @@
-<?php
-
-/*
-if(isFroxlorVersion('0.9'))
-{
-	showUpdateStep("Updating from 0.9 to 1.0", false);
-	showUpdateStep("Converting database tables to UTF-8");
-
-	// Convert all data to UTF-8 to have a sane standard across all data
-	$result = $db->query("SHOW TABLES");
-	while($table = $db->fetch_array($result, 'num'))
-	{
-		$db->query("ALTER TABLE " . $table[0] . " CONVERT TO CHARACTER SET utf8 COLLATE utf8_general_ci;");
-		$db->query("ALTER TABLE " . $table[0] . " DEFAULT CHARACTER SET utf8 COLLATE utf8_general_ci");
-
-		$affected_columns = array();
-
-		$primarykey = "";
-		$columns = $db->query("SHOW COLUMNS FROM ".$table[0]);
-		while ($column = $db->fetch_array($columns))
-		{
-			if (!(strpos($column['Type'], "char") === false) || !(strpos($column['Type'], "text") === false))
-			{
-				$affected_columns[] = $column['Field'];
-			}
-
-			if ($column['Key'] == 'PRI') {
-				$primarykey = $column['Field'];
-			}
-		}
-
-		$count_cols = count($affected_columns);
-		if ($count_cols > 0)
-		{
-			$load = "";
-			foreach($affected_columns as $col)
-			{
-				$load .= ", `" . $col . "`";
-			}
-
-			$rows = $db->query("SELECT $primarykey" . $load . " FROM `" . $table[0] . "`");
-			while ($row = $db->fetch_array($rows))
-			{
-				$changes = "";
-				for ($i = 0; $i < $count_cols; $i++)
-				{
-					$base = "`" . $affected_columns[$i] . "` = '" . convertUtf8($row[$affected_columns[$i]]) . "'";
-					$changes .= ($i == ($count_cols-1)) ? $base : $base . ", ";
-				}
-
-				$db->query("UPDATE `" . $table[0] . "` SET " . $changes . " WHERE `$primarykey` = '" . $db->escape($row[$primarykey]) . "';");
-			}
-		}
-	}
-	
-	lastStepStatus(0);
-}
-*/
-
-?>

install/updates/preconfig.php

@@ -49,14 +49,6 @@ function versionInUpdate($current_version, $version_to_check)
 	if (!isFroxlor()) {
 		return true;
 	}
-	$pos_a = strpos($current_version, '-svn');
-	$pos_b = strpos($version_to_check, '-svn');
-	// if we compare svn-versions, we have to add -svn0 to the version
-	// to compare it correctly	
-	if($pos_a === false && $pos_b !== false)
-	{
-		$current_version.= '-svn9999';
-	}
-	
-	return version_compare($current_version, $version_to_check, '<');
+
+	return (version_compare2($current_version, $version_to_check) == -1 ? true : false);
 }

install/updates/preconfig/0.9/preconfig_0.9.inc.php

@@ -26,7 +26,7 @@
  */
 function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 {
-	global $settings, $lng, $db;
+	global $settings, $lng, $db, $theme;
 
 	if(versionInUpdate($current_version, '0.9.4-svn2'))
 	{
@@ -158,7 +158,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 		$question.= makeyesno('update_defdns_mailentry', '1', '0', '0');
 		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
 	}
-	
+
 	if(versionInUpdate($current_version, '0.9.10-svn1'))
 	{
 		$has_nouser = false;
@@ -171,13 +171,13 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 			$has_nouser = true;
 			$guessed_user = 'www-data';
 			if(function_exists('posix_getuid')
-				&& function_exists('posix_getpwuid')
+					&& function_exists('posix_getpwuid')
 			) {
 				$_httpuser = posix_getpwuid(posix_getuid());
 				$guessed_user = $_httpuser['name'];
 			}
 		}
-		
+
 		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'");
 		if(!isset($result) || !isset($result['value']))
 		{
@@ -185,7 +185,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 			$has_nogroup = true;
 			$guessed_group = 'www-data';
 			if(function_exists('posix_getgid')
-				&& function_exists('posix_getgrgid')
+					&& function_exists('posix_getgrgid')
 			) {
 				$_httpgroup = posix_getgrgid(posix_getgid());
 				$guessed_group = $_httpgroup['name'];
@@ -198,8 +198,8 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 			if($has_nouser)
 			{
 				$question = '<strong>Please enter the webservers username:</strong>&nbsp;<input type="text" class="text" name="update_httpuser" value="'.$guessed_user.'" />';
-			} 
-			elseif($has_nogroup) 
+			}
+			elseif($has_nogroup)
 			{
 				$question2 = '<strong>Please enter the webservers groupname:</strong>&nbsp;<input type="text" class="text" name="update_httpgroup" value="'.$guessed_group.'" />';
 				if($has_nouser) {
@@ -238,7 +238,7 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 		$question.= '<input type="text" class="text" name="update_perlpath" value="/usr/bin/perl" />';
 		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
 	}
-	
+
 	if(versionInUpdate($current_version, '0.9.12-svn1'))
 	{
 		if($settings['system']['mod_fcgid'] == 1)
@@ -345,13 +345,13 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 	}
 
 	if(versionInUpdate($current_version, '0.9.14-svn10'))
-	{       
+	{
 		$has_preconfig = true;
-		$description = '<strong>This update removes the unsupported real-time option. Additionally the deprecated tables for navigation and cronscripts are removed, any modules using these tables need to be updated to the new structure!</strong>'; 
+		$description = '<strong>This update removes the unsupported real-time option. Additionally the deprecated tables for navigation and cronscripts are removed, any modules using these tables need to be updated to the new structure!</strong>';
 		$question = '';
 		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
 	}
-	
+
 	if(versionInUpdate($current_version, '0.9.16-svn1'))
 	{
 		$has_preconfig = true;
@@ -417,16 +417,128 @@ function parseAndOutputPreconfig(&$has_preconfig, &$return, $current_version)
 	}
 
 	if(versionInUpdate($current_version, '0.9.18-svn2'))
-	{       
+	{
 		$has_preconfig = true;
-		$description = 'As you can (obviously) see, Froxlor now comes with a new theme. You also have the possibility to switch back to "Classic" if you want to.'; 
+		$description = 'As you can (obviously) see, Froxlor now comes with a new theme. You also have the possibility to switch back to "Classic" if you want to.';
 		$question = '<strong>Select default panel theme:</strong>&nbsp;';
 		$question.= '<select name="update_default_theme">';
 		$themes = getThemes();
-		foreach($themes as $theme) {
-			$question.= makeoption($theme, $theme, 'Froxlor');
+		foreach($themes as $cur_theme) // $theme is already in use
+		{
+			$question.= makeoption($cur_theme, $cur_theme, 'Froxlor');
 		}
 		$question.= '</select>';
 		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
 	}
+
+	if(versionInUpdate($current_version, '0.9.28-svn4'))
+	{
+		$has_preconfig = true;
+		$description = 'This version introduces a lot of profound changes:';
+		$description .= '<br /><ul><li>Improving the whole template system</li><li>Full UTF-8 support</li><li><strong>Removing support for the former default theme \'Classic\'</strong></li></ul>';
+		$description .= '<br /><br />Notice: This update will <strong>alter your Froxlor database to use UTF-8</strong> as default charset. ';
+		$description .= 'Even though this is already tested, we <span style="color:#ff0000;font-weight:bold;">strongly recommend</span> to ';
+		$description .= 'test this update in a testing environment using your existing data.<br /><br />';
+
+		$question = '<strong>Select your preferred Classic Theme replacement:</strong>&nbsp;';
+		$question.= '<select name="classic_theme_replacement">';
+		$themes = getThemes();
+		foreach($themes as $cur_theme)
+		{
+			$question.= makeoption($cur_theme, $cur_theme, 'Froxlor');
+		}
+		$question.= '</select>';
+
+		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+	}
+
+	if (versionInUpdate($current_version, '0.9.28-svn6')) {
+
+		if ($settings['system']['webserver'] == 'apache2') {
+			$has_preconfig = true;
+			$description = 'Froxlor now supports the new Apache 2.4. Please be aware that you need to load additional apache-modules in ordner to use it.<br />';
+			$description.= '<pre>LoadModule authz_core_module modules/mod_authz_core.so
+					LoadModule authz_host_module modules/mod_authz_host.so</pre><br />';
+			$question = '<strong>Do you want to enable the Apache-2.4 modification?:</strong>&nbsp;';
+			$question.= makeyesno('update_system_apache24', '1', '0', '0');
+			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+		} elseif ($settings['system']['webserver'] == 'nginx') {
+			$has_preconfig = true;
+			$description = 'The path to nginx\'s fastcgi_params file is now customizable.<br /><br />';
+			$question = '<strong>Please enter full path to you nginx/fastcgi_params file (including filename):</strong>&nbsp;';
+			$question.= '<input type="text" class="text" name="nginx_fastcgi_params" value="/etc/nginx/fastcgi_params" />';
+			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+		}
+	}
+
+	if (versionInUpdate($current_version, '0.9.28-rc2')) {
+
+		$has_preconfig = true;
+
+		$description  = 'This version adds an option to append the domain-name to the document-root for domains and subdomains.<br />';
+		$description .= 'You can enable or disable this feature anytime from settings -> system settings.<br />';
+
+		$question = '<strong>Do you want to automatically append the domain-name to the documentroot of newly created domains?:</strong>&nbsp;';
+		$question.= makeyesno('update_system_documentroot_use_default_value', '1', '0', '0');
+
+		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+	}
+
+	if (versionInUpdate($current_version, '0.9.28')) {
+
+		$has_preconfig = true;
+		// just an information about the new sendmail parameter (#1134)
+		$description  = 'Froxlor changed the default parameter-set of sendmail (php.ini)<br />';
+		$description .= 'sendmail_path = "/usr/sbin/sendmail -t <strong>-i</strong> -f {CUSTOMER_EMAIL}"<br /><br />';
+		$description .= 'If you don\'t have any problems with sending mails, you don\'t need to change this';
+		if ($settings['system']['mod_fcgid'] == '1'
+				|| $settings['phpfpm']['enabled'] == '1'
+		) {
+			// information about removal of php's safe_mode
+			$description .= '<br /><br />The php safe_mode flag has been removed as current versions of PHP<br />';
+			$description .= 'do not support it anymore.<br /><br />';
+			$description .= 'Please check your php-configurations and remove safe_mode-directives to avoid php notices/warnings.';
+		}
+		$question = '';
+
+		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+	}
+
+	if (versionInUpdate($current_version, '0.9.29-dev1')) {
+		// we only need to ask if fcgid|php-fpm is enabled
+		if ($settings['system']['mod_fcgid'] == '1'
+				|| $settings['phpfpm']['enabled'] == '1'
+		) {
+			$has_preconfig = true;
+			$description  = 'Standard-subdomains can now be hidden from the php-configuration overview.<br />';
+			$question = '<strong>Do you want to hide the standard-subdomains (this can be changed in the settings any time)?:</strong>&nbsp;';
+			$question.= makeyesno('hide_stdsubdomains', '1', '0', '0');
+			eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+		}
+	}
+
+	if (versionInUpdate($current_version, '0.9.29-dev2')) {
+		$has_preconfig = true;
+		$description  = 'You can now decide whether admins/customers are able to change the theme<br />';
+		$question = '<strong>If you want to disallow theme-changing, select "no" from the dropdowns:</strong>&nbsp;';
+		$question.= "Admins: ". makeyesno('allow_themechange_a', '1', '0', '1').'&nbsp;&nbsp;';
+		$question.= "Customers: ".makeyesno('allow_themechange_c', '1', '0', '1');
+		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+	}
+
+	if (versionInUpdate($current_version, '0.9.29-dev3')) {
+		$has_preconfig = true;
+		$description  = 'There is now a possibility to specify AFXR servers for your bind zone-configuration<br />';
+		$question = '<strong>Enter a comma-separated list of AFXR servers or leave empty (default):</strong>&nbsp;';
+		$question.= '<input type="text" class="text" name="system_afxrservers" value="" />';
+		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+	}
+
+	if (versionInUpdate($current_version, '0.9.29-dev4')) {
+		$has_preconfig = true;
+		$description  = 'As customers can now specify ssl-certificate data for their domains, you need to specify where the generated files are stored<br />';
+		$question = '<strong>Specify the directory for customer ssl-certificates:</strong>&nbsp;';
+		$question.= '<input type="text" class="text" name="system_customersslpath" value="/etc/apache2/ssl/" />';
+		eval("\$return.=\"" . getTemplate("update/preconfigitem") . "\";");
+	}
 }

install/updates/syscp/1.0/update_1.0.10_1.2-beta1.inc.php

@@ -31,7 +31,7 @@ if($settings['panel']['version'] == '1.0.10')
 {
 	// Drop/Rename postfix_ tables
 
-	$db->query("DROP TABLE `" . TABLE_POSTFIX_TRANSPORT . "`");
+	$db->query("DROP TABLE IF EXISTS `" . TABLE_POSTFIX_TRANSPORT . "`");
 	$db->query("ALTER TABLE `" . TABLE_POSTFIX_USERS . "` RENAME `" . TABLE_MAIL_USERS . "` ");
 	$db->query("ALTER TABLE `" . TABLE_POSTFIX_VIRTUAL . "` RENAME `" . TABLE_MAIL_VIRTUAL . "` ");
 
@@ -79,4 +79,4 @@ if($settings['panel']['version'] == '1.0.10')
 	$settings['panel']['version'] = '1.2.0';
 }
 
-?>
+?>

js/jquery-ui-1.8.13.min.js

@@ -0,0 +1,407 @@
+/*!
+ * jQuery UI 1.8.13
+ *
+ * Copyright 2011, AUTHORS.txt (http://jqueryui.com/about)
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * http://docs.jquery.com/UI
+ */
+(function(a,d){function c(g,e){var i=g.nodeName.toLowerCase();if("area"===i){e=g.parentNode;i=e.name;if(!g.href||!i||e.nodeName.toLowerCase()!=="map")return false;g=a("img[usemap=#"+i+"]")[0];return!!g&&f(g)}return(/input|select|textarea|button|object/.test(i)?!g.disabled:"a"==i?g.href||e:e)&&f(g)}function f(g){return!a(g).parents().andSelf().filter(function(){return a.curCSS(this,"visibility")==="hidden"||a.expr.filters.hidden(this)}).length}a.ui=a.ui||{};if(!a.ui.version){a.extend(a.ui,{version:"1.8.13",
+keyCode:{ALT:18,BACKSPACE:8,CAPS_LOCK:20,COMMA:188,COMMAND:91,COMMAND_LEFT:91,COMMAND_RIGHT:93,CONTROL:17,DELETE:46,DOWN:40,END:35,ENTER:13,ESCAPE:27,HOME:36,INSERT:45,LEFT:37,MENU:93,NUMPAD_ADD:107,NUMPAD_DECIMAL:110,NUMPAD_DIVIDE:111,NUMPAD_ENTER:108,NUMPAD_MULTIPLY:106,NUMPAD_SUBTRACT:109,PAGE_DOWN:34,PAGE_UP:33,PERIOD:190,RIGHT:39,SHIFT:16,SPACE:32,TAB:9,UP:38,WINDOWS:91}});a.fn.extend({_focus:a.fn.focus,focus:function(g,e){return typeof g==="number"?this.each(function(){var i=this;setTimeout(function(){a(i).focus();
+e&&e.call(i)},g)}):this._focus.apply(this,arguments)},scrollParent:function(){var g;g=a.browser.msie&&/(static|relative)/.test(this.css("position"))||/absolute/.test(this.css("position"))?this.parents().filter(function(){return/(relative|absolute|fixed)/.test(a.curCSS(this,"position",1))&&/(auto|scroll)/.test(a.curCSS(this,"overflow",1)+a.curCSS(this,"overflow-y",1)+a.curCSS(this,"overflow-x",1))}).eq(0):this.parents().filter(function(){return/(auto|scroll)/.test(a.curCSS(this,"overflow",1)+a.curCSS(this,
+"overflow-y",1)+a.curCSS(this,"overflow-x",1))}).eq(0);return/fixed/.test(this.css("position"))||!g.length?a(document):g},zIndex:function(g){if(g!==d)return this.css("zIndex",g);if(this.length){g=a(this[0]);for(var e;g.length&&g[0]!==document;){e=g.css("position");if(e==="absolute"||e==="relative"||e==="fixed"){e=parseInt(g.css("zIndex"),10);if(!isNaN(e)&&e!==0)return e}g=g.parent()}}return 0},disableSelection:function(){return this.bind((a.support.selectstart?"selectstart":"mousedown")+".ui-disableSelection",
+function(g){g.preventDefault()})},enableSelection:function(){return this.unbind(".ui-disableSelection")}});a.each(["Width","Height"],function(g,e){function i(l,o,n,k){a.each(b,function(){o-=parseFloat(a.curCSS(l,"padding"+this,true))||0;if(n)o-=parseFloat(a.curCSS(l,"border"+this+"Width",true))||0;if(k)o-=parseFloat(a.curCSS(l,"margin"+this,true))||0});return o}var b=e==="Width"?["Left","Right"]:["Top","Bottom"],h=e.toLowerCase(),j={innerWidth:a.fn.innerWidth,innerHeight:a.fn.innerHeight,outerWidth:a.fn.outerWidth,
+outerHeight:a.fn.outerHeight};a.fn["inner"+e]=function(l){if(l===d)return j["inner"+e].call(this);return this.each(function(){a(this).css(h,i(this,l)+"px")})};a.fn["outer"+e]=function(l,o){if(typeof l!=="number")return j["outer"+e].call(this,l);return this.each(function(){a(this).css(h,i(this,l,true,o)+"px")})}});a.extend(a.expr[":"],{data:function(g,e,i){return!!a.data(g,i[3])},focusable:function(g){return c(g,!isNaN(a.attr(g,"tabindex")))},tabbable:function(g){var e=a.attr(g,"tabindex"),i=isNaN(e);
+return(i||e>=0)&&c(g,!i)}});a(function(){var g=document.body,e=g.appendChild(e=document.createElement("div"));a.extend(e.style,{minHeight:"100px",height:"auto",padding:0,borderWidth:0});a.support.minHeight=e.offsetHeight===100;a.support.selectstart="onselectstart"in e;g.removeChild(e).style.display="none"});a.extend(a.ui,{plugin:{add:function(g,e,i){g=a.ui[g].prototype;for(var b in i){g.plugins[b]=g.plugins[b]||[];g.plugins[b].push([e,i[b]])}},call:function(g,e,i){if((e=g.plugins[e])&&g.element[0].parentNode)for(var b=
+0;b<e.length;b++)g.options[e[b][0]]&&e[b][1].apply(g.element,i)}},contains:function(g,e){return document.compareDocumentPosition?g.compareDocumentPosition(e)&16:g!==e&&g.contains(e)},hasScroll:function(g,e){if(a(g).css("overflow")==="hidden")return false;e=e&&e==="left"?"scrollLeft":"scrollTop";var i=false;if(g[e]>0)return true;g[e]=1;i=g[e]>0;g[e]=0;return i},isOverAxis:function(g,e,i){return g>e&&g<e+i},isOver:function(g,e,i,b,h,j){return a.ui.isOverAxis(g,i,h)&&a.ui.isOverAxis(e,b,j)}})}})(jQuery);
+(function(a,d){if(a.cleanData){var c=a.cleanData;a.cleanData=function(g){for(var e=0,i;(i=g[e])!=null;e++)a(i).triggerHandler("remove");c(g)}}else{var f=a.fn.remove;a.fn.remove=function(g,e){return this.each(function(){if(!e)if(!g||a.filter(g,[this]).length)a("*",this).add([this]).each(function(){a(this).triggerHandler("remove")});return f.call(a(this),g,e)})}}a.widget=function(g,e,i){var b=g.split(".")[0],h;g=g.split(".")[1];h=b+"-"+g;if(!i){i=e;e=a.Widget}a.expr[":"][h]=function(j){return!!a.data(j,
+g)};a[b]=a[b]||{};a[b][g]=function(j,l){arguments.length&&this._createWidget(j,l)};e=new e;e.options=a.extend(true,{},e.options);a[b][g].prototype=a.extend(true,e,{namespace:b,widgetName:g,widgetEventPrefix:a[b][g].prototype.widgetEventPrefix||g,widgetBaseClass:h},i);a.widget.bridge(g,a[b][g])};a.widget.bridge=function(g,e){a.fn[g]=function(i){var b=typeof i==="string",h=Array.prototype.slice.call(arguments,1),j=this;i=!b&&h.length?a.extend.apply(null,[true,i].concat(h)):i;if(b&&i.charAt(0)==="_")return j;
+b?this.each(function(){var l=a.data(this,g),o=l&&a.isFunction(l[i])?l[i].apply(l,h):l;if(o!==l&&o!==d){j=o;return false}}):this.each(function(){var l=a.data(this,g);l?l.option(i||{})._init():a.data(this,g,new e(i,this))});return j}};a.Widget=function(g,e){arguments.length&&this._createWidget(g,e)};a.Widget.prototype={widgetName:"widget",widgetEventPrefix:"",options:{disabled:false},_createWidget:function(g,e){a.data(e,this.widgetName,this);this.element=a(e);this.options=a.extend(true,{},this.options,
+this._getCreateOptions(),g);var i=this;this.element.bind("remove."+this.widgetName,function(){i.destroy()});this._create();this._trigger("create");this._init()},_getCreateOptions:function(){return a.metadata&&a.metadata.get(this.element[0])[this.widgetName]},_create:function(){},_init:function(){},destroy:function(){this.element.unbind("."+this.widgetName).removeData(this.widgetName);this.widget().unbind("."+this.widgetName).removeAttr("aria-disabled").removeClass(this.widgetBaseClass+"-disabled ui-state-disabled")},
+widget:function(){return this.element},option:function(g,e){var i=g;if(arguments.length===0)return a.extend({},this.options);if(typeof g==="string"){if(e===d)return this.options[g];i={};i[g]=e}this._setOptions(i);return this},_setOptions:function(g){var e=this;a.each(g,function(i,b){e._setOption(i,b)});return this},_setOption:function(g,e){this.options[g]=e;if(g==="disabled")this.widget()[e?"addClass":"removeClass"](this.widgetBaseClass+"-disabled ui-state-disabled").attr("aria-disabled",e);return this},
+enable:function(){return this._setOption("disabled",false)},disable:function(){return this._setOption("disabled",true)},_trigger:function(g,e,i){var b=this.options[g];e=a.Event(e);e.type=(g===this.widgetEventPrefix?g:this.widgetEventPrefix+g).toLowerCase();i=i||{};if(e.originalEvent){g=a.event.props.length;for(var h;g;){h=a.event.props[--g];e[h]=e.originalEvent[h]}}this.element.trigger(e,i);return!(a.isFunction(b)&&b.call(this.element[0],e,i)===false||e.isDefaultPrevented())}}})(jQuery);
+(function(a){var d=false;a(document).mousedown(function(){d=false});a.widget("ui.mouse",{options:{cancel:":input,option",distance:1,delay:0},_mouseInit:function(){var c=this;this.element.bind("mousedown."+this.widgetName,function(f){return c._mouseDown(f)}).bind("click."+this.widgetName,function(f){if(true===a.data(f.target,c.widgetName+".preventClickEvent")){a.removeData(f.target,c.widgetName+".preventClickEvent");f.stopImmediatePropagation();return false}});this.started=false},_mouseDestroy:function(){this.element.unbind("."+
+this.widgetName)},_mouseDown:function(c){if(!d){this._mouseStarted&&this._mouseUp(c);this._mouseDownEvent=c;var f=this,g=c.which==1,e=typeof this.options.cancel=="string"?a(c.target).parents().add(c.target).filter(this.options.cancel).length:false;if(!g||e||!this._mouseCapture(c))return true;this.mouseDelayMet=!this.options.delay;if(!this.mouseDelayMet)this._mouseDelayTimer=setTimeout(function(){f.mouseDelayMet=true},this.options.delay);if(this._mouseDistanceMet(c)&&this._mouseDelayMet(c)){this._mouseStarted=
+this._mouseStart(c)!==false;if(!this._mouseStarted){c.preventDefault();return true}}true===a.data(c.target,this.widgetName+".preventClickEvent")&&a.removeData(c.target,this.widgetName+".preventClickEvent");this._mouseMoveDelegate=function(i){return f._mouseMove(i)};this._mouseUpDelegate=function(i){return f._mouseUp(i)};a(document).bind("mousemove."+this.widgetName,this._mouseMoveDelegate).bind("mouseup."+this.widgetName,this._mouseUpDelegate);c.preventDefault();return d=true}},_mouseMove:function(c){if(a.browser.msie&&
+!(document.documentMode>=9)&&!c.button)return this._mouseUp(c);if(this._mouseStarted){this._mouseDrag(c);return c.preventDefault()}if(this._mouseDistanceMet(c)&&this._mouseDelayMet(c))(this._mouseStarted=this._mouseStart(this._mouseDownEvent,c)!==false)?this._mouseDrag(c):this._mouseUp(c);return!this._mouseStarted},_mouseUp:function(c){a(document).unbind("mousemove."+this.widgetName,this._mouseMoveDelegate).unbind("mouseup."+this.widgetName,this._mouseUpDelegate);if(this._mouseStarted){this._mouseStarted=
+false;c.target==this._mouseDownEvent.target&&a.data(c.target,this.widgetName+".preventClickEvent",true);this._mouseStop(c)}return false},_mouseDistanceMet:function(c){return Math.max(Math.abs(this._mouseDownEvent.pageX-c.pageX),Math.abs(this._mouseDownEvent.pageY-c.pageY))>=this.options.distance},_mouseDelayMet:function(){return this.mouseDelayMet},_mouseStart:function(){},_mouseDrag:function(){},_mouseStop:function(){},_mouseCapture:function(){return true}})})(jQuery);
+(function(a){a.widget("ui.draggable",a.ui.mouse,{widgetEventPrefix:"drag",options:{addClasses:true,appendTo:"parent",axis:false,connectToSortable:false,containment:false,cursor:"auto",cursorAt:false,grid:false,handle:false,helper:"original",iframeFix:false,opacity:false,refreshPositions:false,revert:false,revertDuration:500,scope:"default",scroll:true,scrollSensitivity:20,scrollSpeed:20,snap:false,snapMode:"both",snapTolerance:20,stack:false,zIndex:false},_create:function(){if(this.options.helper==
+"original"&&!/^(?:r|a|f)/.test(this.element.css("position")))this.element[0].style.position="relative";this.options.addClasses&&this.element.addClass("ui-draggable");this.options.disabled&&this.element.addClass("ui-draggable-disabled");this._mouseInit()},destroy:function(){if(this.element.data("draggable")){this.element.removeData("draggable").unbind(".draggable").removeClass("ui-draggable ui-draggable-dragging ui-draggable-disabled");this._mouseDestroy();return this}},_mouseCapture:function(d){var c=
+this.options;if(this.helper||c.disabled||a(d.target).is(".ui-resizable-handle"))return false;this.handle=this._getHandle(d);if(!this.handle)return false;a(c.iframeFix===true?"iframe":c.iframeFix).each(function(){a('<div class="ui-draggable-iframeFix" style="background: #fff;"></div>').css({width:this.offsetWidth+"px",height:this.offsetHeight+"px",position:"absolute",opacity:"0.001",zIndex:1E3}).css(a(this).offset()).appendTo("body")});return true},_mouseStart:function(d){var c=this.options;this.helper=
+this._createHelper(d);this._cacheHelperProportions();if(a.ui.ddmanager)a.ui.ddmanager.current=this;this._cacheMargins();this.cssPosition=this.helper.css("position");this.scrollParent=this.helper.scrollParent();this.offset=this.positionAbs=this.element.offset();this.offset={top:this.offset.top-this.margins.top,left:this.offset.left-this.margins.left};a.extend(this.offset,{click:{left:d.pageX-this.offset.left,top:d.pageY-this.offset.top},parent:this._getParentOffset(),relative:this._getRelativeOffset()});
+this.originalPosition=this.position=this._generatePosition(d);this.originalPageX=d.pageX;this.originalPageY=d.pageY;c.cursorAt&&this._adjustOffsetFromHelper(c.cursorAt);c.containment&&this._setContainment();if(this._trigger("start",d)===false){this._clear();return false}this._cacheHelperProportions();a.ui.ddmanager&&!c.dropBehaviour&&a.ui.ddmanager.prepareOffsets(this,d);this.helper.addClass("ui-draggable-dragging");this._mouseDrag(d,true);return true},_mouseDrag:function(d,c){this.position=this._generatePosition(d);
+this.positionAbs=this._convertPositionTo("absolute");if(!c){c=this._uiHash();if(this._trigger("drag",d,c)===false){this._mouseUp({});return false}this.position=c.position}if(!this.options.axis||this.options.axis!="y")this.helper[0].style.left=this.position.left+"px";if(!this.options.axis||this.options.axis!="x")this.helper[0].style.top=this.position.top+"px";a.ui.ddmanager&&a.ui.ddmanager.drag(this,d);return false},_mouseStop:function(d){var c=false;if(a.ui.ddmanager&&!this.options.dropBehaviour)c=
+a.ui.ddmanager.drop(this,d);if(this.dropped){c=this.dropped;this.dropped=false}if((!this.element[0]||!this.element[0].parentNode)&&this.options.helper=="original")return false;if(this.options.revert=="invalid"&&!c||this.options.revert=="valid"&&c||this.options.revert===true||a.isFunction(this.options.revert)&&this.options.revert.call(this.element,c)){var f=this;a(this.helper).animate(this.originalPosition,parseInt(this.options.revertDuration,10),function(){f._trigger("stop",d)!==false&&f._clear()})}else this._trigger("stop",
+d)!==false&&this._clear();return false},_mouseUp:function(d){this.options.iframeFix===true&&a("div.ui-draggable-iframeFix").each(function(){this.parentNode.removeChild(this)});return a.ui.mouse.prototype._mouseUp.call(this,d)},cancel:function(){this.helper.is(".ui-draggable-dragging")?this._mouseUp({}):this._clear();return this},_getHandle:function(d){var c=!this.options.handle||!a(this.options.handle,this.element).length?true:false;a(this.options.handle,this.element).find("*").andSelf().each(function(){if(this==
+d.target)c=true});return c},_createHelper:function(d){var c=this.options;d=a.isFunction(c.helper)?a(c.helper.apply(this.element[0],[d])):c.helper=="clone"?this.element.clone().removeAttr("id"):this.element;d.parents("body").length||d.appendTo(c.appendTo=="parent"?this.element[0].parentNode:c.appendTo);d[0]!=this.element[0]&&!/(fixed|absolute)/.test(d.css("position"))&&d.css("position","absolute");return d},_adjustOffsetFromHelper:function(d){if(typeof d=="string")d=d.split(" ");if(a.isArray(d))d=
+{left:+d[0],top:+d[1]||0};if("left"in d)this.offset.click.left=d.left+this.margins.left;if("right"in d)this.offset.click.left=this.helperProportions.width-d.right+this.margins.left;if("top"in d)this.offset.click.top=d.top+this.margins.top;if("bottom"in d)this.offset.click.top=this.helperProportions.height-d.bottom+this.margins.top},_getParentOffset:function(){this.offsetParent=this.helper.offsetParent();var d=this.offsetParent.offset();if(this.cssPosition=="absolute"&&this.scrollParent[0]!=document&&
+a.ui.contains(this.scrollParent[0],this.offsetParent[0])){d.left+=this.scrollParent.scrollLeft();d.top+=this.scrollParent.scrollTop()}if(this.offsetParent[0]==document.body||this.offsetParent[0].tagName&&this.offsetParent[0].tagName.toLowerCase()=="html"&&a.browser.msie)d={top:0,left:0};return{top:d.top+(parseInt(this.offsetParent.css("borderTopWidth"),10)||0),left:d.left+(parseInt(this.offsetParent.css("borderLeftWidth"),10)||0)}},_getRelativeOffset:function(){if(this.cssPosition=="relative"){var d=
+this.element.position();return{top:d.top-(parseInt(this.helper.css("top"),10)||0)+this.scrollParent.scrollTop(),left:d.left-(parseInt(this.helper.css("left"),10)||0)+this.scrollParent.scrollLeft()}}else return{top:0,left:0}},_cacheMargins:function(){this.margins={left:parseInt(this.element.css("marginLeft"),10)||0,top:parseInt(this.element.css("marginTop"),10)||0,right:parseInt(this.element.css("marginRight"),10)||0,bottom:parseInt(this.element.css("marginBottom"),10)||0}},_cacheHelperProportions:function(){this.helperProportions=
+{width:this.helper.outerWidth(),height:this.helper.outerHeight()}},_setContainment:function(){var d=this.options;if(d.containment=="parent")d.containment=this.helper[0].parentNode;if(d.containment=="document"||d.containment=="window")this.containment=[(d.containment=="document"?0:a(window).scrollLeft())-this.offset.relative.left-this.offset.parent.left,(d.containment=="document"?0:a(window).scrollTop())-this.offset.relative.top-this.offset.parent.top,(d.containment=="document"?0:a(window).scrollLeft())+
+a(d.containment=="document"?document:window).width()-this.helperProportions.width-this.margins.left,(d.containment=="document"?0:a(window).scrollTop())+(a(d.containment=="document"?document:window).height()||document.body.parentNode.scrollHeight)-this.helperProportions.height-this.margins.top];if(!/^(document|window|parent)$/.test(d.containment)&&d.containment.constructor!=Array){d=a(d.containment);var c=d[0];if(c){d.offset();var f=a(c).css("overflow")!="hidden";this.containment=[(parseInt(a(c).css("borderLeftWidth"),
+10)||0)+(parseInt(a(c).css("paddingLeft"),10)||0),(parseInt(a(c).css("borderTopWidth"),10)||0)+(parseInt(a(c).css("paddingTop"),10)||0),(f?Math.max(c.scrollWidth,c.offsetWidth):c.offsetWidth)-(parseInt(a(c).css("borderLeftWidth"),10)||0)-(parseInt(a(c).css("paddingRight"),10)||0)-this.helperProportions.width-this.margins.left-this.margins.right,(f?Math.max(c.scrollHeight,c.offsetHeight):c.offsetHeight)-(parseInt(a(c).css("borderTopWidth"),10)||0)-(parseInt(a(c).css("paddingBottom"),10)||0)-this.helperProportions.height-
+this.margins.top-this.margins.bottom];this.relative_container=d}}else if(d.containment.constructor==Array)this.containment=d.containment},_convertPositionTo:function(d,c){if(!c)c=this.position;d=d=="absolute"?1:-1;var f=this.cssPosition=="absolute"&&!(this.scrollParent[0]!=document&&a.ui.contains(this.scrollParent[0],this.offsetParent[0]))?this.offsetParent:this.scrollParent,g=/(html|body)/i.test(f[0].tagName);return{top:c.top+this.offset.relative.top*d+this.offset.parent.top*d-(a.browser.safari&&
+a.browser.version<526&&this.cssPosition=="fixed"?0:(this.cssPosition=="fixed"?-this.scrollParent.scrollTop():g?0:f.scrollTop())*d),left:c.left+this.offset.relative.left*d+this.offset.parent.left*d-(a.browser.safari&&a.browser.version<526&&this.cssPosition=="fixed"?0:(this.cssPosition=="fixed"?-this.scrollParent.scrollLeft():g?0:f.scrollLeft())*d)}},_generatePosition:function(d){var c=this.options,f=this.cssPosition=="absolute"&&!(this.scrollParent[0]!=document&&a.ui.contains(this.scrollParent[0],
+this.offsetParent[0]))?this.offsetParent:this.scrollParent,g=/(html|body)/i.test(f[0].tagName),e=d.pageX,i=d.pageY;if(this.originalPosition){var b;if(this.containment){if(this.relative_container){b=this.relative_container.offset();b=[this.containment[0]+b.left,this.containment[1]+b.top,this.containment[2]+b.left,this.containment[3]+b.top]}else b=this.containment;if(d.pageX-this.offset.click.left<b[0])e=b[0]+this.offset.click.left;if(d.pageY-this.offset.click.top<b[1])i=b[1]+this.offset.click.top;
+if(d.pageX-this.offset.click.left>b[2])e=b[2]+this.offset.click.left;if(d.pageY-this.offset.click.top>b[3])i=b[3]+this.offset.click.top}if(c.grid){i=this.originalPageY+Math.round((i-this.originalPageY)/c.grid[1])*c.grid[1];i=b?!(i-this.offset.click.top<b[1]||i-this.offset.click.top>b[3])?i:!(i-this.offset.click.top<b[1])?i-c.grid[1]:i+c.grid[1]:i;e=this.originalPageX+Math.round((e-this.originalPageX)/c.grid[0])*c.grid[0];e=b?!(e-this.offset.click.left<b[0]||e-this.offset.click.left>b[2])?e:!(e-this.offset.click.left<
+b[0])?e-c.grid[0]:e+c.grid[0]:e}}return{top:i-this.offset.click.top-this.offset.relative.top-this.offset.parent.top+(a.browser.safari&&a.browser.version<526&&this.cssPosition=="fixed"?0:this.cssPosition=="fixed"?-this.scrollParent.scrollTop():g?0:f.scrollTop()),left:e-this.offset.click.left-this.offset.relative.left-this.offset.parent.left+(a.browser.safari&&a.browser.version<526&&this.cssPosition=="fixed"?0:this.cssPosition=="fixed"?-this.scrollParent.scrollLeft():g?0:f.scrollLeft())}},_clear:function(){this.helper.removeClass("ui-draggable-dragging");
+this.helper[0]!=this.element[0]&&!this.cancelHelperRemoval&&this.helper.remove();this.helper=null;this.cancelHelperRemoval=false},_trigger:function(d,c,f){f=f||this._uiHash();a.ui.plugin.call(this,d,[c,f]);if(d=="drag")this.positionAbs=this._convertPositionTo("absolute");return a.Widget.prototype._trigger.call(this,d,c,f)},plugins:{},_uiHash:function(){return{helper:this.helper,position:this.position,originalPosition:this.originalPosition,offset:this.positionAbs}}});a.extend(a.ui.draggable,{version:"1.8.13"});
+a.ui.plugin.add("draggable","connectToSortable",{start:function(d,c){var f=a(this).data("draggable"),g=f.options,e=a.extend({},c,{item:f.element});f.sortables=[];a(g.connectToSortable).each(function(){var i=a.data(this,"sortable");if(i&&!i.options.disabled){f.sortables.push({instance:i,shouldRevert:i.options.revert});i.refreshPositions();i._trigger("activate",d,e)}})},stop:function(d,c){var f=a(this).data("draggable"),g=a.extend({},c,{item:f.element});a.each(f.sortables,function(){if(this.instance.isOver){this.instance.isOver=
+0;f.cancelHelperRemoval=true;this.instance.cancelHelperRemoval=false;if(this.shouldRevert)this.instance.options.revert=true;this.instance._mouseStop(d);this.instance.options.helper=this.instance.options._helper;f.options.helper=="original"&&this.instance.currentItem.css({top:"auto",left:"auto"})}else{this.instance.cancelHelperRemoval=false;this.instance._trigger("deactivate",d,g)}})},drag:function(d,c){var f=a(this).data("draggable"),g=this;a.each(f.sortables,function(){this.instance.positionAbs=
+f.positionAbs;this.instance.helperProportions=f.helperProportions;this.instance.offset.click=f.offset.click;if(this.instance._intersectsWith(this.instance.containerCache)){if(!this.instance.isOver){this.instance.isOver=1;this.instance.currentItem=a(g).clone().removeAttr("id").appendTo(this.instance.element).data("sortable-item",true);this.instance.options._helper=this.instance.options.helper;this.instance.options.helper=function(){return c.helper[0]};d.target=this.instance.currentItem[0];this.instance._mouseCapture(d,
+true);this.instance._mouseStart(d,true,true);this.instance.offset.click.top=f.offset.click.top;this.instance.offset.click.left=f.offset.click.left;this.instance.offset.parent.left-=f.offset.parent.left-this.instance.offset.parent.left;this.instance.offset.parent.top-=f.offset.parent.top-this.instance.offset.parent.top;f._trigger("toSortable",d);f.dropped=this.instance.element;f.currentItem=f.element;this.instance.fromOutside=f}this.instance.currentItem&&this.instance._mouseDrag(d)}else if(this.instance.isOver){this.instance.isOver=
+0;this.instance.cancelHelperRemoval=true;this.instance.options.revert=false;this.instance._trigger("out",d,this.instance._uiHash(this.instance));this.instance._mouseStop(d,true);this.instance.options.helper=this.instance.options._helper;this.instance.currentItem.remove();this.instance.placeholder&&this.instance.placeholder.remove();f._trigger("fromSortable",d);f.dropped=false}})}});a.ui.plugin.add("draggable","cursor",{start:function(){var d=a("body"),c=a(this).data("draggable").options;if(d.css("cursor"))c._cursor=
+d.css("cursor");d.css("cursor",c.cursor)},stop:function(){var d=a(this).data("draggable").options;d._cursor&&a("body").css("cursor",d._cursor)}});a.ui.plugin.add("draggable","opacity",{start:function(d,c){d=a(c.helper);c=a(this).data("draggable").options;if(d.css("opacity"))c._opacity=d.css("opacity");d.css("opacity",c.opacity)},stop:function(d,c){d=a(this).data("draggable").options;d._opacity&&a(c.helper).css("opacity",d._opacity)}});a.ui.plugin.add("draggable","scroll",{start:function(){var d=a(this).data("draggable");
+if(d.scrollParent[0]!=document&&d.scrollParent[0].tagName!="HTML")d.overflowOffset=d.scrollParent.offset()},drag:function(d){var c=a(this).data("draggable"),f=c.options,g=false;if(c.scrollParent[0]!=document&&c.scrollParent[0].tagName!="HTML"){if(!f.axis||f.axis!="x")if(c.overflowOffset.top+c.scrollParent[0].offsetHeight-d.pageY<f.scrollSensitivity)c.scrollParent[0].scrollTop=g=c.scrollParent[0].scrollTop+f.scrollSpeed;else if(d.pageY-c.overflowOffset.top<f.scrollSensitivity)c.scrollParent[0].scrollTop=
+g=c.scrollParent[0].scrollTop-f.scrollSpeed;if(!f.axis||f.axis!="y")if(c.overflowOffset.left+c.scrollParent[0].offsetWidth-d.pageX<f.scrollSensitivity)c.scrollParent[0].scrollLeft=g=c.scrollParent[0].scrollLeft+f.scrollSpeed;else if(d.pageX-c.overflowOffset.left<f.scrollSensitivity)c.scrollParent[0].scrollLeft=g=c.scrollParent[0].scrollLeft-f.scrollSpeed}else{if(!f.axis||f.axis!="x")if(d.pageY-a(document).scrollTop()<f.scrollSensitivity)g=a(document).scrollTop(a(document).scrollTop()-f.scrollSpeed);
+else if(a(window).height()-(d.pageY-a(document).scrollTop())<f.scrollSensitivity)g=a(document).scrollTop(a(document).scrollTop()+f.scrollSpeed);if(!f.axis||f.axis!="y")if(d.pageX-a(document).scrollLeft()<f.scrollSensitivity)g=a(document).scrollLeft(a(document).scrollLeft()-f.scrollSpeed);else if(a(window).width()-(d.pageX-a(document).scrollLeft())<f.scrollSensitivity)g=a(document).scrollLeft(a(document).scrollLeft()+f.scrollSpeed)}g!==false&&a.ui.ddmanager&&!f.dropBehaviour&&a.ui.ddmanager.prepareOffsets(c,
+d)}});a.ui.plugin.add("draggable","snap",{start:function(){var d=a(this).data("draggable"),c=d.options;d.snapElements=[];a(c.snap.constructor!=String?c.snap.items||":data(draggable)":c.snap).each(function(){var f=a(this),g=f.offset();this!=d.element[0]&&d.snapElements.push({item:this,width:f.outerWidth(),height:f.outerHeight(),top:g.top,left:g.left})})},drag:function(d,c){for(var f=a(this).data("draggable"),g=f.options,e=g.snapTolerance,i=c.offset.left,b=i+f.helperProportions.width,h=c.offset.top,
+j=h+f.helperProportions.height,l=f.snapElements.length-1;l>=0;l--){var o=f.snapElements[l].left,n=o+f.snapElements[l].width,k=f.snapElements[l].top,m=k+f.snapElements[l].height;if(o-e<i&&i<n+e&&k-e<h&&h<m+e||o-e<i&&i<n+e&&k-e<j&&j<m+e||o-e<b&&b<n+e&&k-e<h&&h<m+e||o-e<b&&b<n+e&&k-e<j&&j<m+e){if(g.snapMode!="inner"){var p=Math.abs(k-j)<=e,q=Math.abs(m-h)<=e,s=Math.abs(o-b)<=e,r=Math.abs(n-i)<=e;if(p)c.position.top=f._convertPositionTo("relative",{top:k-f.helperProportions.height,left:0}).top-f.margins.top;
+if(q)c.position.top=f._convertPositionTo("relative",{top:m,left:0}).top-f.margins.top;if(s)c.position.left=f._convertPositionTo("relative",{top:0,left:o-f.helperProportions.width}).left-f.margins.left;if(r)c.position.left=f._convertPositionTo("relative",{top:0,left:n}).left-f.margins.left}var u=p||q||s||r;if(g.snapMode!="outer"){p=Math.abs(k-h)<=e;q=Math.abs(m-j)<=e;s=Math.abs(o-i)<=e;r=Math.abs(n-b)<=e;if(p)c.position.top=f._convertPositionTo("relative",{top:k,left:0}).top-f.margins.top;if(q)c.position.top=
+f._convertPositionTo("relative",{top:m-f.helperProportions.height,left:0}).top-f.margins.top;if(s)c.position.left=f._convertPositionTo("relative",{top:0,left:o}).left-f.margins.left;if(r)c.position.left=f._convertPositionTo("relative",{top:0,left:n-f.helperProportions.width}).left-f.margins.left}if(!f.snapElements[l].snapping&&(p||q||s||r||u))f.options.snap.snap&&f.options.snap.snap.call(f.element,d,a.extend(f._uiHash(),{snapItem:f.snapElements[l].item}));f.snapElements[l].snapping=p||q||s||r||u}else{f.snapElements[l].snapping&&
+f.options.snap.release&&f.options.snap.release.call(f.element,d,a.extend(f._uiHash(),{snapItem:f.snapElements[l].item}));f.snapElements[l].snapping=false}}}});a.ui.plugin.add("draggable","stack",{start:function(){var d=a(this).data("draggable").options;d=a.makeArray(a(d.stack)).sort(function(f,g){return(parseInt(a(f).css("zIndex"),10)||0)-(parseInt(a(g).css("zIndex"),10)||0)});if(d.length){var c=parseInt(d[0].style.zIndex)||0;a(d).each(function(f){this.style.zIndex=c+f});this[0].style.zIndex=c+d.length}}});
+a.ui.plugin.add("draggable","zIndex",{start:function(d,c){d=a(c.helper);c=a(this).data("draggable").options;if(d.css("zIndex"))c._zIndex=d.css("zIndex");d.css("zIndex",c.zIndex)},stop:function(d,c){d=a(this).data("draggable").options;d._zIndex&&a(c.helper).css("zIndex",d._zIndex)}})})(jQuery);
+(function(a){a.widget("ui.droppable",{widgetEventPrefix:"drop",options:{accept:"*",activeClass:false,addClasses:true,greedy:false,hoverClass:false,scope:"default",tolerance:"intersect"},_create:function(){var d=this.options,c=d.accept;this.isover=0;this.isout=1;this.accept=a.isFunction(c)?c:function(f){return f.is(c)};this.proportions={width:this.element[0].offsetWidth,height:this.element[0].offsetHeight};a.ui.ddmanager.droppables[d.scope]=a.ui.ddmanager.droppables[d.scope]||[];a.ui.ddmanager.droppables[d.scope].push(this);
+d.addClasses&&this.element.addClass("ui-droppable")},destroy:function(){for(var d=a.ui.ddmanager.droppables[this.options.scope],c=0;c<d.length;c++)d[c]==this&&d.splice(c,1);this.element.removeClass("ui-droppable ui-droppable-disabled").removeData("droppable").unbind(".droppable");return this},_setOption:function(d,c){if(d=="accept")this.accept=a.isFunction(c)?c:function(f){return f.is(c)};a.Widget.prototype._setOption.apply(this,arguments)},_activate:function(d){var c=a.ui.ddmanager.current;this.options.activeClass&&
+this.element.addClass(this.options.activeClass);c&&this._trigger("activate",d,this.ui(c))},_deactivate:function(d){var c=a.ui.ddmanager.current;this.options.activeClass&&this.element.removeClass(this.options.activeClass);c&&this._trigger("deactivate",d,this.ui(c))},_over:function(d){var c=a.ui.ddmanager.current;if(!(!c||(c.currentItem||c.element)[0]==this.element[0]))if(this.accept.call(this.element[0],c.currentItem||c.element)){this.options.hoverClass&&this.element.addClass(this.options.hoverClass);
+this._trigger("over",d,this.ui(c))}},_out:function(d){var c=a.ui.ddmanager.current;if(!(!c||(c.currentItem||c.element)[0]==this.element[0]))if(this.accept.call(this.element[0],c.currentItem||c.element)){this.options.hoverClass&&this.element.removeClass(this.options.hoverClass);this._trigger("out",d,this.ui(c))}},_drop:function(d,c){var f=c||a.ui.ddmanager.current;if(!f||(f.currentItem||f.element)[0]==this.element[0])return false;var g=false;this.element.find(":data(droppable)").not(".ui-draggable-dragging").each(function(){var e=
+a.data(this,"droppable");if(e.options.greedy&&!e.options.disabled&&e.options.scope==f.options.scope&&e.accept.call(e.element[0],f.currentItem||f.element)&&a.ui.intersect(f,a.extend(e,{offset:e.element.offset()}),e.options.tolerance)){g=true;return false}});if(g)return false;if(this.accept.call(this.element[0],f.currentItem||f.element)){this.options.activeClass&&this.element.removeClass(this.options.activeClass);this.options.hoverClass&&this.element.removeClass(this.options.hoverClass);this._trigger("drop",
+d,this.ui(f));return this.element}return false},ui:function(d){return{draggable:d.currentItem||d.element,helper:d.helper,position:d.position,offset:d.positionAbs}}});a.extend(a.ui.droppable,{version:"1.8.13"});a.ui.intersect=function(d,c,f){if(!c.offset)return false;var g=(d.positionAbs||d.position.absolute).left,e=g+d.helperProportions.width,i=(d.positionAbs||d.position.absolute).top,b=i+d.helperProportions.height,h=c.offset.left,j=h+c.proportions.width,l=c.offset.top,o=l+c.proportions.height;
+switch(f){case "fit":return h<=g&&e<=j&&l<=i&&b<=o;case "intersect":return h<g+d.helperProportions.width/2&&e-d.helperProportions.width/2<j&&l<i+d.helperProportions.height/2&&b-d.helperProportions.height/2<o;case "pointer":return a.ui.isOver((d.positionAbs||d.position.absolute).top+(d.clickOffset||d.offset.click).top,(d.positionAbs||d.position.absolute).left+(d.clickOffset||d.offset.click).left,l,h,c.proportions.height,c.proportions.width);case "touch":return(i>=l&&i<=o||b>=l&&b<=o||i<l&&b>o)&&(g>=
+h&&g<=j||e>=h&&e<=j||g<h&&e>j);default:return false}};a.ui.ddmanager={current:null,droppables:{"default":[]},prepareOffsets:function(d,c){var f=a.ui.ddmanager.droppables[d.options.scope]||[],g=c?c.type:null,e=(d.currentItem||d.element).find(":data(droppable)").andSelf(),i=0;a:for(;i<f.length;i++)if(!(f[i].options.disabled||d&&!f[i].accept.call(f[i].element[0],d.currentItem||d.element))){for(var b=0;b<e.length;b++)if(e[b]==f[i].element[0]){f[i].proportions.height=0;continue a}f[i].visible=f[i].element.css("display")!=
+"none";if(f[i].visible){g=="mousedown"&&f[i]._activate.call(f[i],c);f[i].offset=f[i].element.offset();f[i].proportions={width:f[i].element[0].offsetWidth,height:f[i].element[0].offsetHeight}}}},drop:function(d,c){var f=false;a.each(a.ui.ddmanager.droppables[d.options.scope]||[],function(){if(this.options){if(!this.options.disabled&&this.visible&&a.ui.intersect(d,this,this.options.tolerance))f=f||this._drop.call(this,c);if(!this.options.disabled&&this.visible&&this.accept.call(this.element[0],d.currentItem||
+d.element)){this.isout=1;this.isover=0;this._deactivate.call(this,c)}}});return f},drag:function(d,c){d.options.refreshPositions&&a.ui.ddmanager.prepareOffsets(d,c);a.each(a.ui.ddmanager.droppables[d.options.scope]||[],function(){if(!(this.options.disabled||this.greedyChild||!this.visible)){var f=a.ui.intersect(d,this,this.options.tolerance);if(f=!f&&this.isover==1?"isout":f&&this.isover==0?"isover":null){var g;if(this.options.greedy){var e=this.element.parents(":data(droppable):eq(0)");if(e.length){g=
+a.data(e[0],"droppable");g.greedyChild=f=="isover"?1:0}}if(g&&f=="isover"){g.isover=0;g.isout=1;g._out.call(g,c)}this[f]=1;this[f=="isout"?"isover":"isout"]=0;this[f=="isover"?"_over":"_out"].call(this,c);if(g&&f=="isout"){g.isout=0;g.isover=1;g._over.call(g,c)}}}})}}})(jQuery);
+(function(a){a.widget("ui.resizable",a.ui.mouse,{widgetEventPrefix:"resize",options:{alsoResize:false,animate:false,animateDuration:"slow",animateEasing:"swing",aspectRatio:false,autoHide:false,containment:false,ghost:false,grid:false,handles:"e,s,se",helper:false,maxHeight:null,maxWidth:null,minHeight:10,minWidth:10,zIndex:1E3},_create:function(){var f=this,g=this.options;this.element.addClass("ui-resizable");a.extend(this,{_aspectRatio:!!g.aspectRatio,aspectRatio:g.aspectRatio,originalElement:this.element,
+_proportionallyResizeElements:[],_helper:g.helper||g.ghost||g.animate?g.helper||"ui-resizable-helper":null});if(this.element[0].nodeName.match(/canvas|textarea|input|select|button|img/i)){/relative/.test(this.element.css("position"))&&a.browser.opera&&this.element.css({position:"relative",top:"auto",left:"auto"});this.element.wrap(a('<div class="ui-wrapper" style="overflow: hidden;"></div>').css({position:this.element.css("position"),width:this.element.outerWidth(),height:this.element.outerHeight(),
+top:this.element.css("top"),left:this.element.css("left")}));this.element=this.element.parent().data("resizable",this.element.data("resizable"));this.elementIsWrapper=true;this.element.css({marginLeft:this.originalElement.css("marginLeft"),marginTop:this.originalElement.css("marginTop"),marginRight:this.originalElement.css("marginRight"),marginBottom:this.originalElement.css("marginBottom")});this.originalElement.css({marginLeft:0,marginTop:0,marginRight:0,marginBottom:0});this.originalResizeStyle=
+this.originalElement.css("resize");this.originalElement.css("resize","none");this._proportionallyResizeElements.push(this.originalElement.css({position:"static",zoom:1,display:"block"}));this.originalElement.css({margin:this.originalElement.css("margin")});this._proportionallyResize()}this.handles=g.handles||(!a(".ui-resizable-handle",this.element).length?"e,s,se":{n:".ui-resizable-n",e:".ui-resizable-e",s:".ui-resizable-s",w:".ui-resizable-w",se:".ui-resizable-se",sw:".ui-resizable-sw",ne:".ui-resizable-ne",
+nw:".ui-resizable-nw"});if(this.handles.constructor==String){if(this.handles=="all")this.handles="n,e,s,w,se,sw,ne,nw";var e=this.handles.split(",");this.handles={};for(var i=0;i<e.length;i++){var b=a.trim(e[i]),h=a('<div class="ui-resizable-handle '+("ui-resizable-"+b)+'"></div>');/sw|se|ne|nw/.test(b)&&h.css({zIndex:++g.zIndex});"se"==b&&h.addClass("ui-icon ui-icon-gripsmall-diagonal-se");this.handles[b]=".ui-resizable-"+b;this.element.append(h)}}this._renderAxis=function(j){j=j||this.element;for(var l in this.handles){if(this.handles[l].constructor==
+String)this.handles[l]=a(this.handles[l],this.element).show();if(this.elementIsWrapper&&this.originalElement[0].nodeName.match(/textarea|input|select|button/i)){var o=a(this.handles[l],this.element),n=0;n=/sw|ne|nw|se|n|s/.test(l)?o.outerHeight():o.outerWidth();o=["padding",/ne|nw|n/.test(l)?"Top":/se|sw|s/.test(l)?"Bottom":/^e$/.test(l)?"Right":"Left"].join("");j.css(o,n);this._proportionallyResize()}a(this.handles[l])}};this._renderAxis(this.element);this._handles=a(".ui-resizable-handle",this.element).disableSelection();
+this._handles.mouseover(function(){if(!f.resizing){if(this.className)var j=this.className.match(/ui-resizable-(se|sw|ne|nw|n|e|s|w)/i);f.axis=j&&j[1]?j[1]:"se"}});if(g.autoHide){this._handles.hide();a(this.element).addClass("ui-resizable-autohide").hover(function(){if(!g.disabled){a(this).removeClass("ui-resizable-autohide");f._handles.show()}},function(){if(!g.disabled)if(!f.resizing){a(this).addClass("ui-resizable-autohide");f._handles.hide()}})}this._mouseInit()},destroy:function(){this._mouseDestroy();
+var f=function(e){a(e).removeClass("ui-resizable ui-resizable-disabled ui-resizable-resizing").removeData("resizable").unbind(".resizable").find(".ui-resizable-handle").remove()};if(this.elementIsWrapper){f(this.element);var g=this.element;g.after(this.originalElement.css({position:g.css("position"),width:g.outerWidth(),height:g.outerHeight(),top:g.css("top"),left:g.css("left")})).remove()}this.originalElement.css("resize",this.originalResizeStyle);f(this.originalElement);return this},_mouseCapture:function(f){var g=
+false;for(var e in this.handles)if(a(this.handles[e])[0]==f.target)g=true;return!this.options.disabled&&g},_mouseStart:function(f){var g=this.options,e=this.element.position(),i=this.element;this.resizing=true;this.documentScroll={top:a(document).scrollTop(),left:a(document).scrollLeft()};if(i.is(".ui-draggable")||/absolute/.test(i.css("position")))i.css({position:"absolute",top:e.top,left:e.left});a.browser.opera&&/relative/.test(i.css("position"))&&i.css({position:"relative",top:"auto",left:"auto"});
+this._renderProxy();e=d(this.helper.css("left"));var b=d(this.helper.css("top"));if(g.containment){e+=a(g.containment).scrollLeft()||0;b+=a(g.containment).scrollTop()||0}this.offset=this.helper.offset();this.position={left:e,top:b};this.size=this._helper?{width:i.outerWidth(),height:i.outerHeight()}:{width:i.width(),height:i.height()};this.originalSize=this._helper?{width:i.outerWidth(),height:i.outerHeight()}:{width:i.width(),height:i.height()};this.originalPosition={left:e,top:b};this.sizeDiff=
+{width:i.outerWidth()-i.width(),height:i.outerHeight()-i.height()};this.originalMousePosition={left:f.pageX,top:f.pageY};this.aspectRatio=typeof g.aspectRatio=="number"?g.aspectRatio:this.originalSize.width/this.originalSize.height||1;g=a(".ui-resizable-"+this.axis).css("cursor");a("body").css("cursor",g=="auto"?this.axis+"-resize":g);i.addClass("ui-resizable-resizing");this._propagate("start",f);return true},_mouseDrag:function(f){var g=this.helper,e=this.originalMousePosition,i=this._change[this.axis];
+if(!i)return false;e=i.apply(this,[f,f.pageX-e.left||0,f.pageY-e.top||0]);if(this._aspectRatio||f.shiftKey)e=this._updateRatio(e,f);e=this._respectSize(e,f);this._propagate("resize",f);g.css({top:this.position.top+"px",left:this.position.left+"px",width:this.size.width+"px",height:this.size.height+"px"});!this._helper&&this._proportionallyResizeElements.length&&this._proportionallyResize();this._updateCache(e);this._trigger("resize",f,this.ui());return false},_mouseStop:function(f){this.resizing=
+false;var g=this.options,e=this;if(this._helper){var i=this._proportionallyResizeElements,b=i.length&&/textarea/i.test(i[0].nodeName);i=b&&a.ui.hasScroll(i[0],"left")?0:e.sizeDiff.height;b=b?0:e.sizeDiff.width;b={width:e.helper.width()-b,height:e.helper.height()-i};i=parseInt(e.element.css("left"),10)+(e.position.left-e.originalPosition.left)||null;var h=parseInt(e.element.css("top"),10)+(e.position.top-e.originalPosition.top)||null;g.animate||this.element.css(a.extend(b,{top:h,left:i}));e.helper.height(e.size.height);
+e.helper.width(e.size.width);this._helper&&!g.animate&&this._proportionallyResize()}a("body").css("cursor","auto");this.element.removeClass("ui-resizable-resizing");this._propagate("stop",f);this._helper&&this.helper.remove();return false},_updateCache:function(f){this.offset=this.helper.offset();if(c(f.left))this.position.left=f.left;if(c(f.top))this.position.top=f.top;if(c(f.height))this.size.height=f.height;if(c(f.width))this.size.width=f.width},_updateRatio:function(f){var g=this.position,e=this.size,
+i=this.axis;if(f.height)f.width=e.height*this.aspectRatio;else if(f.width)f.height=e.width/this.aspectRatio;if(i=="sw"){f.left=g.left+(e.width-f.width);f.top=null}if(i=="nw"){f.top=g.top+(e.height-f.height);f.left=g.left+(e.width-f.width)}return f},_respectSize:function(f){var g=this.options,e=this.axis,i=c(f.width)&&g.maxWidth&&g.maxWidth<f.width,b=c(f.height)&&g.maxHeight&&g.maxHeight<f.height,h=c(f.width)&&g.minWidth&&g.minWidth>f.width,j=c(f.height)&&g.minHeight&&g.minHeight>f.height;if(h)f.width=
+g.minWidth;if(j)f.height=g.minHeight;if(i)f.width=g.maxWidth;if(b)f.height=g.maxHeight;var l=this.originalPosition.left+this.originalSize.width,o=this.position.top+this.size.height,n=/sw|nw|w/.test(e);e=/nw|ne|n/.test(e);if(h&&n)f.left=l-g.minWidth;if(i&&n)f.left=l-g.maxWidth;if(j&&e)f.top=o-g.minHeight;if(b&&e)f.top=o-g.maxHeight;if((g=!f.width&&!f.height)&&!f.left&&f.top)f.top=null;else if(g&&!f.top&&f.left)f.left=null;return f},_proportionallyResize:function(){if(this._proportionallyResizeElements.length)for(var f=
+this.helper||this.element,g=0;g<this._proportionallyResizeElements.length;g++){var e=this._proportionallyResizeElements[g];if(!this.borderDif){var i=[e.css("borderTopWidth"),e.css("borderRightWidth"),e.css("borderBottomWidth"),e.css("borderLeftWidth")],b=[e.css("paddingTop"),e.css("paddingRight"),e.css("paddingBottom"),e.css("paddingLeft")];this.borderDif=a.map(i,function(h,j){h=parseInt(h,10)||0;j=parseInt(b[j],10)||0;return h+j})}a.browser.msie&&(a(f).is(":hidden")||a(f).parents(":hidden").length)||
+e.css({height:f.height()-this.borderDif[0]-this.borderDif[2]||0,width:f.width()-this.borderDif[1]-this.borderDif[3]||0})}},_renderProxy:function(){var f=this.options;this.elementOffset=this.element.offset();if(this._helper){this.helper=this.helper||a('<div style="overflow:hidden;"></div>');var g=a.browser.msie&&a.browser.version<7,e=g?1:0;g=g?2:-1;this.helper.addClass(this._helper).css({width:this.element.outerWidth()+g,height:this.element.outerHeight()+g,position:"absolute",left:this.elementOffset.left-
+e+"px",top:this.elementOffset.top-e+"px",zIndex:++f.zIndex});this.helper.appendTo("body").disableSelection()}else this.helper=this.element},_change:{e:function(f,g){return{width:this.originalSize.width+g}},w:function(f,g){return{left:this.originalPosition.left+g,width:this.originalSize.width-g}},n:function(f,g,e){return{top:this.originalPosition.top+e,height:this.originalSize.height-e}},s:function(f,g,e){return{height:this.originalSize.height+e}},se:function(f,g,e){return a.extend(this._change.s.apply(this,
+arguments),this._change.e.apply(this,[f,g,e]))},sw:function(f,g,e){return a.extend(this._change.s.apply(this,arguments),this._change.w.apply(this,[f,g,e]))},ne:function(f,g,e){return a.extend(this._change.n.apply(this,arguments),this._change.e.apply(this,[f,g,e]))},nw:function(f,g,e){return a.extend(this._change.n.apply(this,arguments),this._change.w.apply(this,[f,g,e]))}},_propagate:function(f,g){a.ui.plugin.call(this,f,[g,this.ui()]);f!="resize"&&this._trigger(f,g,this.ui())},plugins:{},ui:function(){return{originalElement:this.originalElement,
+element:this.element,helper:this.helper,position:this.position,size:this.size,originalSize:this.originalSize,originalPosition:this.originalPosition}}});a.extend(a.ui.resizable,{version:"1.8.13"});a.ui.plugin.add("resizable","alsoResize",{start:function(){var f=a(this).data("resizable").options,g=function(e){a(e).each(function(){var i=a(this);i.data("resizable-alsoresize",{width:parseInt(i.width(),10),height:parseInt(i.height(),10),left:parseInt(i.css("left"),10),top:parseInt(i.css("top"),10),position:i.css("position")})})};
+if(typeof f.alsoResize=="object"&&!f.alsoResize.parentNode)if(f.alsoResize.length){f.alsoResize=f.alsoResize[0];g(f.alsoResize)}else a.each(f.alsoResize,function(e){g(e)});else g(f.alsoResize)},resize:function(f,g){var e=a(this).data("resizable");f=e.options;var i=e.originalSize,b=e.originalPosition,h={height:e.size.height-i.height||0,width:e.size.width-i.width||0,top:e.position.top-b.top||0,left:e.position.left-b.left||0},j=function(l,o){a(l).each(function(){var n=a(this),k=a(this).data("resizable-alsoresize"),
+m={},p=o&&o.length?o:n.parents(g.originalElement[0]).length?["width","height"]:["width","height","top","left"];a.each(p,function(q,s){if((q=(k[s]||0)+(h[s]||0))&&q>=0)m[s]=q||null});if(a.browser.opera&&/relative/.test(n.css("position"))){e._revertToRelativePosition=true;n.css({position:"absolute",top:"auto",left:"auto"})}n.css(m)})};typeof f.alsoResize=="object"&&!f.alsoResize.nodeType?a.each(f.alsoResize,function(l,o){j(l,o)}):j(f.alsoResize)},stop:function(){var f=a(this).data("resizable"),g=f.options,
+e=function(i){a(i).each(function(){var b=a(this);b.css({position:b.data("resizable-alsoresize").position})})};if(f._revertToRelativePosition){f._revertToRelativePosition=false;typeof g.alsoResize=="object"&&!g.alsoResize.nodeType?a.each(g.alsoResize,function(i){e(i)}):e(g.alsoResize)}a(this).removeData("resizable-alsoresize")}});a.ui.plugin.add("resizable","animate",{stop:function(f){var g=a(this).data("resizable"),e=g.options,i=g._proportionallyResizeElements,b=i.length&&/textarea/i.test(i[0].nodeName),
+h=b&&a.ui.hasScroll(i[0],"left")?0:g.sizeDiff.height;b={width:g.size.width-(b?0:g.sizeDiff.width),height:g.size.height-h};h=parseInt(g.element.css("left"),10)+(g.position.left-g.originalPosition.left)||null;var j=parseInt(g.element.css("top"),10)+(g.position.top-g.originalPosition.top)||null;g.element.animate(a.extend(b,j&&h?{top:j,left:h}:{}),{duration:e.animateDuration,easing:e.animateEasing,step:function(){var l={width:parseInt(g.element.css("width"),10),height:parseInt(g.element.css("height"),
+10),top:parseInt(g.element.css("top"),10),left:parseInt(g.element.css("left"),10)};i&&i.length&&a(i[0]).css({width:l.width,height:l.height});g._updateCache(l);g._propagate("resize",f)}})}});a.ui.plugin.add("resizable","containment",{start:function(){var f=a(this).data("resizable"),g=f.element,e=f.options.containment;if(g=e instanceof a?e.get(0):/parent/.test(e)?g.parent().get(0):e){f.containerElement=a(g);if(/document/.test(e)||e==document){f.containerOffset={left:0,top:0};f.containerPosition={left:0,
+top:0};f.parentData={element:a(document),left:0,top:0,width:a(document).width(),height:a(document).height()||document.body.parentNode.scrollHeight}}else{var i=a(g),b=[];a(["Top","Right","Left","Bottom"]).each(function(l,o){b[l]=d(i.css("padding"+o))});f.containerOffset=i.offset();f.containerPosition=i.position();f.containerSize={height:i.innerHeight()-b[3],width:i.innerWidth()-b[1]};e=f.containerOffset;var h=f.containerSize.height,j=f.containerSize.width;j=a.ui.hasScroll(g,"left")?g.scrollWidth:j;
+h=a.ui.hasScroll(g)?g.scrollHeight:h;f.parentData={element:g,left:e.left,top:e.top,width:j,height:h}}}},resize:function(f){var g=a(this).data("resizable"),e=g.options,i=g.containerOffset,b=g.position;f=g._aspectRatio||f.shiftKey;var h={top:0,left:0},j=g.containerElement;if(j[0]!=document&&/static/.test(j.css("position")))h=i;if(b.left<(g._helper?i.left:0)){g.size.width+=g._helper?g.position.left-i.left:g.position.left-h.left;if(f)g.size.height=g.size.width/e.aspectRatio;g.position.left=e.helper?i.left:
+0}if(b.top<(g._helper?i.top:0)){g.size.height+=g._helper?g.position.top-i.top:g.position.top;if(f)g.size.width=g.size.height*e.aspectRatio;g.position.top=g._helper?i.top:0}g.offset.left=g.parentData.left+g.position.left;g.offset.top=g.parentData.top+g.position.top;e=Math.abs((g._helper?g.offset.left-h.left:g.offset.left-h.left)+g.sizeDiff.width);i=Math.abs((g._helper?g.offset.top-h.top:g.offset.top-i.top)+g.sizeDiff.height);b=g.containerElement.get(0)==g.element.parent().get(0);h=/relative|absolute/.test(g.containerElement.css("position"));
+if(b&&h)e-=g.parentData.left;if(e+g.size.width>=g.parentData.width){g.size.width=g.parentData.width-e;if(f)g.size.height=g.size.width/g.aspectRatio}if(i+g.size.height>=g.parentData.height){g.size.height=g.parentData.height-i;if(f)g.size.width=g.size.height*g.aspectRatio}},stop:function(){var f=a(this).data("resizable"),g=f.options,e=f.containerOffset,i=f.containerPosition,b=f.containerElement,h=a(f.helper),j=h.offset(),l=h.outerWidth()-f.sizeDiff.width;h=h.outerHeight()-f.sizeDiff.height;f._helper&&
+!g.animate&&/relative/.test(b.css("position"))&&a(this).css({left:j.left-i.left-e.left,width:l,height:h});f._helper&&!g.animate&&/static/.test(b.css("position"))&&a(this).css({left:j.left-i.left-e.left,width:l,height:h})}});a.ui.plugin.add("resizable","ghost",{start:function(){var f=a(this).data("resizable"),g=f.options,e=f.size;f.ghost=f.originalElement.clone();f.ghost.css({opacity:0.25,display:"block",position:"relative",height:e.height,width:e.width,margin:0,left:0,top:0}).addClass("ui-resizable-ghost").addClass(typeof g.ghost==
+"string"?g.ghost:"");f.ghost.appendTo(f.helper)},resize:function(){var f=a(this).data("resizable");f.ghost&&f.ghost.css({position:"relative",height:f.size.height,width:f.size.width})},stop:function(){var f=a(this).data("resizable");f.ghost&&f.helper&&f.helper.get(0).removeChild(f.ghost.get(0))}});a.ui.plugin.add("resizable","grid",{resize:function(){var f=a(this).data("resizable"),g=f.options,e=f.size,i=f.originalSize,b=f.originalPosition,h=f.axis;g.grid=typeof g.grid=="number"?[g.grid,g.grid]:g.grid;
+var j=Math.round((e.width-i.width)/(g.grid[0]||1))*(g.grid[0]||1);g=Math.round((e.height-i.height)/(g.grid[1]||1))*(g.grid[1]||1);if(/^(se|s|e)$/.test(h)){f.size.width=i.width+j;f.size.height=i.height+g}else if(/^(ne)$/.test(h)){f.size.width=i.width+j;f.size.height=i.height+g;f.position.top=b.top-g}else{if(/^(sw)$/.test(h)){f.size.width=i.width+j;f.size.height=i.height+g}else{f.size.width=i.width+j;f.size.height=i.height+g;f.position.top=b.top-g}f.position.left=b.left-j}}});var d=function(f){return parseInt(f,
+10)||0},c=function(f){return!isNaN(parseInt(f,10))}})(jQuery);
+(function(a){a.widget("ui.selectable",a.ui.mouse,{options:{appendTo:"body",autoRefresh:true,distance:0,filter:"*",tolerance:"touch"},_create:function(){var d=this;this.element.addClass("ui-selectable");this.dragged=false;var c;this.refresh=function(){c=a(d.options.filter,d.element[0]);c.each(function(){var f=a(this),g=f.offset();a.data(this,"selectable-item",{element:this,$element:f,left:g.left,top:g.top,right:g.left+f.outerWidth(),bottom:g.top+f.outerHeight(),startselected:false,selected:f.hasClass("ui-selected"),
+selecting:f.hasClass("ui-selecting"),unselecting:f.hasClass("ui-unselecting")})})};this.refresh();this.selectees=c.addClass("ui-selectee");this._mouseInit();this.helper=a("<div class='ui-selectable-helper'></div>")},destroy:function(){this.selectees.removeClass("ui-selectee").removeData("selectable-item");this.element.removeClass("ui-selectable ui-selectable-disabled").removeData("selectable").unbind(".selectable");this._mouseDestroy();return this},_mouseStart:function(d){var c=this;this.opos=[d.pageX,
+d.pageY];if(!this.options.disabled){var f=this.options;this.selectees=a(f.filter,this.element[0]);this._trigger("start",d);a(f.appendTo).append(this.helper);this.helper.css({left:d.clientX,top:d.clientY,width:0,height:0});f.autoRefresh&&this.refresh();this.selectees.filter(".ui-selected").each(function(){var g=a.data(this,"selectable-item");g.startselected=true;if(!d.metaKey){g.$element.removeClass("ui-selected");g.selected=false;g.$element.addClass("ui-unselecting");g.unselecting=true;c._trigger("unselecting",
+d,{unselecting:g.element})}});a(d.target).parents().andSelf().each(function(){var g=a.data(this,"selectable-item");if(g){var e=!d.metaKey||!g.$element.hasClass("ui-selected");g.$element.removeClass(e?"ui-unselecting":"ui-selected").addClass(e?"ui-selecting":"ui-unselecting");g.unselecting=!e;g.selecting=e;(g.selected=e)?c._trigger("selecting",d,{selecting:g.element}):c._trigger("unselecting",d,{unselecting:g.element});return false}})}},_mouseDrag:function(d){var c=this;this.dragged=true;if(!this.options.disabled){var f=
+this.options,g=this.opos[0],e=this.opos[1],i=d.pageX,b=d.pageY;if(g>i){var h=i;i=g;g=h}if(e>b){h=b;b=e;e=h}this.helper.css({left:g,top:e,width:i-g,height:b-e});this.selectees.each(function(){var j=a.data(this,"selectable-item");if(!(!j||j.element==c.element[0])){var l=false;if(f.tolerance=="touch")l=!(j.left>i||j.right<g||j.top>b||j.bottom<e);else if(f.tolerance=="fit")l=j.left>g&&j.right<i&&j.top>e&&j.bottom<b;if(l){if(j.selected){j.$element.removeClass("ui-selected");j.selected=false}if(j.unselecting){j.$element.removeClass("ui-unselecting");
+j.unselecting=false}if(!j.selecting){j.$element.addClass("ui-selecting");j.selecting=true;c._trigger("selecting",d,{selecting:j.element})}}else{if(j.selecting)if(d.metaKey&&j.startselected){j.$element.removeClass("ui-selecting");j.selecting=false;j.$element.addClass("ui-selected");j.selected=true}else{j.$element.removeClass("ui-selecting");j.selecting=false;if(j.startselected){j.$element.addClass("ui-unselecting");j.unselecting=true}c._trigger("unselecting",d,{unselecting:j.element})}if(j.selected)if(!d.metaKey&&
+!j.startselected){j.$element.removeClass("ui-selected");j.selected=false;j.$element.addClass("ui-unselecting");j.unselecting=true;c._trigger("unselecting",d,{unselecting:j.element})}}}});return false}},_mouseStop:function(d){var c=this;this.dragged=false;a(".ui-unselecting",this.element[0]).each(function(){var f=a.data(this,"selectable-item");f.$element.removeClass("ui-unselecting");f.unselecting=false;f.startselected=false;c._trigger("unselected",d,{unselected:f.element})});a(".ui-selecting",this.element[0]).each(function(){var f=
+a.data(this,"selectable-item");f.$element.removeClass("ui-selecting").addClass("ui-selected");f.selecting=false;f.selected=true;f.startselected=true;c._trigger("selected",d,{selected:f.element})});this._trigger("stop",d);this.helper.remove();return false}});a.extend(a.ui.selectable,{version:"1.8.13"})})(jQuery);
+(function(a){a.widget("ui.sortable",a.ui.mouse,{widgetEventPrefix:"sort",options:{appendTo:"parent",axis:false,connectWith:false,containment:false,cursor:"auto",cursorAt:false,dropOnEmpty:true,forcePlaceholderSize:false,forceHelperSize:false,grid:false,handle:false,helper:"original",items:"> *",opacity:false,placeholder:false,revert:false,scroll:true,scrollSensitivity:20,scrollSpeed:20,scope:"default",tolerance:"intersect",zIndex:1E3},_create:function(){var d=this.options;this.containerCache={};this.element.addClass("ui-sortable");
+this.refresh();this.floating=this.items.length?d.axis==="x"||/left|right/.test(this.items[0].item.css("float"))||/inline|table-cell/.test(this.items[0].item.css("display")):false;this.offset=this.element.offset();this._mouseInit()},destroy:function(){this.element.removeClass("ui-sortable ui-sortable-disabled").removeData("sortable").unbind(".sortable");this._mouseDestroy();for(var d=this.items.length-1;d>=0;d--)this.items[d].item.removeData("sortable-item");return this},_setOption:function(d,c){if(d===
+"disabled"){this.options[d]=c;this.widget()[c?"addClass":"removeClass"]("ui-sortable-disabled")}else a.Widget.prototype._setOption.apply(this,arguments)},_mouseCapture:function(d,c){if(this.reverting)return false;if(this.options.disabled||this.options.type=="static")return false;this._refreshItems(d);var f=null,g=this;a(d.target).parents().each(function(){if(a.data(this,"sortable-item")==g){f=a(this);return false}});if(a.data(d.target,"sortable-item")==g)f=a(d.target);if(!f)return false;if(this.options.handle&&
+!c){var e=false;a(this.options.handle,f).find("*").andSelf().each(function(){if(this==d.target)e=true});if(!e)return false}this.currentItem=f;this._removeCurrentsFromItems();return true},_mouseStart:function(d,c,f){c=this.options;var g=this;this.currentContainer=this;this.refreshPositions();this.helper=this._createHelper(d);this._cacheHelperProportions();this._cacheMargins();this.scrollParent=this.helper.scrollParent();this.offset=this.currentItem.offset();this.offset={top:this.offset.top-this.margins.top,
+left:this.offset.left-this.margins.left};this.helper.css("position","absolute");this.cssPosition=this.helper.css("position");a.extend(this.offset,{click:{left:d.pageX-this.offset.left,top:d.pageY-this.offset.top},parent:this._getParentOffset(),relative:this._getRelativeOffset()});this.originalPosition=this._generatePosition(d);this.originalPageX=d.pageX;this.originalPageY=d.pageY;c.cursorAt&&this._adjustOffsetFromHelper(c.cursorAt);this.domPosition={prev:this.currentItem.prev()[0],parent:this.currentItem.parent()[0]};
+this.helper[0]!=this.currentItem[0]&&this.currentItem.hide();this._createPlaceholder();c.containment&&this._setContainment();if(c.cursor){if(a("body").css("cursor"))this._storedCursor=a("body").css("cursor");a("body").css("cursor",c.cursor)}if(c.opacity){if(this.helper.css("opacity"))this._storedOpacity=this.helper.css("opacity");this.helper.css("opacity",c.opacity)}if(c.zIndex){if(this.helper.css("zIndex"))this._storedZIndex=this.helper.css("zIndex");this.helper.css("zIndex",c.zIndex)}if(this.scrollParent[0]!=
+document&&this.scrollParent[0].tagName!="HTML")this.overflowOffset=this.scrollParent.offset();this._trigger("start",d,this._uiHash());this._preserveHelperProportions||this._cacheHelperProportions();if(!f)for(f=this.containers.length-1;f>=0;f--)this.containers[f]._trigger("activate",d,g._uiHash(this));if(a.ui.ddmanager)a.ui.ddmanager.current=this;a.ui.ddmanager&&!c.dropBehaviour&&a.ui.ddmanager.prepareOffsets(this,d);this.dragging=true;this.helper.addClass("ui-sortable-helper");this._mouseDrag(d);
+return true},_mouseDrag:function(d){this.position=this._generatePosition(d);this.positionAbs=this._convertPositionTo("absolute");if(!this.lastPositionAbs)this.lastPositionAbs=this.positionAbs;if(this.options.scroll){var c=this.options,f=false;if(this.scrollParent[0]!=document&&this.scrollParent[0].tagName!="HTML"){if(this.overflowOffset.top+this.scrollParent[0].offsetHeight-d.pageY<c.scrollSensitivity)this.scrollParent[0].scrollTop=f=this.scrollParent[0].scrollTop+c.scrollSpeed;else if(d.pageY-this.overflowOffset.top<
+c.scrollSensitivity)this.scrollParent[0].scrollTop=f=this.scrollParent[0].scrollTop-c.scrollSpeed;if(this.overflowOffset.left+this.scrollParent[0].offsetWidth-d.pageX<c.scrollSensitivity)this.scrollParent[0].scrollLeft=f=this.scrollParent[0].scrollLeft+c.scrollSpeed;else if(d.pageX-this.overflowOffset.left<c.scrollSensitivity)this.scrollParent[0].scrollLeft=f=this.scrollParent[0].scrollLeft-c.scrollSpeed}else{if(d.pageY-a(document).scrollTop()<c.scrollSensitivity)f=a(document).scrollTop(a(document).scrollTop()-
+c.scrollSpeed);else if(a(window).height()-(d.pageY-a(document).scrollTop())<c.scrollSensitivity)f=a(document).scrollTop(a(document).scrollTop()+c.scrollSpeed);if(d.pageX-a(document).scrollLeft()<c.scrollSensitivity)f=a(document).scrollLeft(a(document).scrollLeft()-c.scrollSpeed);else if(a(window).width()-(d.pageX-a(document).scrollLeft())<c.scrollSensitivity)f=a(document).scrollLeft(a(document).scrollLeft()+c.scrollSpeed)}f!==false&&a.ui.ddmanager&&!c.dropBehaviour&&a.ui.ddmanager.prepareOffsets(this,
+d)}this.positionAbs=this._convertPositionTo("absolute");if(!this.options.axis||this.options.axis!="y")this.helper[0].style.left=this.position.left+"px";if(!this.options.axis||this.options.axis!="x")this.helper[0].style.top=this.position.top+"px";for(c=this.items.length-1;c>=0;c--){f=this.items[c];var g=f.item[0],e=this._intersectsWithPointer(f);if(e)if(g!=this.currentItem[0]&&this.placeholder[e==1?"next":"prev"]()[0]!=g&&!a.ui.contains(this.placeholder[0],g)&&(this.options.type=="semi-dynamic"?!a.ui.contains(this.element[0],
+g):true)){this.direction=e==1?"down":"up";if(this.options.tolerance=="pointer"||this._intersectsWithSides(f))this._rearrange(d,f);else break;this._trigger("change",d,this._uiHash());break}}this._contactContainers(d);a.ui.ddmanager&&a.ui.ddmanager.drag(this,d);this._trigger("sort",d,this._uiHash());this.lastPositionAbs=this.positionAbs;return false},_mouseStop:function(d,c){if(d){a.ui.ddmanager&&!this.options.dropBehaviour&&a.ui.ddmanager.drop(this,d);if(this.options.revert){var f=this;c=f.placeholder.offset();
+f.reverting=true;a(this.helper).animate({left:c.left-this.offset.parent.left-f.margins.left+(this.offsetParent[0]==document.body?0:this.offsetParent[0].scrollLeft),top:c.top-this.offset.parent.top-f.margins.top+(this.offsetParent[0]==document.body?0:this.offsetParent[0].scrollTop)},parseInt(this.options.revert,10)||500,function(){f._clear(d)})}else this._clear(d,c);return false}},cancel:function(){var d=this;if(this.dragging){this._mouseUp({target:null});this.options.helper=="original"?this.currentItem.css(this._storedCSS).removeClass("ui-sortable-helper"):
+this.currentItem.show();for(var c=this.containers.length-1;c>=0;c--){this.containers[c]._trigger("deactivate",null,d._uiHash(this));if(this.containers[c].containerCache.over){this.containers[c]._trigger("out",null,d._uiHash(this));this.containers[c].containerCache.over=0}}}if(this.placeholder){this.placeholder[0].parentNode&&this.placeholder[0].parentNode.removeChild(this.placeholder[0]);this.options.helper!="original"&&this.helper&&this.helper[0].parentNode&&this.helper.remove();a.extend(this,{helper:null,
+dragging:false,reverting:false,_noFinalSort:null});this.domPosition.prev?a(this.domPosition.prev).after(this.currentItem):a(this.domPosition.parent).prepend(this.currentItem)}return this},serialize:function(d){var c=this._getItemsAsjQuery(d&&d.connected),f=[];d=d||{};a(c).each(function(){var g=(a(d.item||this).attr(d.attribute||"id")||"").match(d.expression||/(.+)[-=_](.+)/);if(g)f.push((d.key||g[1]+"[]")+"="+(d.key&&d.expression?g[1]:g[2]))});!f.length&&d.key&&f.push(d.key+"=");return f.join("&")},
+toArray:function(d){var c=this._getItemsAsjQuery(d&&d.connected),f=[];d=d||{};c.each(function(){f.push(a(d.item||this).attr(d.attribute||"id")||"")});return f},_intersectsWith:function(d){var c=this.positionAbs.left,f=c+this.helperProportions.width,g=this.positionAbs.top,e=g+this.helperProportions.height,i=d.left,b=i+d.width,h=d.top,j=h+d.height,l=this.offset.click.top,o=this.offset.click.left;l=g+l>h&&g+l<j&&c+o>i&&c+o<b;return this.options.tolerance=="pointer"||this.options.forcePointerForContainers||
+this.options.tolerance!="pointer"&&this.helperProportions[this.floating?"width":"height"]>d[this.floating?"width":"height"]?l:i<c+this.helperProportions.width/2&&f-this.helperProportions.width/2<b&&h<g+this.helperProportions.height/2&&e-this.helperProportions.height/2<j},_intersectsWithPointer:function(d){var c=a.ui.isOverAxis(this.positionAbs.top+this.offset.click.top,d.top,d.height);d=a.ui.isOverAxis(this.positionAbs.left+this.offset.click.left,d.left,d.width);c=c&&d;d=this._getDragVerticalDirection();
+var f=this._getDragHorizontalDirection();if(!c)return false;return this.floating?f&&f=="right"||d=="down"?2:1:d&&(d=="down"?2:1)},_intersectsWithSides:function(d){var c=a.ui.isOverAxis(this.positionAbs.top+this.offset.click.top,d.top+d.height/2,d.height);d=a.ui.isOverAxis(this.positionAbs.left+this.offset.click.left,d.left+d.width/2,d.width);var f=this._getDragVerticalDirection(),g=this._getDragHorizontalDirection();return this.floating&&g?g=="right"&&d||g=="left"&&!d:f&&(f=="down"&&c||f=="up"&&!c)},
+_getDragVerticalDirection:function(){var d=this.positionAbs.top-this.lastPositionAbs.top;return d!=0&&(d>0?"down":"up")},_getDragHorizontalDirection:function(){var d=this.positionAbs.left-this.lastPositionAbs.left;return d!=0&&(d>0?"right":"left")},refresh:function(d){this._refreshItems(d);this.refreshPositions();return this},_connectWith:function(){var d=this.options;return d.connectWith.constructor==String?[d.connectWith]:d.connectWith},_getItemsAsjQuery:function(d){var c=[],f=[],g=this._connectWith();
+if(g&&d)for(d=g.length-1;d>=0;d--)for(var e=a(g[d]),i=e.length-1;i>=0;i--){var b=a.data(e[i],"sortable");if(b&&b!=this&&!b.options.disabled)f.push([a.isFunction(b.options.items)?b.options.items.call(b.element):a(b.options.items,b.element).not(".ui-sortable-helper").not(".ui-sortable-placeholder"),b])}f.push([a.isFunction(this.options.items)?this.options.items.call(this.element,null,{options:this.options,item:this.currentItem}):a(this.options.items,this.element).not(".ui-sortable-helper").not(".ui-sortable-placeholder"),
+this]);for(d=f.length-1;d>=0;d--)f[d][0].each(function(){c.push(this)});return a(c)},_removeCurrentsFromItems:function(){for(var d=this.currentItem.find(":data(sortable-item)"),c=0;c<this.items.length;c++)for(var f=0;f<d.length;f++)d[f]==this.items[c].item[0]&&this.items.splice(c,1)},_refreshItems:function(d){this.items=[];this.containers=[this];var c=this.items,f=[[a.isFunction(this.options.items)?this.options.items.call(this.element[0],d,{item:this.currentItem}):a(this.options.items,this.element),
+this]],g=this._connectWith();if(g)for(var e=g.length-1;e>=0;e--)for(var i=a(g[e]),b=i.length-1;b>=0;b--){var h=a.data(i[b],"sortable");if(h&&h!=this&&!h.options.disabled){f.push([a.isFunction(h.options.items)?h.options.items.call(h.element[0],d,{item:this.currentItem}):a(h.options.items,h.element),h]);this.containers.push(h)}}for(e=f.length-1;e>=0;e--){d=f[e][1];g=f[e][0];b=0;for(i=g.length;b<i;b++){h=a(g[b]);h.data("sortable-item",d);c.push({item:h,instance:d,width:0,height:0,left:0,top:0})}}},refreshPositions:function(d){if(this.offsetParent&&
+this.helper)this.offset.parent=this._getParentOffset();for(var c=this.items.length-1;c>=0;c--){var f=this.items[c];if(!(f.instance!=this.currentContainer&&this.currentContainer&&f.item[0]!=this.currentItem[0])){var g=this.options.toleranceElement?a(this.options.toleranceElement,f.item):f.item;if(!d){f.width=g.outerWidth();f.height=g.outerHeight()}g=g.offset();f.left=g.left;f.top=g.top}}if(this.options.custom&&this.options.custom.refreshContainers)this.options.custom.refreshContainers.call(this);else for(c=
+this.containers.length-1;c>=0;c--){g=this.containers[c].element.offset();this.containers[c].containerCache.left=g.left;this.containers[c].containerCache.top=g.top;this.containers[c].containerCache.width=this.containers[c].element.outerWidth();this.containers[c].containerCache.height=this.containers[c].element.outerHeight()}return this},_createPlaceholder:function(d){var c=d||this,f=c.options;if(!f.placeholder||f.placeholder.constructor==String){var g=f.placeholder;f.placeholder={element:function(){var e=
+a(document.createElement(c.currentItem[0].nodeName)).addClass(g||c.currentItem[0].className+" ui-sortable-placeholder").removeClass("ui-sortable-helper")[0];if(!g)e.style.visibility="hidden";return e},update:function(e,i){if(!(g&&!f.forcePlaceholderSize)){i.height()||i.height(c.currentItem.innerHeight()-parseInt(c.currentItem.css("paddingTop")||0,10)-parseInt(c.currentItem.css("paddingBottom")||0,10));i.width()||i.width(c.currentItem.innerWidth()-parseInt(c.currentItem.css("paddingLeft")||0,10)-parseInt(c.currentItem.css("paddingRight")||
+0,10))}}}}c.placeholder=a(f.placeholder.element.call(c.element,c.currentItem));c.currentItem.after(c.placeholder);f.placeholder.update(c,c.placeholder)},_contactContainers:function(d){for(var c=null,f=null,g=this.containers.length-1;g>=0;g--)if(!a.ui.contains(this.currentItem[0],this.containers[g].element[0]))if(this._intersectsWith(this.containers[g].containerCache)){if(!(c&&a.ui.contains(this.containers[g].element[0],c.element[0]))){c=this.containers[g];f=g}}else if(this.containers[g].containerCache.over){this.containers[g]._trigger("out",
+d,this._uiHash(this));this.containers[g].containerCache.over=0}if(c)if(this.containers.length===1){this.containers[f]._trigger("over",d,this._uiHash(this));this.containers[f].containerCache.over=1}else if(this.currentContainer!=this.containers[f]){c=1E4;g=null;for(var e=this.positionAbs[this.containers[f].floating?"left":"top"],i=this.items.length-1;i>=0;i--)if(a.ui.contains(this.containers[f].element[0],this.items[i].item[0])){var b=this.items[i][this.containers[f].floating?"left":"top"];if(Math.abs(b-
+e)<c){c=Math.abs(b-e);g=this.items[i]}}if(g||this.options.dropOnEmpty){this.currentContainer=this.containers[f];g?this._rearrange(d,g,null,true):this._rearrange(d,null,this.containers[f].element,true);this._trigger("change",d,this._uiHash());this.containers[f]._trigger("change",d,this._uiHash(this));this.options.placeholder.update(this.currentContainer,this.placeholder);this.containers[f]._trigger("over",d,this._uiHash(this));this.containers[f].containerCache.over=1}}},_createHelper:function(d){var c=
+this.options;d=a.isFunction(c.helper)?a(c.helper.apply(this.element[0],[d,this.currentItem])):c.helper=="clone"?this.currentItem.clone():this.currentItem;d.parents("body").length||a(c.appendTo!="parent"?c.appendTo:this.currentItem[0].parentNode)[0].appendChild(d[0]);if(d[0]==this.currentItem[0])this._storedCSS={width:this.currentItem[0].style.width,height:this.currentItem[0].style.height,position:this.currentItem.css("position"),top:this.currentItem.css("top"),left:this.currentItem.css("left")};if(d[0].style.width==
+""||c.forceHelperSize)d.width(this.currentItem.width());if(d[0].style.height==""||c.forceHelperSize)d.height(this.currentItem.height());return d},_adjustOffsetFromHelper:function(d){if(typeof d=="string")d=d.split(" ");if(a.isArray(d))d={left:+d[0],top:+d[1]||0};if("left"in d)this.offset.click.left=d.left+this.margins.left;if("right"in d)this.offset.click.left=this.helperProportions.width-d.right+this.margins.left;if("top"in d)this.offset.click.top=d.top+this.margins.top;if("bottom"in d)this.offset.click.top=
+this.helperProportions.height-d.bottom+this.margins.top},_getParentOffset:function(){this.offsetParent=this.helper.offsetParent();var d=this.offsetParent.offset();if(this.cssPosition=="absolute"&&this.scrollParent[0]!=document&&a.ui.contains(this.scrollParent[0],this.offsetParent[0])){d.left+=this.scrollParent.scrollLeft();d.top+=this.scrollParent.scrollTop()}if(this.offsetParent[0]==document.body||this.offsetParent[0].tagName&&this.offsetParent[0].tagName.toLowerCase()=="html"&&a.browser.msie)d=
+{top:0,left:0};return{top:d.top+(parseInt(this.offsetParent.css("borderTopWidth"),10)||0),left:d.left+(parseInt(this.offsetParent.css("borderLeftWidth"),10)||0)}},_getRelativeOffset:function(){if(this.cssPosition=="relative"){var d=this.currentItem.position();return{top:d.top-(parseInt(this.helper.css("top"),10)||0)+this.scrollParent.scrollTop(),left:d.left-(parseInt(this.helper.css("left"),10)||0)+this.scrollParent.scrollLeft()}}else return{top:0,left:0}},_cacheMargins:function(){this.margins={left:parseInt(this.currentItem.css("marginLeft"),
+10)||0,top:parseInt(this.currentItem.css("marginTop"),10)||0}},_cacheHelperProportions:function(){this.helperProportions={width:this.helper.outerWidth(),height:this.helper.outerHeight()}},_setContainment:function(){var d=this.options;if(d.containment=="parent")d.containment=this.helper[0].parentNode;if(d.containment=="document"||d.containment=="window")this.containment=[0-this.offset.relative.left-this.offset.parent.left,0-this.offset.relative.top-this.offset.parent.top,a(d.containment=="document"?
+document:window).width()-this.helperProportions.width-this.margins.left,(a(d.containment=="document"?document:window).height()||document.body.parentNode.scrollHeight)-this.helperProportions.height-this.margins.top];if(!/^(document|window|parent)$/.test(d.containment)){var c=a(d.containment)[0];d=a(d.containment).offset();var f=a(c).css("overflow")!="hidden";this.containment=[d.left+(parseInt(a(c).css("borderLeftWidth"),10)||0)+(parseInt(a(c).css("paddingLeft"),10)||0)-this.margins.left,d.top+(parseInt(a(c).css("borderTopWidth"),
+10)||0)+(parseInt(a(c).css("paddingTop"),10)||0)-this.margins.top,d.left+(f?Math.max(c.scrollWidth,c.offsetWidth):c.offsetWidth)-(parseInt(a(c).css("borderLeftWidth"),10)||0)-(parseInt(a(c).css("paddingRight"),10)||0)-this.helperProportions.width-this.margins.left,d.top+(f?Math.max(c.scrollHeight,c.offsetHeight):c.offsetHeight)-(parseInt(a(c).css("borderTopWidth"),10)||0)-(parseInt(a(c).css("paddingBottom"),10)||0)-this.helperProportions.height-this.margins.top]}},_convertPositionTo:function(d,c){if(!c)c=
+this.position;d=d=="absolute"?1:-1;var f=this.cssPosition=="absolute"&&!(this.scrollParent[0]!=document&&a.ui.contains(this.scrollParent[0],this.offsetParent[0]))?this.offsetParent:this.scrollParent,g=/(html|body)/i.test(f[0].tagName);return{top:c.top+this.offset.relative.top*d+this.offset.parent.top*d-(a.browser.safari&&this.cssPosition=="fixed"?0:(this.cssPosition=="fixed"?-this.scrollParent.scrollTop():g?0:f.scrollTop())*d),left:c.left+this.offset.relative.left*d+this.offset.parent.left*d-(a.browser.safari&&
+this.cssPosition=="fixed"?0:(this.cssPosition=="fixed"?-this.scrollParent.scrollLeft():g?0:f.scrollLeft())*d)}},_generatePosition:function(d){var c=this.options,f=this.cssPosition=="absolute"&&!(this.scrollParent[0]!=document&&a.ui.contains(this.scrollParent[0],this.offsetParent[0]))?this.offsetParent:this.scrollParent,g=/(html|body)/i.test(f[0].tagName);if(this.cssPosition=="relative"&&!(this.scrollParent[0]!=document&&this.scrollParent[0]!=this.offsetParent[0]))this.offset.relative=this._getRelativeOffset();
+var e=d.pageX,i=d.pageY;if(this.originalPosition){if(this.containment){if(d.pageX-this.offset.click.left<this.containment[0])e=this.containment[0]+this.offset.click.left;if(d.pageY-this.offset.click.top<this.containment[1])i=this.containment[1]+this.offset.click.top;if(d.pageX-this.offset.click.left>this.containment[2])e=this.containment[2]+this.offset.click.left;if(d.pageY-this.offset.click.top>this.containment[3])i=this.containment[3]+this.offset.click.top}if(c.grid){i=this.originalPageY+Math.round((i-
+this.originalPageY)/c.grid[1])*c.grid[1];i=this.containment?!(i-this.offset.click.top<this.containment[1]||i-this.offset.click.top>this.containment[3])?i:!(i-this.offset.click.top<this.containment[1])?i-c.grid[1]:i+c.grid[1]:i;e=this.originalPageX+Math.round((e-this.originalPageX)/c.grid[0])*c.grid[0];e=this.containment?!(e-this.offset.click.left<this.containment[0]||e-this.offset.click.left>this.containment[2])?e:!(e-this.offset.click.left<this.containment[0])?e-c.grid[0]:e+c.grid[0]:e}}return{top:i-
+this.offset.click.top-this.offset.relative.top-this.offset.parent.top+(a.browser.safari&&this.cssPosition=="fixed"?0:this.cssPosition=="fixed"?-this.scrollParent.scrollTop():g?0:f.scrollTop()),left:e-this.offset.click.left-this.offset.relative.left-this.offset.parent.left+(a.browser.safari&&this.cssPosition=="fixed"?0:this.cssPosition=="fixed"?-this.scrollParent.scrollLeft():g?0:f.scrollLeft())}},_rearrange:function(d,c,f,g){f?f[0].appendChild(this.placeholder[0]):c.item[0].parentNode.insertBefore(this.placeholder[0],
+this.direction=="down"?c.item[0]:c.item[0].nextSibling);this.counter=this.counter?++this.counter:1;var e=this,i=this.counter;window.setTimeout(function(){i==e.counter&&e.refreshPositions(!g)},0)},_clear:function(d,c){this.reverting=false;var f=[];!this._noFinalSort&&this.currentItem[0].parentNode&&this.placeholder.before(this.currentItem);this._noFinalSort=null;if(this.helper[0]==this.currentItem[0]){for(var g in this._storedCSS)if(this._storedCSS[g]=="auto"||this._storedCSS[g]=="static")this._storedCSS[g]=
+"";this.currentItem.css(this._storedCSS).removeClass("ui-sortable-helper")}else this.currentItem.show();this.fromOutside&&!c&&f.push(function(e){this._trigger("receive",e,this._uiHash(this.fromOutside))});if((this.fromOutside||this.domPosition.prev!=this.currentItem.prev().not(".ui-sortable-helper")[0]||this.domPosition.parent!=this.currentItem.parent()[0])&&!c)f.push(function(e){this._trigger("update",e,this._uiHash())});if(!a.ui.contains(this.element[0],this.currentItem[0])){c||f.push(function(e){this._trigger("remove",
+e,this._uiHash())});for(g=this.containers.length-1;g>=0;g--)if(a.ui.contains(this.containers[g].element[0],this.currentItem[0])&&!c){f.push(function(e){return function(i){e._trigger("receive",i,this._uiHash(this))}}.call(this,this.containers[g]));f.push(function(e){return function(i){e._trigger("update",i,this._uiHash(this))}}.call(this,this.containers[g]))}}for(g=this.containers.length-1;g>=0;g--){c||f.push(function(e){return function(i){e._trigger("deactivate",i,this._uiHash(this))}}.call(this,
+this.containers[g]));if(this.containers[g].containerCache.over){f.push(function(e){return function(i){e._trigger("out",i,this._uiHash(this))}}.call(this,this.containers[g]));this.containers[g].containerCache.over=0}}this._storedCursor&&a("body").css("cursor",this._storedCursor);this._storedOpacity&&this.helper.css("opacity",this._storedOpacity);if(this._storedZIndex)this.helper.css("zIndex",this._storedZIndex=="auto"?"":this._storedZIndex);this.dragging=false;if(this.cancelHelperRemoval){if(!c){this._trigger("beforeStop",
+d,this._uiHash());for(g=0;g<f.length;g++)f[g].call(this,d);this._trigger("stop",d,this._uiHash())}return false}c||this._trigger("beforeStop",d,this._uiHash());this.placeholder[0].parentNode.removeChild(this.placeholder[0]);this.helper[0]!=this.currentItem[0]&&this.helper.remove();this.helper=null;if(!c){for(g=0;g<f.length;g++)f[g].call(this,d);this._trigger("stop",d,this._uiHash())}this.fromOutside=false;return true},_trigger:function(){a.Widget.prototype._trigger.apply(this,arguments)===false&&this.cancel()},
+_uiHash:function(d){var c=d||this;return{helper:c.helper,placeholder:c.placeholder||a([]),position:c.position,originalPosition:c.originalPosition,offset:c.positionAbs,item:c.currentItem,sender:d?d.element:null}}});a.extend(a.ui.sortable,{version:"1.8.13"})})(jQuery);
+jQuery.effects||function(a,d){function c(n){var k;if(n&&n.constructor==Array&&n.length==3)return n;if(k=/rgb\(\s*([0-9]{1,3})\s*,\s*([0-9]{1,3})\s*,\s*([0-9]{1,3})\s*\)/.exec(n))return[parseInt(k[1],10),parseInt(k[2],10),parseInt(k[3],10)];if(k=/rgb\(\s*([0-9]+(?:\.[0-9]+)?)\%\s*,\s*([0-9]+(?:\.[0-9]+)?)\%\s*,\s*([0-9]+(?:\.[0-9]+)?)\%\s*\)/.exec(n))return[parseFloat(k[1])*2.55,parseFloat(k[2])*2.55,parseFloat(k[3])*2.55];if(k=/#([a-fA-F0-9]{2})([a-fA-F0-9]{2})([a-fA-F0-9]{2})/.exec(n))return[parseInt(k[1],
+16),parseInt(k[2],16),parseInt(k[3],16)];if(k=/#([a-fA-F0-9])([a-fA-F0-9])([a-fA-F0-9])/.exec(n))return[parseInt(k[1]+k[1],16),parseInt(k[2]+k[2],16),parseInt(k[3]+k[3],16)];if(/rgba\(0, 0, 0, 0\)/.exec(n))return j.transparent;return j[a.trim(n).toLowerCase()]}function f(n,k){var m;do{m=a.curCSS(n,k);if(m!=""&&m!="transparent"||a.nodeName(n,"body"))break;k="backgroundColor"}while(n=n.parentNode);return c(m)}function g(){var n=document.defaultView?document.defaultView.getComputedStyle(this,null):this.currentStyle,
+k={},m,p;if(n&&n.length&&n[0]&&n[n[0]])for(var q=n.length;q--;){m=n[q];if(typeof n[m]=="string"){p=m.replace(/\-(\w)/g,function(s,r){return r.toUpperCase()});k[p]=n[m]}}else for(m in n)if(typeof n[m]==="string")k[m]=n[m];return k}function e(n){var k,m;for(k in n){m=n[k];if(m==null||a.isFunction(m)||k in o||/scrollbar/.test(k)||!/color/i.test(k)&&isNaN(parseFloat(m)))delete n[k]}return n}function i(n,k){var m={_:0},p;for(p in k)if(n[p]!=k[p])m[p]=k[p];return m}function b(n,k,m,p){if(typeof n=="object"){p=
+k;m=null;k=n;n=k.effect}if(a.isFunction(k)){p=k;m=null;k={}}if(typeof k=="number"||a.fx.speeds[k]){p=m;m=k;k={}}if(a.isFunction(m)){p=m;m=null}k=k||{};m=m||k.duration;m=a.fx.off?0:typeof m=="number"?m:m in a.fx.speeds?a.fx.speeds[m]:a.fx.speeds._default;p=p||k.complete;return[n,k,m,p]}function h(n){if(!n||typeof n==="number"||a.fx.speeds[n])return true;if(typeof n==="string"&&!a.effects[n])return true;return false}a.effects={};a.each(["backgroundColor","borderBottomColor","borderLeftColor","borderRightColor",
+"borderTopColor","borderColor","color","outlineColor"],function(n,k){a.fx.step[k]=function(m){if(!m.colorInit){m.start=f(m.elem,k);m.end=c(m.end);m.colorInit=true}m.elem.style[k]="rgb("+Math.max(Math.min(parseInt(m.pos*(m.end[0]-m.start[0])+m.start[0],10),255),0)+","+Math.max(Math.min(parseInt(m.pos*(m.end[1]-m.start[1])+m.start[1],10),255),0)+","+Math.max(Math.min(parseInt(m.pos*(m.end[2]-m.start[2])+m.start[2],10),255),0)+")"}});var j={aqua:[0,255,255],azure:[240,255,255],beige:[245,245,220],black:[0,
+0,0],blue:[0,0,255],brown:[165,42,42],cyan:[0,255,255],darkblue:[0,0,139],darkcyan:[0,139,139],darkgrey:[169,169,169],darkgreen:[0,100,0],darkkhaki:[189,183,107],darkmagenta:[139,0,139],darkolivegreen:[85,107,47],darkorange:[255,140,0],darkorchid:[153,50,204],darkred:[139,0,0],darksalmon:[233,150,122],darkviolet:[148,0,211],fuchsia:[255,0,255],gold:[255,215,0],green:[0,128,0],indigo:[75,0,130],khaki:[240,230,140],lightblue:[173,216,230],lightcyan:[224,255,255],lightgreen:[144,238,144],lightgrey:[211,
+211,211],lightpink:[255,182,193],lightyellow:[255,255,224],lime:[0,255,0],magenta:[255,0,255],maroon:[128,0,0],navy:[0,0,128],olive:[128,128,0],orange:[255,165,0],pink:[255,192,203],purple:[128,0,128],violet:[128,0,128],red:[255,0,0],silver:[192,192,192],white:[255,255,255],yellow:[255,255,0],transparent:[255,255,255]},l=["add","remove","toggle"],o={border:1,borderBottom:1,borderColor:1,borderLeft:1,borderRight:1,borderTop:1,borderWidth:1,margin:1,padding:1};a.effects.animateClass=function(n,k,m,
+p){if(a.isFunction(m)){p=m;m=null}return this.queue(function(){var q=a(this),s=q.attr("style")||" ",r=e(g.call(this)),u,v=q.attr("class");a.each(l,function(w,x){n[x]&&q[x+"Class"](n[x])});u=e(g.call(this));q.attr("class",v);q.animate(i(r,u),{queue:false,duration:k,easding:m,complete:function(){a.each(l,function(w,x){n[x]&&q[x+"Class"](n[x])});if(typeof q.attr("style")=="object"){q.attr("style").cssText="";q.attr("style").cssText=s}else q.attr("style",s);p&&p.apply(this,arguments);a.dequeue(this)}})})};
+a.fn.extend({_addClass:a.fn.addClass,addClass:function(n,k,m,p){return k?a.effects.animateClass.apply(this,[{add:n},k,m,p]):this._addClass(n)},_removeClass:a.fn.removeClass,removeClass:function(n,k,m,p){return k?a.effects.animateClass.apply(this,[{remove:n},k,m,p]):this._removeClass(n)},_toggleClass:a.fn.toggleClass,toggleClass:function(n,k,m,p,q){return typeof k=="boolean"||k===d?m?a.effects.animateClass.apply(this,[k?{add:n}:{remove:n},m,p,q]):this._toggleClass(n,k):a.effects.animateClass.apply(this,
+[{toggle:n},k,m,p])},switchClass:function(n,k,m,p,q){return a.effects.animateClass.apply(this,[{add:k,remove:n},m,p,q])}});a.extend(a.effects,{version:"1.8.13",save:function(n,k){for(var m=0;m<k.length;m++)k[m]!==null&&n.data("ec.storage."+k[m],n[0].style[k[m]])},restore:function(n,k){for(var m=0;m<k.length;m++)k[m]!==null&&n.css(k[m],n.data("ec.storage."+k[m]))},setMode:function(n,k){if(k=="toggle")k=n.is(":hidden")?"show":"hide";return k},getBaseline:function(n,k){var m;switch(n[0]){case "top":m=
+0;break;case "middle":m=0.5;break;case "bottom":m=1;break;default:m=n[0]/k.height}switch(n[1]){case "left":n=0;break;case "center":n=0.5;break;case "right":n=1;break;default:n=n[1]/k.width}return{x:n,y:m}},createWrapper:function(n){if(n.parent().is(".ui-effects-wrapper"))return n.parent();var k={width:n.outerWidth(true),height:n.outerHeight(true),"float":n.css("float")},m=a("<div></div>").addClass("ui-effects-wrapper").css({fontSize:"100%",background:"transparent",border:"none",margin:0,padding:0});
+n.wrap(m);m=n.parent();if(n.css("position")=="static"){m.css({position:"relative"});n.css({position:"relative"})}else{a.extend(k,{position:n.css("position"),zIndex:n.css("z-index")});a.each(["top","left","bottom","right"],function(p,q){k[q]=n.css(q);if(isNaN(parseInt(k[q],10)))k[q]="auto"});n.css({position:"relative",top:0,left:0,right:"auto",bottom:"auto"})}return m.css(k).show()},removeWrapper:function(n){if(n.parent().is(".ui-effects-wrapper"))return n.parent().replaceWith(n);return n},setTransition:function(n,
+k,m,p){p=p||{};a.each(k,function(q,s){unit=n.cssUnit(s);if(unit[0]>0)p[s]=unit[0]*m+unit[1]});return p}});a.fn.extend({effect:function(n){var k=b.apply(this,arguments),m={options:k[1],duration:k[2],callback:k[3]};k=m.options.mode;var p=a.effects[n];if(a.fx.off||!p)return k?this[k](m.duration,m.callback):this.each(function(){m.callback&&m.callback.call(this)});return p.call(this,m)},_show:a.fn.show,show:function(n){if(h(n))return this._show.apply(this,arguments);else{var k=b.apply(this,arguments);
+k[1].mode="show";return this.effect.apply(this,k)}},_hide:a.fn.hide,hide:function(n){if(h(n))return this._hide.apply(this,arguments);else{var k=b.apply(this,arguments);k[1].mode="hide";return this.effect.apply(this,k)}},__toggle:a.fn.toggle,toggle:function(n){if(h(n)||typeof n==="boolean"||a.isFunction(n))return this.__toggle.apply(this,arguments);else{var k=b.apply(this,arguments);k[1].mode="toggle";return this.effect.apply(this,k)}},cssUnit:function(n){var k=this.css(n),m=[];a.each(["em","px","%",
+"pt"],function(p,q){if(k.indexOf(q)>0)m=[parseFloat(k),q]});return m}});a.easing.jswing=a.easing.swing;a.extend(a.easing,{def:"easeOutQuad",swing:function(n,k,m,p,q){return a.easing[a.easing.def](n,k,m,p,q)},easeInQuad:function(n,k,m,p,q){return p*(k/=q)*k+m},easeOutQuad:function(n,k,m,p,q){return-p*(k/=q)*(k-2)+m},easeInOutQuad:function(n,k,m,p,q){if((k/=q/2)<1)return p/2*k*k+m;return-p/2*(--k*(k-2)-1)+m},easeInCubic:function(n,k,m,p,q){return p*(k/=q)*k*k+m},easeOutCubic:function(n,k,m,p,q){return p*
+((k=k/q-1)*k*k+1)+m},easeInOutCubic:function(n,k,m,p,q){if((k/=q/2)<1)return p/2*k*k*k+m;return p/2*((k-=2)*k*k+2)+m},easeInQuart:function(n,k,m,p,q){return p*(k/=q)*k*k*k+m},easeOutQuart:function(n,k,m,p,q){return-p*((k=k/q-1)*k*k*k-1)+m},easeInOutQuart:function(n,k,m,p,q){if((k/=q/2)<1)return p/2*k*k*k*k+m;return-p/2*((k-=2)*k*k*k-2)+m},easeInQuint:function(n,k,m,p,q){return p*(k/=q)*k*k*k*k+m},easeOutQuint:function(n,k,m,p,q){return p*((k=k/q-1)*k*k*k*k+1)+m},easeInOutQuint:function(n,k,m,p,q){if((k/=
+q/2)<1)return p/2*k*k*k*k*k+m;return p/2*((k-=2)*k*k*k*k+2)+m},easeInSine:function(n,k,m,p,q){return-p*Math.cos(k/q*(Math.PI/2))+p+m},easeOutSine:function(n,k,m,p,q){return p*Math.sin(k/q*(Math.PI/2))+m},easeInOutSine:function(n,k,m,p,q){return-p/2*(Math.cos(Math.PI*k/q)-1)+m},easeInExpo:function(n,k,m,p,q){return k==0?m:p*Math.pow(2,10*(k/q-1))+m},easeOutExpo:function(n,k,m,p,q){return k==q?m+p:p*(-Math.pow(2,-10*k/q)+1)+m},easeInOutExpo:function(n,k,m,p,q){if(k==0)return m;if(k==q)return m+p;if((k/=
+q/2)<1)return p/2*Math.pow(2,10*(k-1))+m;return p/2*(-Math.pow(2,-10*--k)+2)+m},easeInCirc:function(n,k,m,p,q){return-p*(Math.sqrt(1-(k/=q)*k)-1)+m},easeOutCirc:function(n,k,m,p,q){return p*Math.sqrt(1-(k=k/q-1)*k)+m},easeInOutCirc:function(n,k,m,p,q){if((k/=q/2)<1)return-p/2*(Math.sqrt(1-k*k)-1)+m;return p/2*(Math.sqrt(1-(k-=2)*k)+1)+m},easeInElastic:function(n,k,m,p,q){n=1.70158;var s=0,r=p;if(k==0)return m;if((k/=q)==1)return m+p;s||(s=q*0.3);if(r<Math.abs(p)){r=p;n=s/4}else n=s/(2*Math.PI)*Math.asin(p/
+r);return-(r*Math.pow(2,10*(k-=1))*Math.sin((k*q-n)*2*Math.PI/s))+m},easeOutElastic:function(n,k,m,p,q){n=1.70158;var s=0,r=p;if(k==0)return m;if((k/=q)==1)return m+p;s||(s=q*0.3);if(r<Math.abs(p)){r=p;n=s/4}else n=s/(2*Math.PI)*Math.asin(p/r);return r*Math.pow(2,-10*k)*Math.sin((k*q-n)*2*Math.PI/s)+p+m},easeInOutElastic:function(n,k,m,p,q){n=1.70158;var s=0,r=p;if(k==0)return m;if((k/=q/2)==2)return m+p;s||(s=q*0.3*1.5);if(r<Math.abs(p)){r=p;n=s/4}else n=s/(2*Math.PI)*Math.asin(p/r);if(k<1)return-0.5*
+r*Math.pow(2,10*(k-=1))*Math.sin((k*q-n)*2*Math.PI/s)+m;return r*Math.pow(2,-10*(k-=1))*Math.sin((k*q-n)*2*Math.PI/s)*0.5+p+m},easeInBack:function(n,k,m,p,q,s){if(s==d)s=1.70158;return p*(k/=q)*k*((s+1)*k-s)+m},easeOutBack:function(n,k,m,p,q,s){if(s==d)s=1.70158;return p*((k=k/q-1)*k*((s+1)*k+s)+1)+m},easeInOutBack:function(n,k,m,p,q,s){if(s==d)s=1.70158;if((k/=q/2)<1)return p/2*k*k*(((s*=1.525)+1)*k-s)+m;return p/2*((k-=2)*k*(((s*=1.525)+1)*k+s)+2)+m},easeInBounce:function(n,k,m,p,q){return p-a.easing.easeOutBounce(n,
+q-k,0,p,q)+m},easeOutBounce:function(n,k,m,p,q){return(k/=q)<1/2.75?p*7.5625*k*k+m:k<2/2.75?p*(7.5625*(k-=1.5/2.75)*k+0.75)+m:k<2.5/2.75?p*(7.5625*(k-=2.25/2.75)*k+0.9375)+m:p*(7.5625*(k-=2.625/2.75)*k+0.984375)+m},easeInOutBounce:function(n,k,m,p,q){if(k<q/2)return a.easing.easeInBounce(n,k*2,0,p,q)*0.5+m;return a.easing.easeOutBounce(n,k*2-q,0,p,q)*0.5+p*0.5+m}})}(jQuery);
+(function(a){a.effects.blind=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right"],g=a.effects.setMode(c,d.options.mode||"hide"),e=d.options.direction||"vertical";a.effects.save(c,f);c.show();var i=a.effects.createWrapper(c).css({overflow:"hidden"}),b=e=="vertical"?"height":"width";e=e=="vertical"?i.height():i.width();g=="show"&&i.css(b,0);var h={};h[b]=g=="show"?e:0;i.animate(h,d.duration,d.options.easing,function(){g=="hide"&&c.hide();a.effects.restore(c,
+f);a.effects.removeWrapper(c);d.callback&&d.callback.apply(c[0],arguments);c.dequeue()})})}})(jQuery);
+(function(a){a.effects.bounce=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right"],g=a.effects.setMode(c,d.options.mode||"effect"),e=d.options.direction||"up",i=d.options.distance||20,b=d.options.times||5,h=d.duration||250;/show|hide/.test(g)&&f.push("opacity");a.effects.save(c,f);c.show();a.effects.createWrapper(c);var j=e=="up"||e=="down"?"top":"left";e=e=="up"||e=="left"?"pos":"neg";i=d.options.distance||(j=="top"?c.outerHeight({margin:true})/3:c.outerWidth({margin:true})/
+3);if(g=="show")c.css("opacity",0).css(j,e=="pos"?-i:i);if(g=="hide")i/=b*2;g!="hide"&&b--;if(g=="show"){var l={opacity:1};l[j]=(e=="pos"?"+=":"-=")+i;c.animate(l,h/2,d.options.easing);i/=2;b--}for(l=0;l<b;l++){var o={},n={};o[j]=(e=="pos"?"-=":"+=")+i;n[j]=(e=="pos"?"+=":"-=")+i;c.animate(o,h/2,d.options.easing).animate(n,h/2,d.options.easing);i=g=="hide"?i*2:i/2}if(g=="hide"){l={opacity:0};l[j]=(e=="pos"?"-=":"+=")+i;c.animate(l,h/2,d.options.easing,function(){c.hide();a.effects.restore(c,f);a.effects.removeWrapper(c);
+d.callback&&d.callback.apply(this,arguments)})}else{o={};n={};o[j]=(e=="pos"?"-=":"+=")+i;n[j]=(e=="pos"?"+=":"-=")+i;c.animate(o,h/2,d.options.easing).animate(n,h/2,d.options.easing,function(){a.effects.restore(c,f);a.effects.removeWrapper(c);d.callback&&d.callback.apply(this,arguments)})}c.queue("fx",function(){c.dequeue()});c.dequeue()})}})(jQuery);
+(function(a){a.effects.clip=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right","height","width"],g=a.effects.setMode(c,d.options.mode||"hide"),e=d.options.direction||"vertical";a.effects.save(c,f);c.show();var i=a.effects.createWrapper(c).css({overflow:"hidden"});i=c[0].tagName=="IMG"?i:c;var b={size:e=="vertical"?"height":"width",position:e=="vertical"?"top":"left"};e=e=="vertical"?i.height():i.width();if(g=="show"){i.css(b.size,0);i.css(b.position,
+e/2)}var h={};h[b.size]=g=="show"?e:0;h[b.position]=g=="show"?0:e/2;i.animate(h,{queue:false,duration:d.duration,easing:d.options.easing,complete:function(){g=="hide"&&c.hide();a.effects.restore(c,f);a.effects.removeWrapper(c);d.callback&&d.callback.apply(c[0],arguments);c.dequeue()}})})}})(jQuery);
+(function(a){a.effects.drop=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right","opacity"],g=a.effects.setMode(c,d.options.mode||"hide"),e=d.options.direction||"left";a.effects.save(c,f);c.show();a.effects.createWrapper(c);var i=e=="up"||e=="down"?"top":"left";e=e=="up"||e=="left"?"pos":"neg";var b=d.options.distance||(i=="top"?c.outerHeight({margin:true})/2:c.outerWidth({margin:true})/2);if(g=="show")c.css("opacity",0).css(i,e=="pos"?-b:b);var h={opacity:g==
+"show"?1:0};h[i]=(g=="show"?e=="pos"?"+=":"-=":e=="pos"?"-=":"+=")+b;c.animate(h,{queue:false,duration:d.duration,easing:d.options.easing,complete:function(){g=="hide"&&c.hide();a.effects.restore(c,f);a.effects.removeWrapper(c);d.callback&&d.callback.apply(this,arguments);c.dequeue()}})})}})(jQuery);
+(function(a){a.effects.explode=function(d){return this.queue(function(){var c=d.options.pieces?Math.round(Math.sqrt(d.options.pieces)):3,f=d.options.pieces?Math.round(Math.sqrt(d.options.pieces)):3;d.options.mode=d.options.mode=="toggle"?a(this).is(":visible")?"hide":"show":d.options.mode;var g=a(this).show().css("visibility","hidden"),e=g.offset();e.top-=parseInt(g.css("marginTop"),10)||0;e.left-=parseInt(g.css("marginLeft"),10)||0;for(var i=g.outerWidth(true),b=g.outerHeight(true),h=0;h<c;h++)for(var j=
+0;j<f;j++)g.clone().appendTo("body").wrap("<div></div>").css({position:"absolute",visibility:"visible",left:-j*(i/f),top:-h*(b/c)}).parent().addClass("ui-effects-explode").css({position:"absolute",overflow:"hidden",width:i/f,height:b/c,left:e.left+j*(i/f)+(d.options.mode=="show"?(j-Math.floor(f/2))*(i/f):0),top:e.top+h*(b/c)+(d.options.mode=="show"?(h-Math.floor(c/2))*(b/c):0),opacity:d.options.mode=="show"?0:1}).animate({left:e.left+j*(i/f)+(d.options.mode=="show"?0:(j-Math.floor(f/2))*(i/f)),top:e.top+
+h*(b/c)+(d.options.mode=="show"?0:(h-Math.floor(c/2))*(b/c)),opacity:d.options.mode=="show"?1:0},d.duration||500);setTimeout(function(){d.options.mode=="show"?g.css({visibility:"visible"}):g.css({visibility:"visible"}).hide();d.callback&&d.callback.apply(g[0]);g.dequeue();a("div.ui-effects-explode").remove()},d.duration||500)})}})(jQuery);
+(function(a){a.effects.fade=function(d){return this.queue(function(){var c=a(this),f=a.effects.setMode(c,d.options.mode||"hide");c.animate({opacity:f},{queue:false,duration:d.duration,easing:d.options.easing,complete:function(){d.callback&&d.callback.apply(this,arguments);c.dequeue()}})})}})(jQuery);
+(function(a){a.effects.fold=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right"],g=a.effects.setMode(c,d.options.mode||"hide"),e=d.options.size||15,i=!!d.options.horizFirst,b=d.duration?d.duration/2:a.fx.speeds._default/2;a.effects.save(c,f);c.show();var h=a.effects.createWrapper(c).css({overflow:"hidden"}),j=g=="show"!=i,l=j?["width","height"]:["height","width"];j=j?[h.width(),h.height()]:[h.height(),h.width()];var o=/([0-9]+)%/.exec(e);if(o)e=parseInt(o[1],
+10)/100*j[g=="hide"?0:1];if(g=="show")h.css(i?{height:0,width:e}:{height:e,width:0});i={};o={};i[l[0]]=g=="show"?j[0]:e;o[l[1]]=g=="show"?j[1]:0;h.animate(i,b,d.options.easing).animate(o,b,d.options.easing,function(){g=="hide"&&c.hide();a.effects.restore(c,f);a.effects.removeWrapper(c);d.callback&&d.callback.apply(c[0],arguments);c.dequeue()})})}})(jQuery);
+(function(a){a.effects.highlight=function(d){return this.queue(function(){var c=a(this),f=["backgroundImage","backgroundColor","opacity"],g=a.effects.setMode(c,d.options.mode||"show"),e={backgroundColor:c.css("backgroundColor")};if(g=="hide")e.opacity=0;a.effects.save(c,f);c.show().css({backgroundImage:"none",backgroundColor:d.options.color||"#ffff99"}).animate(e,{queue:false,duration:d.duration,easing:d.options.easing,complete:function(){g=="hide"&&c.hide();a.effects.restore(c,f);g=="show"&&!a.support.opacity&&
+this.style.removeAttribute("filter");d.callback&&d.callback.apply(this,arguments);c.dequeue()}})})}})(jQuery);
+(function(a){a.effects.pulsate=function(d){return this.queue(function(){var c=a(this),f=a.effects.setMode(c,d.options.mode||"show");times=(d.options.times||5)*2-1;duration=d.duration?d.duration/2:a.fx.speeds._default/2;isVisible=c.is(":visible");animateTo=0;if(!isVisible){c.css("opacity",0).show();animateTo=1}if(f=="hide"&&isVisible||f=="show"&&!isVisible)times--;for(f=0;f<times;f++){c.animate({opacity:animateTo},duration,d.options.easing);animateTo=(animateTo+1)%2}c.animate({opacity:animateTo},duration,
+d.options.easing,function(){animateTo==0&&c.hide();d.callback&&d.callback.apply(this,arguments)});c.queue("fx",function(){c.dequeue()}).dequeue()})}})(jQuery);
+(function(a){a.effects.puff=function(d){return this.queue(function(){var c=a(this),f=a.effects.setMode(c,d.options.mode||"hide"),g=parseInt(d.options.percent,10)||150,e=g/100,i={height:c.height(),width:c.width()};a.extend(d.options,{fade:true,mode:f,percent:f=="hide"?g:100,from:f=="hide"?i:{height:i.height*e,width:i.width*e}});c.effect("scale",d.options,d.duration,d.callback);c.dequeue()})};a.effects.scale=function(d){return this.queue(function(){var c=a(this),f=a.extend(true,{},d.options),g=a.effects.setMode(c,
+d.options.mode||"effect"),e=parseInt(d.options.percent,10)||(parseInt(d.options.percent,10)==0?0:g=="hide"?0:100),i=d.options.direction||"both",b=d.options.origin;if(g!="effect"){f.origin=b||["middle","center"];f.restore=true}b={height:c.height(),width:c.width()};c.from=d.options.from||(g=="show"?{height:0,width:0}:b);e={y:i!="horizontal"?e/100:1,x:i!="vertical"?e/100:1};c.to={height:b.height*e.y,width:b.width*e.x};if(d.options.fade){if(g=="show"){c.from.opacity=0;c.to.opacity=1}if(g=="hide"){c.from.opacity=
+1;c.to.opacity=0}}f.from=c.from;f.to=c.to;f.mode=g;c.effect("size",f,d.duration,d.callback);c.dequeue()})};a.effects.size=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right","width","height","overflow","opacity"],g=["position","top","bottom","left","right","overflow","opacity"],e=["width","height","overflow"],i=["fontSize"],b=["borderTopWidth","borderBottomWidth","paddingTop","paddingBottom"],h=["borderLeftWidth","borderRightWidth","paddingLeft","paddingRight"],
+j=a.effects.setMode(c,d.options.mode||"effect"),l=d.options.restore||false,o=d.options.scale||"both",n=d.options.origin,k={height:c.height(),width:c.width()};c.from=d.options.from||k;c.to=d.options.to||k;if(n){n=a.effects.getBaseline(n,k);c.from.top=(k.height-c.from.height)*n.y;c.from.left=(k.width-c.from.width)*n.x;c.to.top=(k.height-c.to.height)*n.y;c.to.left=(k.width-c.to.width)*n.x}var m={from:{y:c.from.height/k.height,x:c.from.width/k.width},to:{y:c.to.height/k.height,x:c.to.width/k.width}};
+if(o=="box"||o=="both"){if(m.from.y!=m.to.y){f=f.concat(b);c.from=a.effects.setTransition(c,b,m.from.y,c.from);c.to=a.effects.setTransition(c,b,m.to.y,c.to)}if(m.from.x!=m.to.x){f=f.concat(h);c.from=a.effects.setTransition(c,h,m.from.x,c.from);c.to=a.effects.setTransition(c,h,m.to.x,c.to)}}if(o=="content"||o=="both")if(m.from.y!=m.to.y){f=f.concat(i);c.from=a.effects.setTransition(c,i,m.from.y,c.from);c.to=a.effects.setTransition(c,i,m.to.y,c.to)}a.effects.save(c,l?f:g);c.show();a.effects.createWrapper(c);
+c.css("overflow","hidden").css(c.from);if(o=="content"||o=="both"){b=b.concat(["marginTop","marginBottom"]).concat(i);h=h.concat(["marginLeft","marginRight"]);e=f.concat(b).concat(h);c.find("*[width]").each(function(){child=a(this);l&&a.effects.save(child,e);var p={height:child.height(),width:child.width()};child.from={height:p.height*m.from.y,width:p.width*m.from.x};child.to={height:p.height*m.to.y,width:p.width*m.to.x};if(m.from.y!=m.to.y){child.from=a.effects.setTransition(child,b,m.from.y,child.from);
+child.to=a.effects.setTransition(child,b,m.to.y,child.to)}if(m.from.x!=m.to.x){child.from=a.effects.setTransition(child,h,m.from.x,child.from);child.to=a.effects.setTransition(child,h,m.to.x,child.to)}child.css(child.from);child.animate(child.to,d.duration,d.options.easing,function(){l&&a.effects.restore(child,e)})})}c.animate(c.to,{queue:false,duration:d.duration,easing:d.options.easing,complete:function(){c.to.opacity===0&&c.css("opacity",c.from.opacity);j=="hide"&&c.hide();a.effects.restore(c,
+l?f:g);a.effects.removeWrapper(c);d.callback&&d.callback.apply(this,arguments);c.dequeue()}})})}})(jQuery);
+(function(a){a.effects.shake=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right"];a.effects.setMode(c,d.options.mode||"effect");var g=d.options.direction||"left",e=d.options.distance||20,i=d.options.times||3,b=d.duration||d.options.duration||140;a.effects.save(c,f);c.show();a.effects.createWrapper(c);var h=g=="up"||g=="down"?"top":"left",j=g=="up"||g=="left"?"pos":"neg";g={};var l={},o={};g[h]=(j=="pos"?"-=":"+=")+e;l[h]=(j=="pos"?"+=":"-=")+e*2;o[h]=
+(j=="pos"?"-=":"+=")+e*2;c.animate(g,b,d.options.easing);for(e=1;e<i;e++)c.animate(l,b,d.options.easing).animate(o,b,d.options.easing);c.animate(l,b,d.options.easing).animate(g,b/2,d.options.easing,function(){a.effects.restore(c,f);a.effects.removeWrapper(c);d.callback&&d.callback.apply(this,arguments)});c.queue("fx",function(){c.dequeue()});c.dequeue()})}})(jQuery);
+(function(a){a.effects.slide=function(d){return this.queue(function(){var c=a(this),f=["position","top","bottom","left","right"],g=a.effects.setMode(c,d.options.mode||"show"),e=d.options.direction||"left";a.effects.save(c,f);c.show();a.effects.createWrapper(c).css({overflow:"hidden"});var i=e=="up"||e=="down"?"top":"left";e=e=="up"||e=="left"?"pos":"neg";var b=d.options.distance||(i=="top"?c.outerHeight({margin:true}):c.outerWidth({margin:true}));if(g=="show")c.css(i,e=="pos"?isNaN(b)?"-"+b:-b:b);
+var h={};h[i]=(g=="show"?e=="pos"?"+=":"-=":e=="pos"?"-=":"+=")+b;c.animate(h,{queue:false,duration:d.duration,easing:d.options.easing,complete:function(){g=="hide"&&c.hide();a.effects.restore(c,f);a.effects.removeWrapper(c);d.callback&&d.callback.apply(this,arguments);c.dequeue()}})})}})(jQuery);
+(function(a){a.effects.transfer=function(d){return this.queue(function(){var c=a(this),f=a(d.options.to),g=f.offset();f={top:g.top,left:g.left,height:f.innerHeight(),width:f.innerWidth()};g=c.offset();var e=a('<div class="ui-effects-transfer"></div>').appendTo(document.body).addClass(d.options.className).css({top:g.top,left:g.left,height:c.innerHeight(),width:c.innerWidth(),position:"absolute"}).animate(f,d.duration,d.options.easing,function(){e.remove();d.callback&&d.callback.apply(c[0],arguments);
+c.dequeue()})})}})(jQuery);
+(function(a){a.widget("ui.accordion",{options:{active:0,animated:"slide",autoHeight:true,clearStyle:false,collapsible:false,event:"click",fillSpace:false,header:"> li > :first-child,> :not(li):even",icons:{header:"ui-icon-triangle-1-e",headerSelected:"ui-icon-triangle-1-s"},navigation:false,navigationFilter:function(){return this.href.toLowerCase()===location.href.toLowerCase()}},_create:function(){var d=this,c=d.options;d.running=0;d.element.addClass("ui-accordion ui-widget ui-helper-reset").children("li").addClass("ui-accordion-li-fix");d.headers=
+d.element.find(c.header).addClass("ui-accordion-header ui-helper-reset ui-state-default ui-corner-all").bind("mouseenter.accordion",function(){c.disabled||a(this).addClass("ui-state-hover")}).bind("mouseleave.accordion",function(){c.disabled||a(this).removeClass("ui-state-hover")}).bind("focus.accordion",function(){c.disabled||a(this).addClass("ui-state-focus")}).bind("blur.accordion",function(){c.disabled||a(this).removeClass("ui-state-focus")});d.headers.next().addClass("ui-accordion-content ui-helper-reset ui-widget-content ui-corner-bottom");
+if(c.navigation){var f=d.element.find("a").filter(c.navigationFilter).eq(0);if(f.length){var g=f.closest(".ui-accordion-header");d.active=g.length?g:f.closest(".ui-accordion-content").prev()}}d.active=d._findActive(d.active||c.active).addClass("ui-state-default ui-state-active").toggleClass("ui-corner-all").toggleClass("ui-corner-top");d.active.next().addClass("ui-accordion-content-active");d._createIcons();d.resize();d.element.attr("role","tablist");d.headers.attr("role","tab").bind("keydown.accordion",
+function(e){return d._keydown(e)}).next().attr("role","tabpanel");d.headers.not(d.active||"").attr({"aria-expanded":"false","aria-selected":"false",tabIndex:-1}).next().hide();d.active.length?d.active.attr({"aria-expanded":"true","aria-selected":"true",tabIndex:0}):d.headers.eq(0).attr("tabIndex",0);a.browser.safari||d.headers.find("a").attr("tabIndex",-1);c.event&&d.headers.bind(c.event.split(" ").join(".accordion ")+".accordion",function(e){d._clickHandler.call(d,e,this);e.preventDefault()})},_createIcons:function(){var d=
+this.options;if(d.icons){a("<span></span>").addClass("ui-icon "+d.icons.header).prependTo(this.headers);this.active.children(".ui-icon").toggleClass(d.icons.header).toggleClass(d.icons.headerSelected);this.element.addClass("ui-accordion-icons")}},_destroyIcons:function(){this.headers.children(".ui-icon").remove();this.element.removeClass("ui-accordion-icons")},destroy:function(){var d=this.options;this.element.removeClass("ui-accordion ui-widget ui-helper-reset").removeAttr("role");this.headers.unbind(".accordion").removeClass("ui-accordion-header ui-accordion-disabled ui-helper-reset ui-state-default ui-corner-all ui-state-active ui-state-disabled ui-corner-top").removeAttr("role").removeAttr("aria-expanded").removeAttr("aria-selected").removeAttr("tabIndex");
+this.headers.find("a").removeAttr("tabIndex");this._destroyIcons();var c=this.headers.next().css("display","").removeAttr("role").removeClass("ui-helper-reset ui-widget-content ui-corner-bottom ui-accordion-content ui-accordion-content-active ui-accordion-disabled ui-state-disabled");if(d.autoHeight||d.fillHeight)c.css("height","");return a.Widget.prototype.destroy.call(this)},_setOption:function(d,c){a.Widget.prototype._setOption.apply(this,arguments);d=="active"&&this.activate(c);if(d=="icons"){this._destroyIcons();
+c&&this._createIcons()}if(d=="disabled")this.headers.add(this.headers.next())[c?"addClass":"removeClass"]("ui-accordion-disabled ui-state-disabled")},_keydown:function(d){if(!(this.options.disabled||d.altKey||d.ctrlKey)){var c=a.ui.keyCode,f=this.headers.length,g=this.headers.index(d.target),e=false;switch(d.keyCode){case c.RIGHT:case c.DOWN:e=this.headers[(g+1)%f];break;case c.LEFT:case c.UP:e=this.headers[(g-1+f)%f];break;case c.SPACE:case c.ENTER:this._clickHandler({target:d.target},d.target);
+d.preventDefault()}if(e){a(d.target).attr("tabIndex",-1);a(e).attr("tabIndex",0);e.focus();return false}return true}},resize:function(){var d=this.options,c;if(d.fillSpace){if(a.browser.msie){var f=this.element.parent().css("overflow");this.element.parent().css("overflow","hidden")}c=this.element.parent().height();a.browser.msie&&this.element.parent().css("overflow",f);this.headers.each(function(){c-=a(this).outerHeight(true)});this.headers.next().each(function(){a(this).height(Math.max(0,c-a(this).innerHeight()+
+a(this).height()))}).css("overflow","auto")}else if(d.autoHeight){c=0;this.headers.next().each(function(){c=Math.max(c,a(this).height("").height())}).height(c)}return this},activate:function(d){this.options.active=d;d=this._findActive(d)[0];this._clickHandler({target:d},d);return this},_findActive:function(d){return d?typeof d==="number"?this.headers.filter(":eq("+d+")"):this.headers.not(this.headers.not(d)):d===false?a([]):this.headers.filter(":eq(0)")},_clickHandler:function(d,c){var f=this.options;
+if(!f.disabled)if(d.target){d=a(d.currentTarget||c);c=d[0]===this.active[0];f.active=f.collapsible&&c?false:this.headers.index(d);if(!(this.running||!f.collapsible&&c)){var g=this.active;h=d.next();i=this.active.next();b={options:f,newHeader:c&&f.collapsible?a([]):d,oldHeader:this.active,newContent:c&&f.collapsible?a([]):h,oldContent:i};var e=this.headers.index(this.active[0])>this.headers.index(d[0]);this.active=c?a([]):d;this._toggle(h,i,b,c,e);g.removeClass("ui-state-active ui-corner-top").addClass("ui-state-default ui-corner-all").children(".ui-icon").removeClass(f.icons.headerSelected).addClass(f.icons.header);
+if(!c){d.removeClass("ui-state-default ui-corner-all").addClass("ui-state-active ui-corner-top").children(".ui-icon").removeClass(f.icons.header).addClass(f.icons.headerSelected);d.next().addClass("ui-accordion-content-active")}}}else if(f.collapsible){this.active.removeClass("ui-state-active ui-corner-top").addClass("ui-state-default ui-corner-all").children(".ui-icon").removeClass(f.icons.headerSelected).addClass(f.icons.header);this.active.next().addClass("ui-accordion-content-active");var i=this.active.next(),
+b={options:f,newHeader:a([]),oldHeader:f.active,newContent:a([]),oldContent:i},h=this.active=a([]);this._toggle(h,i,b)}},_toggle:function(d,c,f,g,e){var i=this,b=i.options;i.toShow=d;i.toHide=c;i.data=f;var h=function(){if(i)return i._completed.apply(i,arguments)};i._trigger("changestart",null,i.data);i.running=c.size()===0?d.size():c.size();if(b.animated){f={};f=b.collapsible&&g?{toShow:a([]),toHide:c,complete:h,down:e,autoHeight:b.autoHeight||b.fillSpace}:{toShow:d,toHide:c,complete:h,down:e,autoHeight:b.autoHeight||
+b.fillSpace};if(!b.proxied)b.proxied=b.animated;if(!b.proxiedDuration)b.proxiedDuration=b.duration;b.animated=a.isFunction(b.proxied)?b.proxied(f):b.proxied;b.duration=a.isFunction(b.proxiedDuration)?b.proxiedDuration(f):b.proxiedDuration;g=a.ui.accordion.animations;var j=b.duration,l=b.animated;if(l&&!g[l]&&!a.easing[l])l="slide";g[l]||(g[l]=function(o){this.slide(o,{easing:l,duration:j||700})});g[l](f)}else{if(b.collapsible&&g)d.toggle();else{c.hide();d.show()}h(true)}c.prev().attr({"aria-expanded":"false",
+"aria-selected":"false",tabIndex:-1}).blur();d.prev().attr({"aria-expanded":"true","aria-selected":"true",tabIndex:0}).focus()},_completed:function(d){this.running=d?0:--this.running;if(!this.running){this.options.clearStyle&&this.toShow.add(this.toHide).css({height:"",overflow:""});this.toHide.removeClass("ui-accordion-content-active");if(this.toHide.length)this.toHide.parent()[0].className=this.toHide.parent()[0].className;this._trigger("change",null,this.data)}}});a.extend(a.ui.accordion,{version:"1.8.13",
+animations:{slide:function(d,c){d=a.extend({easing:"swing",duration:300},d,c);if(d.toHide.size())if(d.toShow.size()){var f=d.toShow.css("overflow"),g=0,e={},i={},b;c=d.toShow;b=c[0].style.width;c.width(parseInt(c.parent().width(),10)-parseInt(c.css("paddingLeft"),10)-parseInt(c.css("paddingRight"),10)-(parseInt(c.css("borderLeftWidth"),10)||0)-(parseInt(c.css("borderRightWidth"),10)||0));a.each(["height","paddingTop","paddingBottom"],function(h,j){i[j]="hide";h=(""+a.css(d.toShow[0],j)).match(/^([\d+-.]+)(.*)$/);
+e[j]={value:h[1],unit:h[2]||"px"}});d.toShow.css({height:0,overflow:"hidden"}).show();d.toHide.filter(":hidden").each(d.complete).end().filter(":visible").animate(i,{step:function(h,j){if(j.prop=="height")g=j.end-j.start===0?0:(j.now-j.start)/(j.end-j.start);d.toShow[0].style[j.prop]=g*e[j.prop].value+e[j.prop].unit},duration:d.duration,easing:d.easing,complete:function(){d.autoHeight||d.toShow.css("height","");d.toShow.css({width:b,overflow:f});d.complete()}})}else d.toHide.animate({height:"hide",
+paddingTop:"hide",paddingBottom:"hide"},d);else d.toShow.animate({height:"show",paddingTop:"show",paddingBottom:"show"},d)},bounceslide:function(d){this.slide(d,{easing:d.down?"easeOutBounce":"swing",duration:d.down?1E3:200})}}})})(jQuery);
+(function(a){var d=0;a.widget("ui.autocomplete",{options:{appendTo:"body",autoFocus:false,delay:300,minLength:1,position:{my:"left top",at:"left bottom",collision:"none"},source:null},pending:0,_create:function(){var c=this,f=this.element[0].ownerDocument,g;this.element.addClass("ui-autocomplete-input").attr("autocomplete","off").attr({role:"textbox","aria-autocomplete":"list","aria-haspopup":"true"}).bind("keydown.autocomplete",function(e){if(!(c.options.disabled||c.element.attr("readonly"))){g=
+false;var i=a.ui.keyCode;switch(e.keyCode){case i.PAGE_UP:c._move("previousPage",e);break;case i.PAGE_DOWN:c._move("nextPage",e);break;case i.UP:c._move("previous",e);e.preventDefault();break;case i.DOWN:c._move("next",e);e.preventDefault();break;case i.ENTER:case i.NUMPAD_ENTER:if(c.menu.active){g=true;e.preventDefault()}case i.TAB:if(!c.menu.active)return;c.menu.select(e);break;case i.ESCAPE:c.element.val(c.term);c.close(e);break;default:clearTimeout(c.searching);c.searching=setTimeout(function(){if(c.term!=
+c.element.val()){c.selectedItem=null;c.search(null,e)}},c.options.delay);break}}}).bind("keypress.autocomplete",function(e){if(g){g=false;e.preventDefault()}}).bind("focus.autocomplete",function(){if(!c.options.disabled){c.selectedItem=null;c.previous=c.element.val()}}).bind("blur.autocomplete",function(e){if(!c.options.disabled){clearTimeout(c.searching);c.closing=setTimeout(function(){c.close(e);c._change(e)},150)}});this._initSource();this.response=function(){return c._response.apply(c,arguments)};
+this.menu=a("<ul></ul>").addClass("ui-autocomplete").appendTo(a(this.options.appendTo||"body",f)[0]).mousedown(function(e){var i=c.menu.element[0];a(e.target).closest(".ui-menu-item").length||setTimeout(function(){a(document).one("mousedown",function(b){b.target!==c.element[0]&&b.target!==i&&!a.ui.contains(i,b.target)&&c.close()})},1);setTimeout(function(){clearTimeout(c.closing)},13)}).menu({focus:function(e,i){i=i.item.data("item.autocomplete");false!==c._trigger("focus",e,{item:i})&&/^key/.test(e.originalEvent.type)&&
+c.element.val(i.value)},selected:function(e,i){var b=i.item.data("item.autocomplete"),h=c.previous;if(c.element[0]!==f.activeElement){c.element.focus();c.previous=h;setTimeout(function(){c.previous=h;c.selectedItem=b},1)}false!==c._trigger("select",e,{item:b})&&c.element.val(b.value);c.term=c.element.val();c.close(e);c.selectedItem=b},blur:function(){c.menu.element.is(":visible")&&c.element.val()!==c.term&&c.element.val(c.term)}}).zIndex(this.element.zIndex()+1).css({top:0,left:0}).hide().data("menu");
+a.fn.bgiframe&&this.menu.element.bgiframe()},destroy:function(){this.element.removeClass("ui-autocomplete-input").removeAttr("autocomplete").removeAttr("role").removeAttr("aria-autocomplete").removeAttr("aria-haspopup");this.menu.element.remove();a.Widget.prototype.destroy.call(this)},_setOption:function(c,f){a.Widget.prototype._setOption.apply(this,arguments);c==="source"&&this._initSource();if(c==="appendTo")this.menu.element.appendTo(a(f||"body",this.element[0].ownerDocument)[0]);c==="disabled"&&
+f&&this.xhr&&this.xhr.abort()},_initSource:function(){var c=this,f,g;if(a.isArray(this.options.source)){f=this.options.source;this.source=function(e,i){i(a.ui.autocomplete.filter(f,e.term))}}else if(typeof this.options.source==="string"){g=this.options.source;this.source=function(e,i){c.xhr&&c.xhr.abort();c.xhr=a.ajax({url:g,data:e,dataType:"json",autocompleteRequest:++d,success:function(b){this.autocompleteRequest===d&&i(b)},error:function(){this.autocompleteRequest===d&&i([])}})}}else this.source=
+this.options.source},search:function(c,f){c=c!=null?c:this.element.val();this.term=this.element.val();if(c.length<this.options.minLength)return this.close(f);clearTimeout(this.closing);if(this._trigger("search",f)!==false)return this._search(c)},_search:function(c){this.pending++;this.element.addClass("ui-autocomplete-loading");this.source({term:c},this.response)},_response:function(c){if(!this.options.disabled&&c&&c.length){c=this._normalize(c);this._suggest(c);this._trigger("open")}else this.close();
+this.pending--;this.pending||this.element.removeClass("ui-autocomplete-loading")},close:function(c){clearTimeout(this.closing);if(this.menu.element.is(":visible")){this.menu.element.hide();this.menu.deactivate();this._trigger("close",c)}},_change:function(c){this.previous!==this.element.val()&&this._trigger("change",c,{item:this.selectedItem})},_normalize:function(c){if(c.length&&c[0].label&&c[0].value)return c;return a.map(c,function(f){if(typeof f==="string")return{label:f,value:f};return a.extend({label:f.label||
+f.value,value:f.value||f.label},f)})},_suggest:function(c){var f=this.menu.element.empty().zIndex(this.element.zIndex()+1);this._renderMenu(f,c);this.menu.deactivate();this.menu.refresh();f.show();this._resizeMenu();f.position(a.extend({of:this.element},this.options.position));this.options.autoFocus&&this.menu.next(new a.Event("mouseover"))},_resizeMenu:function(){var c=this.menu.element;c.outerWidth(Math.max(c.width("").outerWidth(),this.element.outerWidth()))},_renderMenu:function(c,f){var g=this;
+a.each(f,function(e,i){g._renderItem(c,i)})},_renderItem:function(c,f){return a("<li></li>").data("item.autocomplete",f).append(a("<a></a>").text(f.label)).appendTo(c)},_move:function(c,f){if(this.menu.element.is(":visible"))if(this.menu.first()&&/^previous/.test(c)||this.menu.last()&&/^next/.test(c)){this.element.val(this.term);this.menu.deactivate()}else this.menu[c](f);else this.search(null,f)},widget:function(){return this.menu.element}});a.extend(a.ui.autocomplete,{escapeRegex:function(c){return c.replace(/[-[\]{}()*+?.,\\^$|#\s]/g,
+"\\$&")},filter:function(c,f){var g=new RegExp(a.ui.autocomplete.escapeRegex(f),"i");return a.grep(c,function(e){return g.test(e.label||e.value||e)})}})})(jQuery);
+(function(a){a.widget("ui.menu",{_create:function(){var d=this;this.element.addClass("ui-menu ui-widget ui-widget-content ui-corner-all").attr({role:"listbox","aria-activedescendant":"ui-active-menuitem"}).click(function(c){if(a(c.target).closest(".ui-menu-item a").length){c.preventDefault();d.select(c)}});this.refresh()},refresh:function(){var d=this;this.element.children("li:not(.ui-menu-item):has(a)").addClass("ui-menu-item").attr("role","menuitem").children("a").addClass("ui-corner-all").attr("tabindex",
+-1).mouseenter(function(c){d.activate(c,a(this).parent())}).mouseleave(function(){d.deactivate()})},activate:function(d,c){this.deactivate();if(this.hasScroll()){var f=c.offset().top-this.element.offset().top,g=this.element.scrollTop(),e=this.element.height();if(f<0)this.element.scrollTop(g+f);else f>=e&&this.element.scrollTop(g+f-e+c.height())}this.active=c.eq(0).children("a").addClass("ui-state-hover").attr("id","ui-active-menuitem").end();this._trigger("focus",d,{item:c})},deactivate:function(){if(this.active){this.active.children("a").removeClass("ui-state-hover").removeAttr("id");
+this._trigger("blur");this.active=null}},next:function(d){this.move("next",".ui-menu-item:first",d)},previous:function(d){this.move("prev",".ui-menu-item:last",d)},first:function(){return this.active&&!this.active.prevAll(".ui-menu-item").length},last:function(){return this.active&&!this.active.nextAll(".ui-menu-item").length},move:function(d,c,f){if(this.active){d=this.active[d+"All"](".ui-menu-item").eq(0);d.length?this.activate(f,d):this.activate(f,this.element.children(c))}else this.activate(f,
+this.element.children(c))},nextPage:function(d){if(this.hasScroll())if(!this.active||this.last())this.activate(d,this.element.children(".ui-menu-item:first"));else{var c=this.active.offset().top,f=this.element.height(),g=this.element.children(".ui-menu-item").filter(function(){var e=a(this).offset().top-c-f+a(this).height();return e<10&&e>-10});g.length||(g=this.element.children(".ui-menu-item:last"));this.activate(d,g)}else this.activate(d,this.element.children(".ui-menu-item").filter(!this.active||
+this.last()?":first":":last"))},previousPage:function(d){if(this.hasScroll())if(!this.active||this.first())this.activate(d,this.element.children(".ui-menu-item:last"));else{var c=this.active.offset().top,f=this.element.height();result=this.element.children(".ui-menu-item").filter(function(){var g=a(this).offset().top-c+f-a(this).height();return g<10&&g>-10});result.length||(result=this.element.children(".ui-menu-item:first"));this.activate(d,result)}else this.activate(d,this.element.children(".ui-menu-item").filter(!this.active||
+this.first()?":last":":first"))},hasScroll:function(){return this.element.height()<this.element[a.fn.prop?"prop":"attr"]("scrollHeight")},select:function(d){this._trigger("selected",d,{item:this.active})}})})(jQuery);
+(function(a){var d,c=function(g){a(":ui-button",g.target.form).each(function(){var e=a(this).data("button");setTimeout(function(){e.refresh()},1)})},f=function(g){var e=g.name,i=g.form,b=a([]);if(e)b=i?a(i).find("[name='"+e+"']"):a("[name='"+e+"']",g.ownerDocument).filter(function(){return!this.form});return b};a.widget("ui.button",{options:{disabled:null,text:true,label:null,icons:{primary:null,secondary:null}},_create:function(){this.element.closest("form").unbind("reset.button").bind("reset.button",
+c);if(typeof this.options.disabled!=="boolean")this.options.disabled=this.element.attr("disabled");this._determineButtonType();this.hasTitle=!!this.buttonElement.attr("title");var g=this,e=this.options,i=this.type==="checkbox"||this.type==="radio",b="ui-state-hover"+(!i?" ui-state-active":"");if(e.label===null)e.label=this.buttonElement.html();if(this.element.is(":disabled"))e.disabled=true;this.buttonElement.addClass("ui-button ui-widget ui-state-default ui-corner-all").attr("role","button").bind("mouseenter.button",
+function(){if(!e.disabled){a(this).addClass("ui-state-hover");this===d&&a(this).addClass("ui-state-active")}}).bind("mouseleave.button",function(){e.disabled||a(this).removeClass(b)}).bind("focus.button",function(){a(this).addClass("ui-state-focus")}).bind("blur.button",function(){a(this).removeClass("ui-state-focus")}).bind("click.button",function(h){e.disabled&&h.stopImmediatePropagation()});i&&this.element.bind("change.button",function(){g.refresh()});if(this.type==="checkbox")this.buttonElement.bind("click.button",
+function(){if(e.disabled)return false;a(this).toggleClass("ui-state-active");g.buttonElement.attr("aria-pressed",g.element[0].checked)});else if(this.type==="radio")this.buttonElement.bind("click.button",function(){if(e.disabled)return false;a(this).addClass("ui-state-active");g.buttonElement.attr("aria-pressed",true);var h=g.element[0];f(h).not(h).map(function(){return a(this).button("widget")[0]}).removeClass("ui-state-active").attr("aria-pressed",false)});else{this.buttonElement.bind("mousedown.button",
+function(){if(e.disabled)return false;a(this).addClass("ui-state-active");d=this;a(document).one("mouseup",function(){d=null})}).bind("mouseup.button",function(){if(e.disabled)return false;a(this).removeClass("ui-state-active")}).bind("keydown.button",function(h){if(e.disabled)return false;if(h.keyCode==a.ui.keyCode.SPACE||h.keyCode==a.ui.keyCode.ENTER)a(this).addClass("ui-state-active")}).bind("keyup.button",function(){a(this).removeClass("ui-state-active")});this.buttonElement.is("a")&&this.buttonElement.keyup(function(h){h.keyCode===
+a.ui.keyCode.SPACE&&a(this).click()})}this._setOption("disabled",e.disabled)},_determineButtonType:function(){this.type=this.element.is(":checkbox")?"checkbox":this.element.is(":radio")?"radio":this.element.is("input")?"input":"button";if(this.type==="checkbox"||this.type==="radio"){var g=this.element.parents().filter(":last"),e="label[for="+this.element.attr("id")+"]";this.buttonElement=g.find(e);if(!this.buttonElement.length){g=g.length?g.siblings():this.element.siblings();this.buttonElement=g.filter(e);
+if(!this.buttonElement.length)this.buttonElement=g.find(e)}this.element.addClass("ui-helper-hidden-accessible");(g=this.element.is(":checked"))&&this.buttonElement.addClass("ui-state-active");this.buttonElement.attr("aria-pressed",g)}else this.buttonElement=this.element},widget:function(){return this.buttonElement},destroy:function(){this.element.removeClass("ui-helper-hidden-accessible");this.buttonElement.removeClass("ui-button ui-widget ui-state-default ui-corner-all ui-state-hover ui-state-active  ui-button-icons-only ui-button-icon-only ui-button-text-icons ui-button-text-icon-primary ui-button-text-icon-secondary ui-button-text-only").removeAttr("role").removeAttr("aria-pressed").html(this.buttonElement.find(".ui-button-text").html());
+this.hasTitle||this.buttonElement.removeAttr("title");a.Widget.prototype.destroy.call(this)},_setOption:function(g,e){a.Widget.prototype._setOption.apply(this,arguments);if(g==="disabled")e?this.element.attr("disabled",true):this.element.removeAttr("disabled");this._resetButton()},refresh:function(){var g=this.element.is(":disabled");g!==this.options.disabled&&this._setOption("disabled",g);if(this.type==="radio")f(this.element[0]).each(function(){a(this).is(":checked")?a(this).button("widget").addClass("ui-state-active").attr("aria-pressed",
+true):a(this).button("widget").removeClass("ui-state-active").attr("aria-pressed",false)});else if(this.type==="checkbox")this.element.is(":checked")?this.buttonElement.addClass("ui-state-active").attr("aria-pressed",true):this.buttonElement.removeClass("ui-state-active").attr("aria-pressed",false)},_resetButton:function(){if(this.type==="input")this.options.label&&this.element.val(this.options.label);else{var g=this.buttonElement.removeClass("ui-button-icons-only ui-button-icon-only ui-button-text-icons ui-button-text-icon-primary ui-button-text-icon-secondary ui-button-text-only"),
+e=a("<span></span>").addClass("ui-button-text").html(this.options.label).appendTo(g.empty()).text(),i=this.options.icons,b=i.primary&&i.secondary,h=[];if(i.primary||i.secondary){if(this.options.text)h.push("ui-button-text-icon"+(b?"s":i.primary?"-primary":"-secondary"));i.primary&&g.prepend("<span class='ui-button-icon-primary ui-icon "+i.primary+"'></span>");i.secondary&&g.append("<span class='ui-button-icon-secondary ui-icon "+i.secondary+"'></span>");if(!this.options.text){h.push(b?"ui-button-icons-only":
+"ui-button-icon-only");this.hasTitle||g.attr("title",e)}}else h.push("ui-button-text-only");g.addClass(h.join(" "))}}});a.widget("ui.buttonset",{options:{items:":button, :submit, :reset, :checkbox, :radio, a, :data(button)"},_create:function(){this.element.addClass("ui-buttonset")},_init:function(){this.refresh()},_setOption:function(g,e){g==="disabled"&&this.buttons.button("option",g,e);a.Widget.prototype._setOption.apply(this,arguments)},refresh:function(){this.buttons=this.element.find(this.options.items).filter(":ui-button").button("refresh").end().not(":ui-button").button().end().map(function(){return a(this).button("widget")[0]}).removeClass("ui-corner-all ui-corner-left ui-corner-right").filter(":first").addClass("ui-corner-left").end().filter(":last").addClass("ui-corner-right").end().end()},
+destroy:function(){this.element.removeClass("ui-buttonset");this.buttons.map(function(){return a(this).button("widget")[0]}).removeClass("ui-corner-left ui-corner-right").end().button("destroy");a.Widget.prototype.destroy.call(this)}})})(jQuery);
+(function(a,d){function c(){this.debug=false;this._curInst=null;this._keyEvent=false;this._disabledInputs=[];this._inDialog=this._datepickerShowing=false;this._mainDivId="ui-datepicker-div";this._inlineClass="ui-datepicker-inline";this._appendClass="ui-datepicker-append";this._triggerClass="ui-datepicker-trigger";this._dialogClass="ui-datepicker-dialog";this._disableClass="ui-datepicker-disabled";this._unselectableClass="ui-datepicker-unselectable";this._currentClass="ui-datepicker-current-day";this._dayOverClass=
+"ui-datepicker-days-cell-over";this.regional=[];this.regional[""]={closeText:"Done",prevText:"Prev",nextText:"Next",currentText:"Today",monthNames:["January","February","March","April","May","June","July","August","September","October","November","December"],monthNamesShort:["Jan","Feb","Mar","Apr","May","Jun","Jul","Aug","Sep","Oct","Nov","Dec"],dayNames:["Sunday","Monday","Tuesday","Wednesday","Thursday","Friday","Saturday"],dayNamesShort:["Sun","Mon","Tue","Wed","Thu","Fri","Sat"],dayNamesMin:["Su",
+"Mo","Tu","We","Th","Fr","Sa"],weekHeader:"Wk",dateFormat:"mm/dd/yy",firstDay:0,isRTL:false,showMonthAfterYear:false,yearSuffix:""};this._defaults={showOn:"focus",showAnim:"fadeIn",showOptions:{},defaultDate:null,appendText:"",buttonText:"...",buttonImage:"",buttonImageOnly:false,hideIfNoPrevNext:false,navigationAsDateFormat:false,gotoCurrent:false,changeMonth:false,changeYear:false,yearRange:"c-10:c+10",showOtherMonths:false,selectOtherMonths:false,showWeek:false,calculateWeek:this.iso8601Week,shortYearCutoff:"+10",
+minDate:null,maxDate:null,duration:"fast",beforeShowDay:null,beforeShow:null,onSelect:null,onChangeMonthYear:null,onClose:null,numberOfMonths:1,showCurrentAtPos:0,stepMonths:1,stepBigMonths:12,altField:"",altFormat:"",constrainInput:true,showButtonPanel:false,autoSize:false};a.extend(this._defaults,this.regional[""]);this.dpDiv=f(a('<div id="'+this._mainDivId+'" class="ui-datepicker ui-widget ui-widget-content ui-helper-clearfix ui-corner-all"></div>'))}function f(b){return b.delegate("button, .ui-datepicker-prev, .ui-datepicker-next, .ui-datepicker-calendar td a",
+"mouseout",function(){a(this).removeClass("ui-state-hover");this.className.indexOf("ui-datepicker-prev")!=-1&&a(this).removeClass("ui-datepicker-prev-hover");this.className.indexOf("ui-datepicker-next")!=-1&&a(this).removeClass("ui-datepicker-next-hover")}).delegate("button, .ui-datepicker-prev, .ui-datepicker-next, .ui-datepicker-calendar td a","mouseover",function(){if(!a.datepicker._isDisabledDatepicker(i.inline?b.parent()[0]:i.input[0])){a(this).parents(".ui-datepicker-calendar").find("a").removeClass("ui-state-hover");
+a(this).addClass("ui-state-hover");this.className.indexOf("ui-datepicker-prev")!=-1&&a(this).addClass("ui-datepicker-prev-hover");this.className.indexOf("ui-datepicker-next")!=-1&&a(this).addClass("ui-datepicker-next-hover")}})}function g(b,h){a.extend(b,h);for(var j in h)if(h[j]==null||h[j]==d)b[j]=h[j];return b}a.extend(a.ui,{datepicker:{version:"1.8.13"}});var e=(new Date).getTime(),i;a.extend(c.prototype,{markerClassName:"hasDatepicker",log:function(){this.debug&&console.log.apply("",arguments)},
+_widgetDatepicker:function(){return this.dpDiv},setDefaults:function(b){g(this._defaults,b||{});return this},_attachDatepicker:function(b,h){var j=null;for(var l in this._defaults){var o=b.getAttribute("date:"+l);if(o){j=j||{};try{j[l]=eval(o)}catch(n){j[l]=o}}}l=b.nodeName.toLowerCase();o=l=="div"||l=="span";if(!b.id){this.uuid+=1;b.id="dp"+this.uuid}var k=this._newInst(a(b),o);k.settings=a.extend({},h||{},j||{});if(l=="input")this._connectDatepicker(b,k);else o&&this._inlineDatepicker(b,k)},_newInst:function(b,
+h){return{id:b[0].id.replace(/([^A-Za-z0-9_-])/g,"\\\\$1"),input:b,selectedDay:0,selectedMonth:0,selectedYear:0,drawMonth:0,drawYear:0,inline:h,dpDiv:!h?this.dpDiv:f(a('<div class="'+this._inlineClass+' ui-datepicker ui-widget ui-widget-content ui-helper-clearfix ui-corner-all"></div>'))}},_connectDatepicker:function(b,h){var j=a(b);h.append=a([]);h.trigger=a([]);if(!j.hasClass(this.markerClassName)){this._attachments(j,h);j.addClass(this.markerClassName).keydown(this._doKeyDown).keypress(this._doKeyPress).keyup(this._doKeyUp).bind("setData.datepicker",
+function(l,o,n){h.settings[o]=n}).bind("getData.datepicker",function(l,o){return this._get(h,o)});this._autoSize(h);a.data(b,"datepicker",h)}},_attachments:function(b,h){var j=this._get(h,"appendText"),l=this._get(h,"isRTL");h.append&&h.append.remove();if(j){h.append=a('<span class="'+this._appendClass+'">'+j+"</span>");b[l?"before":"after"](h.append)}b.unbind("focus",this._showDatepicker);h.trigger&&h.trigger.remove();j=this._get(h,"showOn");if(j=="focus"||j=="both")b.focus(this._showDatepicker);
+if(j=="button"||j=="both"){j=this._get(h,"buttonText");var o=this._get(h,"buttonImage");h.trigger=a(this._get(h,"buttonImageOnly")?a("<img/>").addClass(this._triggerClass).attr({src:o,alt:j,title:j}):a('<button type="button"></button>').addClass(this._triggerClass).html(o==""?j:a("<img/>").attr({src:o,alt:j,title:j})));b[l?"before":"after"](h.trigger);h.trigger.click(function(){a.datepicker._datepickerShowing&&a.datepicker._lastInput==b[0]?a.datepicker._hideDatepicker():a.datepicker._showDatepicker(b[0]);
+return false})}},_autoSize:function(b){if(this._get(b,"autoSize")&&!b.inline){var h=new Date(2009,11,20),j=this._get(b,"dateFormat");if(j.match(/[DM]/)){var l=function(o){for(var n=0,k=0,m=0;m<o.length;m++)if(o[m].length>n){n=o[m].length;k=m}return k};h.setMonth(l(this._get(b,j.match(/MM/)?"monthNames":"monthNamesShort")));h.setDate(l(this._get(b,j.match(/DD/)?"dayNames":"dayNamesShort"))+20-h.getDay())}b.input.attr("size",this._formatDate(b,h).length)}},_inlineDatepicker:function(b,h){var j=a(b);
+if(!j.hasClass(this.markerClassName)){j.addClass(this.markerClassName).append(h.dpDiv).bind("setData.datepicker",function(l,o,n){h.settings[o]=n}).bind("getData.datepicker",function(l,o){return this._get(h,o)});a.data(b,"datepicker",h);this._setDate(h,this._getDefaultDate(h),true);this._updateDatepicker(h);this._updateAlternate(h);h.dpDiv.show()}},_dialogDatepicker:function(b,h,j,l,o){b=this._dialogInst;if(!b){this.uuid+=1;this._dialogInput=a('<input type="text" id="'+("dp"+this.uuid)+'" style="position: absolute; top: -100px; width: 0px; z-index: -10;"/>');
+this._dialogInput.keydown(this._doKeyDown);a("body").append(this._dialogInput);b=this._dialogInst=this._newInst(this._dialogInput,false);b.settings={};a.data(this._dialogInput[0],"datepicker",b)}g(b.settings,l||{});h=h&&h.constructor==Date?this._formatDate(b,h):h;this._dialogInput.val(h);this._pos=o?o.length?o:[o.pageX,o.pageY]:null;if(!this._pos)this._pos=[document.documentElement.clientWidth/2-100+(document.documentElement.scrollLeft||document.body.scrollLeft),document.documentElement.clientHeight/
+2-150+(document.documentElement.scrollTop||document.body.scrollTop)];this._dialogInput.css("left",this._pos[0]+20+"px").css("top",this._pos[1]+"px");b.settings.onSelect=j;this._inDialog=true;this.dpDiv.addClass(this._dialogClass);this._showDatepicker(this._dialogInput[0]);a.blockUI&&a.blockUI(this.dpDiv);a.data(this._dialogInput[0],"datepicker",b);return this},_destroyDatepicker:function(b){var h=a(b),j=a.data(b,"datepicker");if(h.hasClass(this.markerClassName)){var l=b.nodeName.toLowerCase();a.removeData(b,
+"datepicker");if(l=="input"){j.append.remove();j.trigger.remove();h.removeClass(this.markerClassName).unbind("focus",this._showDatepicker).unbind("keydown",this._doKeyDown).unbind("keypress",this._doKeyPress).unbind("keyup",this._doKeyUp)}else if(l=="div"||l=="span")h.removeClass(this.markerClassName).empty()}},_enableDatepicker:function(b){var h=a(b),j=a.data(b,"datepicker");if(h.hasClass(this.markerClassName)){var l=b.nodeName.toLowerCase();if(l=="input"){b.disabled=false;j.trigger.filter("button").each(function(){this.disabled=
+false}).end().filter("img").css({opacity:"1.0",cursor:""})}else if(l=="div"||l=="span"){h=h.children("."+this._inlineClass);h.children().removeClass("ui-state-disabled");h.find("select.ui-datepicker-month, select.ui-datepicker-year").removeAttr("disabled")}this._disabledInputs=a.map(this._disabledInputs,function(o){return o==b?null:o})}},_disableDatepicker:function(b){var h=a(b),j=a.data(b,"datepicker");if(h.hasClass(this.markerClassName)){var l=b.nodeName.toLowerCase();if(l=="input"){b.disabled=
+true;j.trigger.filter("button").each(function(){this.disabled=true}).end().filter("img").css({opacity:"0.5",cursor:"default"})}else if(l=="div"||l=="span"){h=h.children("."+this._inlineClass);h.children().addClass("ui-state-disabled");h.find("select.ui-datepicker-month, select.ui-datepicker-year").attr("disabled","disabled")}this._disabledInputs=a.map(this._disabledInputs,function(o){return o==b?null:o});this._disabledInputs[this._disabledInputs.length]=b}},_isDisabledDatepicker:function(b){if(!b)return false;
+for(var h=0;h<this._disabledInputs.length;h++)if(this._disabledInputs[h]==b)return true;return false},_getInst:function(b){try{return a.data(b,"datepicker")}catch(h){throw"Missing instance data for this datepicker";}},_optionDatepicker:function(b,h,j){var l=this._getInst(b);if(arguments.length==2&&typeof h=="string")return h=="defaults"?a.extend({},a.datepicker._defaults):l?h=="all"?a.extend({},l.settings):this._get(l,h):null;var o=h||{};if(typeof h=="string"){o={};o[h]=j}if(l){this._curInst==l&&
+this._hideDatepicker();var n=this._getDateDatepicker(b,true),k=this._getMinMaxDate(l,"min"),m=this._getMinMaxDate(l,"max");g(l.settings,o);if(k!==null&&o.dateFormat!==d&&o.minDate===d)l.settings.minDate=this._formatDate(l,k);if(m!==null&&o.dateFormat!==d&&o.maxDate===d)l.settings.maxDate=this._formatDate(l,m);this._attachments(a(b),l);this._autoSize(l);this._setDate(l,n);this._updateAlternate(l);this._updateDatepicker(l)}},_changeDatepicker:function(b,h,j){this._optionDatepicker(b,h,j)},_refreshDatepicker:function(b){(b=
+this._getInst(b))&&this._updateDatepicker(b)},_setDateDatepicker:function(b,h){if(b=this._getInst(b)){this._setDate(b,h);this._updateDatepicker(b);this._updateAlternate(b)}},_getDateDatepicker:function(b,h){(b=this._getInst(b))&&!b.inline&&this._setDateFromField(b,h);return b?this._getDate(b):null},_doKeyDown:function(b){var h=a.datepicker._getInst(b.target),j=true,l=h.dpDiv.is(".ui-datepicker-rtl");h._keyEvent=true;if(a.datepicker._datepickerShowing)switch(b.keyCode){case 9:a.datepicker._hideDatepicker();
+j=false;break;case 13:j=a("td."+a.datepicker._dayOverClass+":not(."+a.datepicker._currentClass+")",h.dpDiv);j[0]?a.datepicker._selectDay(b.target,h.selectedMonth,h.selectedYear,j[0]):a.datepicker._hideDatepicker();return false;case 27:a.datepicker._hideDatepicker();break;case 33:a.datepicker._adjustDate(b.target,b.ctrlKey?-a.datepicker._get(h,"stepBigMonths"):-a.datepicker._get(h,"stepMonths"),"M");break;case 34:a.datepicker._adjustDate(b.target,b.ctrlKey?+a.datepicker._get(h,"stepBigMonths"):+a.datepicker._get(h,
+"stepMonths"),"M");break;case 35:if(b.ctrlKey||b.metaKey)a.datepicker._clearDate(b.target);j=b.ctrlKey||b.metaKey;break;case 36:if(b.ctrlKey||b.metaKey)a.datepicker._gotoToday(b.target);j=b.ctrlKey||b.metaKey;break;case 37:if(b.ctrlKey||b.metaKey)a.datepicker._adjustDate(b.target,l?+1:-1,"D");j=b.ctrlKey||b.metaKey;if(b.originalEvent.altKey)a.datepicker._adjustDate(b.target,b.ctrlKey?-a.datepicker._get(h,"stepBigMonths"):-a.datepicker._get(h,"stepMonths"),"M");break;case 38:if(b.ctrlKey||b.metaKey)a.datepicker._adjustDate(b.target,
+-7,"D");j=b.ctrlKey||b.metaKey;break;case 39:if(b.ctrlKey||b.metaKey)a.datepicker._adjustDate(b.target,l?-1:+1,"D");j=b.ctrlKey||b.metaKey;if(b.originalEvent.altKey)a.datepicker._adjustDate(b.target,b.ctrlKey?+a.datepicker._get(h,"stepBigMonths"):+a.datepicker._get(h,"stepMonths"),"M");break;case 40:if(b.ctrlKey||b.metaKey)a.datepicker._adjustDate(b.target,+7,"D");j=b.ctrlKey||b.metaKey;break;default:j=false}else if(b.keyCode==36&&b.ctrlKey)a.datepicker._showDatepicker(this);else j=false;if(j){b.preventDefault();
+b.stopPropagation()}},_doKeyPress:function(b){var h=a.datepicker._getInst(b.target);if(a.datepicker._get(h,"constrainInput")){h=a.datepicker._possibleChars(a.datepicker._get(h,"dateFormat"));var j=String.fromCharCode(b.charCode==d?b.keyCode:b.charCode);return b.ctrlKey||b.metaKey||j<" "||!h||h.indexOf(j)>-1}},_doKeyUp:function(b){b=a.datepicker._getInst(b.target);if(b.input.val()!=b.lastVal)try{if(a.datepicker.parseDate(a.datepicker._get(b,"dateFormat"),b.input?b.input.val():null,a.datepicker._getFormatConfig(b))){a.datepicker._setDateFromField(b);
+a.datepicker._updateAlternate(b);a.datepicker._updateDatepicker(b)}}catch(h){a.datepicker.log(h)}return true},_showDatepicker:function(b){b=b.target||b;if(b.nodeName.toLowerCase()!="input")b=a("input",b.parentNode)[0];if(!(a.datepicker._isDisabledDatepicker(b)||a.datepicker._lastInput==b)){var h=a.datepicker._getInst(b);a.datepicker._curInst&&a.datepicker._curInst!=h&&a.datepicker._curInst.dpDiv.stop(true,true);var j=a.datepicker._get(h,"beforeShow");g(h.settings,j?j.apply(b,[b,h]):{});h.lastVal=
+null;a.datepicker._lastInput=b;a.datepicker._setDateFromField(h);if(a.datepicker._inDialog)b.value="";if(!a.datepicker._pos){a.datepicker._pos=a.datepicker._findPos(b);a.datepicker._pos[1]+=b.offsetHeight}var l=false;a(b).parents().each(function(){l|=a(this).css("position")=="fixed";return!l});if(l&&a.browser.opera){a.datepicker._pos[0]-=document.documentElement.scrollLeft;a.datepicker._pos[1]-=document.documentElement.scrollTop}j={left:a.datepicker._pos[0],top:a.datepicker._pos[1]};a.datepicker._pos=
+null;h.dpDiv.empty();h.dpDiv.css({position:"absolute",display:"block",top:"-1000px"});a.datepicker._updateDatepicker(h);j=a.datepicker._checkOffset(h,j,l);h.dpDiv.css({position:a.datepicker._inDialog&&a.blockUI?"static":l?"fixed":"absolute",display:"none",left:j.left+"px",top:j.top+"px"});if(!h.inline){j=a.datepicker._get(h,"showAnim");var o=a.datepicker._get(h,"duration"),n=function(){var k=h.dpDiv.find("iframe.ui-datepicker-cover");if(k.length){var m=a.datepicker._getBorders(h.dpDiv);k.css({left:-m[0],
+top:-m[1],width:h.dpDiv.outerWidth(),height:h.dpDiv.outerHeight()})}};h.dpDiv.zIndex(a(b).zIndex()+1);a.datepicker._datepickerShowing=true;a.effects&&a.effects[j]?h.dpDiv.show(j,a.datepicker._get(h,"showOptions"),o,n):h.dpDiv[j||"show"](j?o:null,n);if(!j||!o)n();h.input.is(":visible")&&!h.input.is(":disabled")&&h.input.focus();a.datepicker._curInst=h}}},_updateDatepicker:function(b){var h=a.datepicker._getBorders(b.dpDiv);i=b;b.dpDiv.empty().append(this._generateHTML(b));var j=b.dpDiv.find("iframe.ui-datepicker-cover");
+j.length&&j.css({left:-h[0],top:-h[1],width:b.dpDiv.outerWidth(),height:b.dpDiv.outerHeight()});b.dpDiv.find("."+this._dayOverClass+" a").mouseover();h=this._getNumberOfMonths(b);j=h[1];b.dpDiv.removeClass("ui-datepicker-multi-2 ui-datepicker-multi-3 ui-datepicker-multi-4").width("");j>1&&b.dpDiv.addClass("ui-datepicker-multi-"+j).css("width",17*j+"em");b.dpDiv[(h[0]!=1||h[1]!=1?"add":"remove")+"Class"]("ui-datepicker-multi");b.dpDiv[(this._get(b,"isRTL")?"add":"remove")+"Class"]("ui-datepicker-rtl");
+b==a.datepicker._curInst&&a.datepicker._datepickerShowing&&b.input&&b.input.is(":visible")&&!b.input.is(":disabled")&&b.input[0]!=document.activeElement&&b.input.focus();if(b.yearshtml){var l=b.yearshtml;setTimeout(function(){l===b.yearshtml&&b.yearshtml&&b.dpDiv.find("select.ui-datepicker-year:first").replaceWith(b.yearshtml);l=b.yearshtml=null},0)}},_getBorders:function(b){var h=function(j){return{thin:1,medium:2,thick:3}[j]||j};return[parseFloat(h(b.css("border-left-width"))),parseFloat(h(b.css("border-top-width")))]},
+_checkOffset:function(b,h,j){var l=b.dpDiv.outerWidth(),o=b.dpDiv.outerHeight(),n=b.input?b.input.outerWidth():0,k=b.input?b.input.outerHeight():0,m=document.documentElement.clientWidth+a(document).scrollLeft(),p=document.documentElement.clientHeight+a(document).scrollTop();h.left-=this._get(b,"isRTL")?l-n:0;h.left-=j&&h.left==b.input.offset().left?a(document).scrollLeft():0;h.top-=j&&h.top==b.input.offset().top+k?a(document).scrollTop():0;h.left-=Math.min(h.left,h.left+l>m&&m>l?Math.abs(h.left+l-
+m):0);h.top-=Math.min(h.top,h.top+o>p&&p>o?Math.abs(o+k):0);return h},_findPos:function(b){for(var h=this._get(this._getInst(b),"isRTL");b&&(b.type=="hidden"||b.nodeType!=1||a.expr.filters.hidden(b));)b=b[h?"previousSibling":"nextSibling"];b=a(b).offset();return[b.left,b.top]},_hideDatepicker:function(b){var h=this._curInst;if(!(!h||b&&h!=a.data(b,"datepicker")))if(this._datepickerShowing){b=this._get(h,"showAnim");var j=this._get(h,"duration"),l=function(){a.datepicker._tidyDialog(h);this._curInst=
+null};a.effects&&a.effects[b]?h.dpDiv.hide(b,a.datepicker._get(h,"showOptions"),j,l):h.dpDiv[b=="slideDown"?"slideUp":b=="fadeIn"?"fadeOut":"hide"](b?j:null,l);b||l();if(b=this._get(h,"onClose"))b.apply(h.input?h.input[0]:null,[h.input?h.input.val():"",h]);this._datepickerShowing=false;this._lastInput=null;if(this._inDialog){this._dialogInput.css({position:"absolute",left:"0",top:"-100px"});if(a.blockUI){a.unblockUI();a("body").append(this.dpDiv)}}this._inDialog=false}},_tidyDialog:function(b){b.dpDiv.removeClass(this._dialogClass).unbind(".ui-datepicker-calendar")},
+_checkExternalClick:function(b){if(a.datepicker._curInst){b=a(b.target);b[0].id!=a.datepicker._mainDivId&&b.parents("#"+a.datepicker._mainDivId).length==0&&!b.hasClass(a.datepicker.markerClassName)&&!b.hasClass(a.datepicker._triggerClass)&&a.datepicker._datepickerShowing&&!(a.datepicker._inDialog&&a.blockUI)&&a.datepicker._hideDatepicker()}},_adjustDate:function(b,h,j){b=a(b);var l=this._getInst(b[0]);if(!this._isDisabledDatepicker(b[0])){this._adjustInstDate(l,h+(j=="M"?this._get(l,"showCurrentAtPos"):
+0),j);this._updateDatepicker(l)}},_gotoToday:function(b){b=a(b);var h=this._getInst(b[0]);if(this._get(h,"gotoCurrent")&&h.currentDay){h.selectedDay=h.currentDay;h.drawMonth=h.selectedMonth=h.currentMonth;h.drawYear=h.selectedYear=h.currentYear}else{var j=new Date;h.selectedDay=j.getDate();h.drawMonth=h.selectedMonth=j.getMonth();h.drawYear=h.selectedYear=j.getFullYear()}this._notifyChange(h);this._adjustDate(b)},_selectMonthYear:function(b,h,j){b=a(b);var l=this._getInst(b[0]);l._selectingMonthYear=
+false;l["selected"+(j=="M"?"Month":"Year")]=l["draw"+(j=="M"?"Month":"Year")]=parseInt(h.options[h.selectedIndex].value,10);this._notifyChange(l);this._adjustDate(b)},_clickMonthYear:function(b){var h=this._getInst(a(b)[0]);h.input&&h._selectingMonthYear&&setTimeout(function(){h.input.focus()},0);h._selectingMonthYear=!h._selectingMonthYear},_selectDay:function(b,h,j,l){var o=a(b);if(!(a(l).hasClass(this._unselectableClass)||this._isDisabledDatepicker(o[0]))){o=this._getInst(o[0]);o.selectedDay=o.currentDay=
+a("a",l).html();o.selectedMonth=o.currentMonth=h;o.selectedYear=o.currentYear=j;this._selectDate(b,this._formatDate(o,o.currentDay,o.currentMonth,o.currentYear))}},_clearDate:function(b){b=a(b);this._getInst(b[0]);this._selectDate(b,"")},_selectDate:function(b,h){b=this._getInst(a(b)[0]);h=h!=null?h:this._formatDate(b);b.input&&b.input.val(h);this._updateAlternate(b);var j=this._get(b,"onSelect");if(j)j.apply(b.input?b.input[0]:null,[h,b]);else b.input&&b.input.trigger("change");if(b.inline)this._updateDatepicker(b);
+else{this._hideDatepicker();this._lastInput=b.input[0];typeof b.input[0]!="object"&&b.input.focus();this._lastInput=null}},_updateAlternate:function(b){var h=this._get(b,"altField");if(h){var j=this._get(b,"altFormat")||this._get(b,"dateFormat"),l=this._getDate(b),o=this.formatDate(j,l,this._getFormatConfig(b));a(h).each(function(){a(this).val(o)})}},noWeekends:function(b){b=b.getDay();return[b>0&&b<6,""]},iso8601Week:function(b){b=new Date(b.getTime());b.setDate(b.getDate()+4-(b.getDay()||7));var h=
+b.getTime();b.setMonth(0);b.setDate(1);return Math.floor(Math.round((h-b)/864E5)/7)+1},parseDate:function(b,h,j){if(b==null||h==null)throw"Invalid arguments";h=typeof h=="object"?h.toString():h+"";if(h=="")return null;var l=(j?j.shortYearCutoff:null)||this._defaults.shortYearCutoff;l=typeof l!="string"?l:(new Date).getFullYear()%100+parseInt(l,10);for(var o=(j?j.dayNamesShort:null)||this._defaults.dayNamesShort,n=(j?j.dayNames:null)||this._defaults.dayNames,k=(j?j.monthNamesShort:null)||this._defaults.monthNamesShort,
+m=(j?j.monthNames:null)||this._defaults.monthNames,p=j=-1,q=-1,s=-1,r=false,u=function(y){(y=G+1<b.length&&b.charAt(G+1)==y)&&G++;return y},v=function(y){var H=u(y);y=new RegExp("^\\d{1,"+(y=="@"?14:y=="!"?20:y=="y"&&H?4:y=="o"?3:2)+"}");y=h.substring(z).match(y);if(!y)throw"Missing number at position "+z;z+=y[0].length;return parseInt(y[0],10)},w=function(y,H,N){y=a.map(u(y)?N:H,function(D,E){return[[E,D]]}).sort(function(D,E){return-(D[1].length-E[1].length)});var J=-1;a.each(y,function(D,E){D=
+E[1];if(h.substr(z,D.length).toLowerCase()==D.toLowerCase()){J=E[0];z+=D.length;return false}});if(J!=-1)return J+1;else throw"Unknown name at position "+z;},x=function(){if(h.charAt(z)!=b.charAt(G))throw"Unexpected literal at position "+z;z++},z=0,G=0;G<b.length;G++)if(r)if(b.charAt(G)=="'"&&!u("'"))r=false;else x();else switch(b.charAt(G)){case "d":q=v("d");break;case "D":w("D",o,n);break;case "o":s=v("o");break;case "m":p=v("m");break;case "M":p=w("M",k,m);break;case "y":j=v("y");break;case "@":var C=
+new Date(v("@"));j=C.getFullYear();p=C.getMonth()+1;q=C.getDate();break;case "!":C=new Date((v("!")-this._ticksTo1970)/1E4);j=C.getFullYear();p=C.getMonth()+1;q=C.getDate();break;case "'":if(u("'"))x();else r=true;break;default:x()}if(j==-1)j=(new Date).getFullYear();else if(j<100)j+=(new Date).getFullYear()-(new Date).getFullYear()%100+(j<=l?0:-100);if(s>-1){p=1;q=s;do{l=this._getDaysInMonth(j,p-1);if(q<=l)break;p++;q-=l}while(1)}C=this._daylightSavingAdjust(new Date(j,p-1,q));if(C.getFullYear()!=
+j||C.getMonth()+1!=p||C.getDate()!=q)throw"Invalid date";return C},ATOM:"yy-mm-dd",COOKIE:"D, dd M yy",ISO_8601:"yy-mm-dd",RFC_822:"D, d M y",RFC_850:"DD, dd-M-y",RFC_1036:"D, d M y",RFC_1123:"D, d M yy",RFC_2822:"D, d M yy",RSS:"D, d M y",TICKS:"!",TIMESTAMP:"@",W3C:"yy-mm-dd",_ticksTo1970:(718685+Math.floor(492.5)-Math.floor(19.7)+Math.floor(4.925))*24*60*60*1E7,formatDate:function(b,h,j){if(!h)return"";var l=(j?j.dayNamesShort:null)||this._defaults.dayNamesShort,o=(j?j.dayNames:null)||this._defaults.dayNames,
+n=(j?j.monthNamesShort:null)||this._defaults.monthNamesShort;j=(j?j.monthNames:null)||this._defaults.monthNames;var k=function(u){(u=r+1<b.length&&b.charAt(r+1)==u)&&r++;return u},m=function(u,v,w){v=""+v;if(k(u))for(;v.length<w;)v="0"+v;return v},p=function(u,v,w,x){return k(u)?x[v]:w[v]},q="",s=false;if(h)for(var r=0;r<b.length;r++)if(s)if(b.charAt(r)=="'"&&!k("'"))s=false;else q+=b.charAt(r);else switch(b.charAt(r)){case "d":q+=m("d",h.getDate(),2);break;case "D":q+=p("D",h.getDay(),l,o);break;
+case "o":q+=m("o",(h.getTime()-(new Date(h.getFullYear(),0,0)).getTime())/864E5,3);break;case "m":q+=m("m",h.getMonth()+1,2);break;case "M":q+=p("M",h.getMonth(),n,j);break;case "y":q+=k("y")?h.getFullYear():(h.getYear()%100<10?"0":"")+h.getYear()%100;break;case "@":q+=h.getTime();break;case "!":q+=h.getTime()*1E4+this._ticksTo1970;break;case "'":if(k("'"))q+="'";else s=true;break;default:q+=b.charAt(r)}return q},_possibleChars:function(b){for(var h="",j=false,l=function(n){(n=o+1<b.length&&b.charAt(o+
+1)==n)&&o++;return n},o=0;o<b.length;o++)if(j)if(b.charAt(o)=="'"&&!l("'"))j=false;else h+=b.charAt(o);else switch(b.charAt(o)){case "d":case "m":case "y":case "@":h+="0123456789";break;case "D":case "M":return null;case "'":if(l("'"))h+="'";else j=true;break;default:h+=b.charAt(o)}return h},_get:function(b,h){return b.settings[h]!==d?b.settings[h]:this._defaults[h]},_setDateFromField:function(b,h){if(b.input.val()!=b.lastVal){var j=this._get(b,"dateFormat"),l=b.lastVal=b.input?b.input.val():null,
+o,n;o=n=this._getDefaultDate(b);var k=this._getFormatConfig(b);try{o=this.parseDate(j,l,k)||n}catch(m){this.log(m);l=h?"":l}b.selectedDay=o.getDate();b.drawMonth=b.selectedMonth=o.getMonth();b.drawYear=b.selectedYear=o.getFullYear();b.currentDay=l?o.getDate():0;b.currentMonth=l?o.getMonth():0;b.currentYear=l?o.getFullYear():0;this._adjustInstDate(b)}},_getDefaultDate:function(b){return this._restrictMinMax(b,this._determineDate(b,this._get(b,"defaultDate"),new Date))},_determineDate:function(b,h,
+j){var l=function(n){var k=new Date;k.setDate(k.getDate()+n);return k},o=function(n){try{return a.datepicker.parseDate(a.datepicker._get(b,"dateFormat"),n,a.datepicker._getFormatConfig(b))}catch(k){}var m=(n.toLowerCase().match(/^c/)?a.datepicker._getDate(b):null)||new Date,p=m.getFullYear(),q=m.getMonth();m=m.getDate();for(var s=/([+-]?[0-9]+)\s*(d|D|w|W|m|M|y|Y)?/g,r=s.exec(n);r;){switch(r[2]||"d"){case "d":case "D":m+=parseInt(r[1],10);break;case "w":case "W":m+=parseInt(r[1],10)*7;break;case "m":case "M":q+=
+parseInt(r[1],10);m=Math.min(m,a.datepicker._getDaysInMonth(p,q));break;case "y":case "Y":p+=parseInt(r[1],10);m=Math.min(m,a.datepicker._getDaysInMonth(p,q));break}r=s.exec(n)}return new Date(p,q,m)};if(h=(h=h==null||h===""?j:typeof h=="string"?o(h):typeof h=="number"?isNaN(h)?j:l(h):new Date(h.getTime()))&&h.toString()=="Invalid Date"?j:h){h.setHours(0);h.setMinutes(0);h.setSeconds(0);h.setMilliseconds(0)}return this._daylightSavingAdjust(h)},_daylightSavingAdjust:function(b){if(!b)return null;
+b.setHours(b.getHours()>12?b.getHours()+2:0);return b},_setDate:function(b,h,j){var l=!h,o=b.selectedMonth,n=b.selectedYear;h=this._restrictMinMax(b,this._determineDate(b,h,new Date));b.selectedDay=b.currentDay=h.getDate();b.drawMonth=b.selectedMonth=b.currentMonth=h.getMonth();b.drawYear=b.selectedYear=b.currentYear=h.getFullYear();if((o!=b.selectedMonth||n!=b.selectedYear)&&!j)this._notifyChange(b);this._adjustInstDate(b);if(b.input)b.input.val(l?"":this._formatDate(b))},_getDate:function(b){return!b.currentYear||
+b.input&&b.input.val()==""?null:this._daylightSavingAdjust(new Date(b.currentYear,b.currentMonth,b.currentDay))},_generateHTML:function(b){var h=new Date;h=this._daylightSavingAdjust(new Date(h.getFullYear(),h.getMonth(),h.getDate()));var j=this._get(b,"isRTL"),l=this._get(b,"showButtonPanel"),o=this._get(b,"hideIfNoPrevNext"),n=this._get(b,"navigationAsDateFormat"),k=this._getNumberOfMonths(b),m=this._get(b,"showCurrentAtPos"),p=this._get(b,"stepMonths"),q=k[0]!=1||k[1]!=1,s=this._daylightSavingAdjust(!b.currentDay?
+new Date(9999,9,9):new Date(b.currentYear,b.currentMonth,b.currentDay)),r=this._getMinMaxDate(b,"min"),u=this._getMinMaxDate(b,"max");m=b.drawMonth-m;var v=b.drawYear;if(m<0){m+=12;v--}if(u){var w=this._daylightSavingAdjust(new Date(u.getFullYear(),u.getMonth()-k[0]*k[1]+1,u.getDate()));for(w=r&&w<r?r:w;this._daylightSavingAdjust(new Date(v,m,1))>w;){m--;if(m<0){m=11;v--}}}b.drawMonth=m;b.drawYear=v;w=this._get(b,"prevText");w=!n?w:this.formatDate(w,this._daylightSavingAdjust(new Date(v,m-p,1)),this._getFormatConfig(b));
+w=this._canAdjustMonth(b,-1,v,m)?'<a class="ui-datepicker-prev ui-corner-all" onclick="DP_jQuery_'+e+".datepicker._adjustDate('#"+b.id+"', -"+p+", 'M');\" title=\""+w+'"><span class="ui-icon ui-icon-circle-triangle-'+(j?"e":"w")+'">'+w+"</span></a>":o?"":'<a class="ui-datepicker-prev ui-corner-all ui-state-disabled" title="'+w+'"><span class="ui-icon ui-icon-circle-triangle-'+(j?"e":"w")+'">'+w+"</span></a>";var x=this._get(b,"nextText");x=!n?x:this.formatDate(x,this._daylightSavingAdjust(new Date(v,
+m+p,1)),this._getFormatConfig(b));o=this._canAdjustMonth(b,+1,v,m)?'<a class="ui-datepicker-next ui-corner-all" onclick="DP_jQuery_'+e+".datepicker._adjustDate('#"+b.id+"', +"+p+", 'M');\" title=\""+x+'"><span class="ui-icon ui-icon-circle-triangle-'+(j?"w":"e")+'">'+x+"</span></a>":o?"":'<a class="ui-datepicker-next ui-corner-all ui-state-disabled" title="'+x+'"><span class="ui-icon ui-icon-circle-triangle-'+(j?"w":"e")+'">'+x+"</span></a>";p=this._get(b,"currentText");x=this._get(b,"gotoCurrent")&&
+b.currentDay?s:h;p=!n?p:this.formatDate(p,x,this._getFormatConfig(b));n=!b.inline?'<button type="button" class="ui-datepicker-close ui-state-default ui-priority-primary ui-corner-all" onclick="DP_jQuery_'+e+'.datepicker._hideDatepicker();">'+this._get(b,"closeText")+"</button>":"";l=l?'<div class="ui-datepicker-buttonpane ui-widget-content">'+(j?n:"")+(this._isInRange(b,x)?'<button type="button" class="ui-datepicker-current ui-state-default ui-priority-secondary ui-corner-all" onclick="DP_jQuery_'+
+e+".datepicker._gotoToday('#"+b.id+"');\">"+p+"</button>":"")+(j?"":n)+"</div>":"";n=parseInt(this._get(b,"firstDay"),10);n=isNaN(n)?0:n;p=this._get(b,"showWeek");x=this._get(b,"dayNames");this._get(b,"dayNamesShort");var z=this._get(b,"dayNamesMin"),G=this._get(b,"monthNames"),C=this._get(b,"monthNamesShort"),y=this._get(b,"beforeShowDay"),H=this._get(b,"showOtherMonths"),N=this._get(b,"selectOtherMonths");this._get(b,"calculateWeek");for(var J=this._getDefaultDate(b),D="",E=0;E<k[0];E++){for(var P=
+"",L=0;L<k[1];L++){var Q=this._daylightSavingAdjust(new Date(v,m,b.selectedDay)),B=" ui-corner-all",F="";if(q){F+='<div class="ui-datepicker-group';if(k[1]>1)switch(L){case 0:F+=" ui-datepicker-group-first";B=" ui-corner-"+(j?"right":"left");break;case k[1]-1:F+=" ui-datepicker-group-last";B=" ui-corner-"+(j?"left":"right");break;default:F+=" ui-datepicker-group-middle";B="";break}F+='">'}F+='<div class="ui-datepicker-header ui-widget-header ui-helper-clearfix'+B+'">'+(/all|left/.test(B)&&E==0?j?
+o:w:"")+(/all|right/.test(B)&&E==0?j?w:o:"")+this._generateMonthYearHeader(b,m,v,r,u,E>0||L>0,G,C)+'</div><table class="ui-datepicker-calendar"><thead><tr>';var I=p?'<th class="ui-datepicker-week-col">'+this._get(b,"weekHeader")+"</th>":"";for(B=0;B<7;B++){var A=(B+n)%7;I+="<th"+((B+n+6)%7>=5?' class="ui-datepicker-week-end"':"")+'><span title="'+x[A]+'">'+z[A]+"</span></th>"}F+=I+"</tr></thead><tbody>";I=this._getDaysInMonth(v,m);if(v==b.selectedYear&&m==b.selectedMonth)b.selectedDay=Math.min(b.selectedDay,
+I);B=(this._getFirstDayOfMonth(v,m)-n+7)%7;I=q?6:Math.ceil((B+I)/7);A=this._daylightSavingAdjust(new Date(v,m,1-B));for(var R=0;R<I;R++){F+="<tr>";var S=!p?"":'<td class="ui-datepicker-week-col">'+this._get(b,"calculateWeek")(A)+"</td>";for(B=0;B<7;B++){var M=y?y.apply(b.input?b.input[0]:null,[A]):[true,""],K=A.getMonth()!=m,O=K&&!N||!M[0]||r&&A<r||u&&A>u;S+='<td class="'+((B+n+6)%7>=5?" ui-datepicker-week-end":"")+(K?" ui-datepicker-other-month":"")+(A.getTime()==Q.getTime()&&m==b.selectedMonth&&
+b._keyEvent||J.getTime()==A.getTime()&&J.getTime()==Q.getTime()?" "+this._dayOverClass:"")+(O?" "+this._unselectableClass+" ui-state-disabled":"")+(K&&!H?"":" "+M[1]+(A.getTime()==s.getTime()?" "+this._currentClass:"")+(A.getTime()==h.getTime()?" ui-datepicker-today":""))+'"'+((!K||H)&&M[2]?' title="'+M[2]+'"':"")+(O?"":' onclick="DP_jQuery_'+e+".datepicker._selectDay('#"+b.id+"',"+A.getMonth()+","+A.getFullYear()+', this);return false;"')+">"+(K&&!H?"&#xa0;":O?'<span class="ui-state-default">'+A.getDate()+
+"</span>":'<a class="ui-state-default'+(A.getTime()==h.getTime()?" ui-state-highlight":"")+(A.getTime()==s.getTime()?" ui-state-active":"")+(K?" ui-priority-secondary":"")+'" href="#">'+A.getDate()+"</a>")+"</td>";A.setDate(A.getDate()+1);A=this._daylightSavingAdjust(A)}F+=S+"</tr>"}m++;if(m>11){m=0;v++}F+="</tbody></table>"+(q?"</div>"+(k[0]>0&&L==k[1]-1?'<div class="ui-datepicker-row-break"></div>':""):"");P+=F}D+=P}D+=l+(a.browser.msie&&parseInt(a.browser.version,10)<7&&!b.inline?'<iframe src="javascript:false;" class="ui-datepicker-cover" frameborder="0"></iframe>':
+"");b._keyEvent=false;return D},_generateMonthYearHeader:function(b,h,j,l,o,n,k,m){var p=this._get(b,"changeMonth"),q=this._get(b,"changeYear"),s=this._get(b,"showMonthAfterYear"),r='<div class="ui-datepicker-title">',u="";if(n||!p)u+='<span class="ui-datepicker-month">'+k[h]+"</span>";else{k=l&&l.getFullYear()==j;var v=o&&o.getFullYear()==j;u+='<select class="ui-datepicker-month" onchange="DP_jQuery_'+e+".datepicker._selectMonthYear('#"+b.id+"', this, 'M');\" onclick=\"DP_jQuery_"+e+".datepicker._clickMonthYear('#"+
+b.id+"');\">";for(var w=0;w<12;w++)if((!k||w>=l.getMonth())&&(!v||w<=o.getMonth()))u+='<option value="'+w+'"'+(w==h?' selected="selected"':"")+">"+m[w]+"</option>";u+="</select>"}s||(r+=u+(n||!(p&&q)?"&#xa0;":""));if(!b.yearshtml){b.yearshtml="";if(n||!q)r+='<span class="ui-datepicker-year">'+j+"</span>";else{m=this._get(b,"yearRange").split(":");var x=(new Date).getFullYear();k=function(z){z=z.match(/c[+-].*/)?j+parseInt(z.substring(1),10):z.match(/[+-].*/)?x+parseInt(z,10):parseInt(z,10);return isNaN(z)?
+x:z};h=k(m[0]);m=Math.max(h,k(m[1]||""));h=l?Math.max(h,l.getFullYear()):h;m=o?Math.min(m,o.getFullYear()):m;for(b.yearshtml+='<select class="ui-datepicker-year" onchange="DP_jQuery_'+e+".datepicker._selectMonthYear('#"+b.id+"', this, 'Y');\" onclick=\"DP_jQuery_"+e+".datepicker._clickMonthYear('#"+b.id+"');\">";h<=m;h++)b.yearshtml+='<option value="'+h+'"'+(h==j?' selected="selected"':"")+">"+h+"</option>";b.yearshtml+="</select>";r+=b.yearshtml;b.yearshtml=null}}r+=this._get(b,"yearSuffix");if(s)r+=
+(n||!(p&&q)?"&#xa0;":"")+u;r+="</div>";return r},_adjustInstDate:function(b,h,j){var l=b.drawYear+(j=="Y"?h:0),o=b.drawMonth+(j=="M"?h:0);h=Math.min(b.selectedDay,this._getDaysInMonth(l,o))+(j=="D"?h:0);l=this._restrictMinMax(b,this._daylightSavingAdjust(new Date(l,o,h)));b.selectedDay=l.getDate();b.drawMonth=b.selectedMonth=l.getMonth();b.drawYear=b.selectedYear=l.getFullYear();if(j=="M"||j=="Y")this._notifyChange(b)},_restrictMinMax:function(b,h){var j=this._getMinMaxDate(b,"min");b=this._getMinMaxDate(b,
+"max");h=j&&h<j?j:h;return h=b&&h>b?b:h},_notifyChange:function(b){var h=this._get(b,"onChangeMonthYear");if(h)h.apply(b.input?b.input[0]:null,[b.selectedYear,b.selectedMonth+1,b])},_getNumberOfMonths:function(b){b=this._get(b,"numberOfMonths");return b==null?[1,1]:typeof b=="number"?[1,b]:b},_getMinMaxDate:function(b,h){return this._determineDate(b,this._get(b,h+"Date"),null)},_getDaysInMonth:function(b,h){return 32-this._daylightSavingAdjust(new Date(b,h,32)).getDate()},_getFirstDayOfMonth:function(b,
+h){return(new Date(b,h,1)).getDay()},_canAdjustMonth:function(b,h,j,l){var o=this._getNumberOfMonths(b);j=this._daylightSavingAdjust(new Date(j,l+(h<0?h:o[0]*o[1]),1));h<0&&j.setDate(this._getDaysInMonth(j.getFullYear(),j.getMonth()));return this._isInRange(b,j)},_isInRange:function(b,h){var j=this._getMinMaxDate(b,"min");b=this._getMinMaxDate(b,"max");return(!j||h.getTime()>=j.getTime())&&(!b||h.getTime()<=b.getTime())},_getFormatConfig:function(b){var h=this._get(b,"shortYearCutoff");h=typeof h!=
+"string"?h:(new Date).getFullYear()%100+parseInt(h,10);return{shortYearCutoff:h,dayNamesShort:this._get(b,"dayNamesShort"),dayNames:this._get(b,"dayNames"),monthNamesShort:this._get(b,"monthNamesShort"),monthNames:this._get(b,"monthNames")}},_formatDate:function(b,h,j,l){if(!h){b.currentDay=b.selectedDay;b.currentMonth=b.selectedMonth;b.currentYear=b.selectedYear}h=h?typeof h=="object"?h:this._daylightSavingAdjust(new Date(l,j,h)):this._daylightSavingAdjust(new Date(b.currentYear,b.currentMonth,b.currentDay));
+return this.formatDate(this._get(b,"dateFormat"),h,this._getFormatConfig(b))}});a.fn.datepicker=function(b){if(!this.length)return this;if(!a.datepicker.initialized){a(document).mousedown(a.datepicker._checkExternalClick).find("body").append(a.datepicker.dpDiv);a.datepicker.initialized=true}var h=Array.prototype.slice.call(arguments,1);if(typeof b=="string"&&(b=="isDisabled"||b=="getDate"||b=="widget"))return a.datepicker["_"+b+"Datepicker"].apply(a.datepicker,[this[0]].concat(h));if(b=="option"&&
+arguments.length==2&&typeof arguments[1]=="string")return a.datepicker["_"+b+"Datepicker"].apply(a.datepicker,[this[0]].concat(h));return this.each(function(){typeof b=="string"?a.datepicker["_"+b+"Datepicker"].apply(a.datepicker,[this].concat(h)):a.datepicker._attachDatepicker(this,b)})};a.datepicker=new c;a.datepicker.initialized=false;a.datepicker.uuid=(new Date).getTime();a.datepicker.version="1.8.13";window["DP_jQuery_"+e]=a})(jQuery);
+(function(a,d){var c={buttons:true,height:true,maxHeight:true,maxWidth:true,minHeight:true,minWidth:true,width:true},f={maxHeight:true,maxWidth:true,minHeight:true,minWidth:true},g=a.attrFn||{val:true,css:true,html:true,text:true,data:true,width:true,height:true,offset:true,click:true};a.widget("ui.dialog",{options:{autoOpen:true,buttons:{},closeOnEscape:true,closeText:"close",dialogClass:"",draggable:true,hide:null,height:"auto",maxHeight:false,maxWidth:false,minHeight:150,minWidth:150,modal:false,
+position:{my:"center",at:"center",collision:"fit",using:function(e){var i=a(this).css(e).offset().top;i<0&&a(this).css("top",e.top-i)}},resizable:true,show:null,stack:true,title:"",width:300,zIndex:1E3},_create:function(){this.originalTitle=this.element.attr("title");if(typeof this.originalTitle!=="string")this.originalTitle="";this.options.title=this.options.title||this.originalTitle;var e=this,i=e.options,b=i.title||"&#160;",h=a.ui.dialog.getTitleId(e.element),j=(e.uiDialog=a("<div></div>")).appendTo(document.body).hide().addClass("ui-dialog ui-widget ui-widget-content ui-corner-all "+
+i.dialogClass).css({zIndex:i.zIndex}).attr("tabIndex",-1).css("outline",0).keydown(function(n){if(i.closeOnEscape&&n.keyCode&&n.keyCode===a.ui.keyCode.ESCAPE){e.close(n);n.preventDefault()}}).attr({role:"dialog","aria-labelledby":h}).mousedown(function(n){e.moveToTop(false,n)});e.element.show().removeAttr("title").addClass("ui-dialog-content ui-widget-content").appendTo(j);var l=(e.uiDialogTitlebar=a("<div></div>")).addClass("ui-dialog-titlebar ui-widget-header ui-corner-all ui-helper-clearfix").prependTo(j),
+o=a('<a href="#"></a>').addClass("ui-dialog-titlebar-close ui-corner-all").attr("role","button").hover(function(){o.addClass("ui-state-hover")},function(){o.removeClass("ui-state-hover")}).focus(function(){o.addClass("ui-state-focus")}).blur(function(){o.removeClass("ui-state-focus")}).click(function(n){e.close(n);return false}).appendTo(l);(e.uiDialogTitlebarCloseText=a("<span></span>")).addClass("ui-icon ui-icon-closethick").text(i.closeText).appendTo(o);a("<span></span>").addClass("ui-dialog-title").attr("id",
+h).html(b).prependTo(l);if(a.isFunction(i.beforeclose)&&!a.isFunction(i.beforeClose))i.beforeClose=i.beforeclose;l.find("*").add(l).disableSelection();i.draggable&&a.fn.draggable&&e._makeDraggable();i.resizable&&a.fn.resizable&&e._makeResizable();e._createButtons(i.buttons);e._isOpen=false;a.fn.bgiframe&&j.bgiframe()},_init:function(){this.options.autoOpen&&this.open()},destroy:function(){var e=this;e.overlay&&e.overlay.destroy();e.uiDialog.hide();e.element.unbind(".dialog").removeData("dialog").removeClass("ui-dialog-content ui-widget-content").hide().appendTo("body");
+e.uiDialog.remove();e.originalTitle&&e.element.attr("title",e.originalTitle);return e},widget:function(){return this.uiDialog},close:function(e){var i=this,b,h;if(false!==i._trigger("beforeClose",e)){i.overlay&&i.overlay.destroy();i.uiDialog.unbind("keypress.ui-dialog");i._isOpen=false;if(i.options.hide)i.uiDialog.hide(i.options.hide,function(){i._trigger("close",e)});else{i.uiDialog.hide();i._trigger("close",e)}a.ui.dialog.overlay.resize();if(i.options.modal){b=0;a(".ui-dialog").each(function(){if(this!==
+i.uiDialog[0]){h=a(this).css("z-index");isNaN(h)||(b=Math.max(b,h))}});a.ui.dialog.maxZ=b}return i}},isOpen:function(){return this._isOpen},moveToTop:function(e,i){var b=this,h=b.options;if(h.modal&&!e||!h.stack&&!h.modal)return b._trigger("focus",i);if(h.zIndex>a.ui.dialog.maxZ)a.ui.dialog.maxZ=h.zIndex;if(b.overlay){a.ui.dialog.maxZ+=1;b.overlay.$el.css("z-index",a.ui.dialog.overlay.maxZ=a.ui.dialog.maxZ)}e={scrollTop:b.element.attr("scrollTop"),scrollLeft:b.element.attr("scrollLeft")};a.ui.dialog.maxZ+=
+1;b.uiDialog.css("z-index",a.ui.dialog.maxZ);b.element.attr(e);b._trigger("focus",i);return b},open:function(){if(!this._isOpen){var e=this,i=e.options,b=e.uiDialog;e.overlay=i.modal?new a.ui.dialog.overlay(e):null;e._size();e._position(i.position);b.show(i.show);e.moveToTop(true);i.modal&&b.bind("keypress.ui-dialog",function(h){if(h.keyCode===a.ui.keyCode.TAB){var j=a(":tabbable",this),l=j.filter(":first");j=j.filter(":last");if(h.target===j[0]&&!h.shiftKey){l.focus(1);return false}else if(h.target===
+l[0]&&h.shiftKey){j.focus(1);return false}}});a(e.element.find(":tabbable").get().concat(b.find(".ui-dialog-buttonpane :tabbable").get().concat(b.get()))).eq(0).focus();e._isOpen=true;e._trigger("open");return e}},_createButtons:function(e){var i=this,b=false,h=a("<div></div>").addClass("ui-dialog-buttonpane ui-widget-content ui-helper-clearfix"),j=a("<div></div>").addClass("ui-dialog-buttonset").appendTo(h);i.uiDialog.find(".ui-dialog-buttonpane").remove();typeof e==="object"&&e!==null&&a.each(e,
+function(){return!(b=true)});if(b){a.each(e,function(l,o){o=a.isFunction(o)?{click:o,text:l}:o;var n=a('<button type="button"></button>').click(function(){o.click.apply(i.element[0],arguments)}).appendTo(j);a.each(o,function(k,m){if(k!=="click")k in g?n[k](m):n.attr(k,m)});a.fn.button&&n.button()});h.appendTo(i.uiDialog)}},_makeDraggable:function(){function e(l){return{position:l.position,offset:l.offset}}var i=this,b=i.options,h=a(document),j;i.uiDialog.draggable({cancel:".ui-dialog-content, .ui-dialog-titlebar-close",
+handle:".ui-dialog-titlebar",containment:"document",start:function(l,o){j=b.height==="auto"?"auto":a(this).height();a(this).height(a(this).height()).addClass("ui-dialog-dragging");i._trigger("dragStart",l,e(o))},drag:function(l,o){i._trigger("drag",l,e(o))},stop:function(l,o){b.position=[o.position.left-h.scrollLeft(),o.position.top-h.scrollTop()];a(this).removeClass("ui-dialog-dragging").height(j);i._trigger("dragStop",l,e(o));a.ui.dialog.overlay.resize()}})},_makeResizable:function(e){function i(l){return{originalPosition:l.originalPosition,
+originalSize:l.originalSize,position:l.position,size:l.size}}e=e===d?this.options.resizable:e;var b=this,h=b.options,j=b.uiDialog.css("position");e=typeof e==="string"?e:"n,e,s,w,se,sw,ne,nw";b.uiDialog.resizable({cancel:".ui-dialog-content",containment:"document",alsoResize:b.element,maxWidth:h.maxWidth,maxHeight:h.maxHeight,minWidth:h.minWidth,minHeight:b._minHeight(),handles:e,start:function(l,o){a(this).addClass("ui-dialog-resizing");b._trigger("resizeStart",l,i(o))},resize:function(l,o){b._trigger("resize",
+l,i(o))},stop:function(l,o){a(this).removeClass("ui-dialog-resizing");h.height=a(this).height();h.width=a(this).width();b._trigger("resizeStop",l,i(o));a.ui.dialog.overlay.resize()}}).css("position",j).find(".ui-resizable-se").addClass("ui-icon ui-icon-grip-diagonal-se")},_minHeight:function(){var e=this.options;return e.height==="auto"?e.minHeight:Math.min(e.minHeight,e.height)},_position:function(e){var i=[],b=[0,0],h;if(e){if(typeof e==="string"||typeof e==="object"&&"0"in e){i=e.split?e.split(" "):
+[e[0],e[1]];if(i.length===1)i[1]=i[0];a.each(["left","top"],function(j,l){if(+i[j]===i[j]){b[j]=i[j];i[j]=l}});e={my:i.join(" "),at:i.join(" "),offset:b.join(" ")}}e=a.extend({},a.ui.dialog.prototype.options.position,e)}else e=a.ui.dialog.prototype.options.position;(h=this.uiDialog.is(":visible"))||this.uiDialog.show();this.uiDialog.css({top:0,left:0}).position(a.extend({of:window},e));h||this.uiDialog.hide()},_setOptions:function(e){var i=this,b={},h=false;a.each(e,function(j,l){i._setOption(j,l);
+if(j in c)h=true;if(j in f)b[j]=l});h&&this._size();this.uiDialog.is(":data(resizable)")&&this.uiDialog.resizable("option",b)},_setOption:function(e,i){var b=this,h=b.uiDialog;switch(e){case "beforeclose":e="beforeClose";break;case "buttons":b._createButtons(i);break;case "closeText":b.uiDialogTitlebarCloseText.text(""+i);break;case "dialogClass":h.removeClass(b.options.dialogClass).addClass("ui-dialog ui-widget ui-widget-content ui-corner-all "+i);break;case "disabled":i?h.addClass("ui-dialog-disabled"):
+h.removeClass("ui-dialog-disabled");break;case "draggable":var j=h.is(":data(draggable)");j&&!i&&h.draggable("destroy");!j&&i&&b._makeDraggable();break;case "position":b._position(i);break;case "resizable":(j=h.is(":data(resizable)"))&&!i&&h.resizable("destroy");j&&typeof i==="string"&&h.resizable("option","handles",i);!j&&i!==false&&b._makeResizable(i);break;case "title":a(".ui-dialog-title",b.uiDialogTitlebar).html(""+(i||"&#160;"));break}a.Widget.prototype._setOption.apply(b,arguments)},_size:function(){var e=
+this.options,i,b,h=this.uiDialog.is(":visible");this.element.show().css({width:"auto",minHeight:0,height:0});if(e.minWidth>e.width)e.width=e.minWidth;i=this.uiDialog.css({height:"auto",width:e.width}).height();b=Math.max(0,e.minHeight-i);if(e.height==="auto")if(a.support.minHeight)this.element.css({minHeight:b,height:"auto"});else{this.uiDialog.show();e=this.element.css("height","auto").height();h||this.uiDialog.hide();this.element.height(Math.max(e,b))}else this.element.height(Math.max(e.height-
+i,0));this.uiDialog.is(":data(resizable)")&&this.uiDialog.resizable("option","minHeight",this._minHeight())}});a.extend(a.ui.dialog,{version:"1.8.13",uuid:0,maxZ:0,getTitleId:function(e){e=e.attr("id");if(!e){this.uuid+=1;e=this.uuid}return"ui-dialog-title-"+e},overlay:function(e){this.$el=a.ui.dialog.overlay.create(e)}});a.extend(a.ui.dialog.overlay,{instances:[],oldInstances:[],maxZ:0,events:a.map("focus,mousedown,mouseup,keydown,keypress,click".split(","),function(e){return e+".dialog-overlay"}).join(" "),
+create:function(e){if(this.instances.length===0){setTimeout(function(){a.ui.dialog.overlay.instances.length&&a(document).bind(a.ui.dialog.overlay.events,function(b){if(a(b.target).zIndex()<a.ui.dialog.overlay.maxZ)return false})},1);a(document).bind("keydown.dialog-overlay",function(b){if(e.options.closeOnEscape&&b.keyCode&&b.keyCode===a.ui.keyCode.ESCAPE){e.close(b);b.preventDefault()}});a(window).bind("resize.dialog-overlay",a.ui.dialog.overlay.resize)}var i=(this.oldInstances.pop()||a("<div></div>").addClass("ui-widget-overlay")).appendTo(document.body).css({width:this.width(),
+height:this.height()});a.fn.bgiframe&&i.bgiframe();this.instances.push(i);return i},destroy:function(e){var i=a.inArray(e,this.instances);i!=-1&&this.oldInstances.push(this.instances.splice(i,1)[0]);this.instances.length===0&&a([document,window]).unbind(".dialog-overlay");e.remove();var b=0;a.each(this.instances,function(){b=Math.max(b,this.css("z-index"))});this.maxZ=b},height:function(){var e,i;if(a.browser.msie&&a.browser.version<7){e=Math.max(document.documentElement.scrollHeight,document.body.scrollHeight);
+i=Math.max(document.documentElement.offsetHeight,document.body.offsetHeight);return e<i?a(window).height()+"px":e+"px"}else return a(document).height()+"px"},width:function(){var e,i;if(a.browser.msie&&a.browser.version<7){e=Math.max(document.documentElement.scrollWidth,document.body.scrollWidth);i=Math.max(document.documentElement.offsetWidth,document.body.offsetWidth);return e<i?a(window).width()+"px":e+"px"}else return a(document).width()+"px"},resize:function(){var e=a([]);a.each(a.ui.dialog.overlay.instances,
+function(){e=e.add(this)});e.css({width:0,height:0}).css({width:a.ui.dialog.overlay.width(),height:a.ui.dialog.overlay.height()})}});a.extend(a.ui.dialog.overlay.prototype,{destroy:function(){a.ui.dialog.overlay.destroy(this.$el)}})})(jQuery);
+(function(a){a.ui=a.ui||{};var d=/left|center|right/,c=/top|center|bottom/,f=a.fn.position,g=a.fn.offset;a.fn.position=function(e){if(!e||!e.of)return f.apply(this,arguments);e=a.extend({},e);var i=a(e.of),b=i[0],h=(e.collision||"flip").split(" "),j=e.offset?e.offset.split(" "):[0,0],l,o,n;if(b.nodeType===9){l=i.width();o=i.height();n={top:0,left:0}}else if(b.setTimeout){l=i.width();o=i.height();n={top:i.scrollTop(),left:i.scrollLeft()}}else if(b.preventDefault){e.at="left top";l=o=0;n={top:e.of.pageY,
+left:e.of.pageX}}else{l=i.outerWidth();o=i.outerHeight();n=i.offset()}a.each(["my","at"],function(){var k=(e[this]||"").split(" ");if(k.length===1)k=d.test(k[0])?k.concat(["center"]):c.test(k[0])?["center"].concat(k):["center","center"];k[0]=d.test(k[0])?k[0]:"center";k[1]=c.test(k[1])?k[1]:"center";e[this]=k});if(h.length===1)h[1]=h[0];j[0]=parseInt(j[0],10)||0;if(j.length===1)j[1]=j[0];j[1]=parseInt(j[1],10)||0;if(e.at[0]==="right")n.left+=l;else if(e.at[0]==="center")n.left+=l/2;if(e.at[1]==="bottom")n.top+=
+o;else if(e.at[1]==="center")n.top+=o/2;n.left+=j[0];n.top+=j[1];return this.each(function(){var k=a(this),m=k.outerWidth(),p=k.outerHeight(),q=parseInt(a.curCSS(this,"marginLeft",true))||0,s=parseInt(a.curCSS(this,"marginTop",true))||0,r=m+q+(parseInt(a.curCSS(this,"marginRight",true))||0),u=p+s+(parseInt(a.curCSS(this,"marginBottom",true))||0),v=a.extend({},n),w;if(e.my[0]==="right")v.left-=m;else if(e.my[0]==="center")v.left-=m/2;if(e.my[1]==="bottom")v.top-=p;else if(e.my[1]==="center")v.top-=
+p/2;v.left=Math.round(v.left);v.top=Math.round(v.top);w={left:v.left-q,top:v.top-s};a.each(["left","top"],function(x,z){a.ui.position[h[x]]&&a.ui.position[h[x]][z](v,{targetWidth:l,targetHeight:o,elemWidth:m,elemHeight:p,collisionPosition:w,collisionWidth:r,collisionHeight:u,offset:j,my:e.my,at:e.at})});a.fn.bgiframe&&k.bgiframe();k.offset(a.extend(v,{using:e.using}))})};a.ui.position={fit:{left:function(e,i){var b=a(window);b=i.collisionPosition.left+i.collisionWidth-b.width()-b.scrollLeft();e.left=
+b>0?e.left-b:Math.max(e.left-i.collisionPosition.left,e.left)},top:function(e,i){var b=a(window);b=i.collisionPosition.top+i.collisionHeight-b.height()-b.scrollTop();e.top=b>0?e.top-b:Math.max(e.top-i.collisionPosition.top,e.top)}},flip:{left:function(e,i){if(i.at[0]!=="center"){var b=a(window);b=i.collisionPosition.left+i.collisionWidth-b.width()-b.scrollLeft();var h=i.my[0]==="left"?-i.elemWidth:i.my[0]==="right"?i.elemWidth:0,j=i.at[0]==="left"?i.targetWidth:-i.targetWidth,l=-2*i.offset[0];e.left+=
+i.collisionPosition.left<0?h+j+l:b>0?h+j+l:0}},top:function(e,i){if(i.at[1]!=="center"){var b=a(window);b=i.collisionPosition.top+i.collisionHeight-b.height()-b.scrollTop();var h=i.my[1]==="top"?-i.elemHeight:i.my[1]==="bottom"?i.elemHeight:0,j=i.at[1]==="top"?i.targetHeight:-i.targetHeight,l=-2*i.offset[1];e.top+=i.collisionPosition.top<0?h+j+l:b>0?h+j+l:0}}}};if(!a.offset.setOffset){a.offset.setOffset=function(e,i){if(/static/.test(a.curCSS(e,"position")))e.style.position="relative";var b=a(e),
+h=b.offset(),j=parseInt(a.curCSS(e,"top",true),10)||0,l=parseInt(a.curCSS(e,"left",true),10)||0;h={top:i.top-h.top+j,left:i.left-h.left+l};"using"in i?i.using.call(e,h):b.css(h)};a.fn.offset=function(e){var i=this[0];if(!i||!i.ownerDocument)return null;if(e)return this.each(function(){a.offset.setOffset(this,e)});return g.call(this)}}})(jQuery);
+(function(a,d){a.widget("ui.progressbar",{options:{value:0,max:100},min:0,_create:function(){this.element.addClass("ui-progressbar ui-widget ui-widget-content ui-corner-all").attr({role:"progressbar","aria-valuemin":this.min,"aria-valuemax":this.options.max,"aria-valuenow":this._value()});this.valueDiv=a("<div class='ui-progressbar-value ui-widget-header ui-corner-left'></div>").appendTo(this.element);this.oldValue=this._value();this._refreshValue()},destroy:function(){this.element.removeClass("ui-progressbar ui-widget ui-widget-content ui-corner-all").removeAttr("role").removeAttr("aria-valuemin").removeAttr("aria-valuemax").removeAttr("aria-valuenow");
+this.valueDiv.remove();a.Widget.prototype.destroy.apply(this,arguments)},value:function(c){if(c===d)return this._value();this._setOption("value",c);return this},_setOption:function(c,f){if(c==="value"){this.options.value=f;this._refreshValue();this._value()===this.options.max&&this._trigger("complete")}a.Widget.prototype._setOption.apply(this,arguments)},_value:function(){var c=this.options.value;if(typeof c!=="number")c=0;return Math.min(this.options.max,Math.max(this.min,c))},_percentage:function(){return 100*
+this._value()/this.options.max},_refreshValue:function(){var c=this.value(),f=this._percentage();if(this.oldValue!==c){this.oldValue=c;this._trigger("change")}this.valueDiv.toggle(c>this.min).toggleClass("ui-corner-right",c===this.options.max).width(f.toFixed(0)+"%");this.element.attr("aria-valuenow",c)}});a.extend(a.ui.progressbar,{version:"1.8.13"})})(jQuery);
+(function(a){a.widget("ui.slider",a.ui.mouse,{widgetEventPrefix:"slide",options:{animate:false,distance:0,max:100,min:0,orientation:"horizontal",range:false,step:1,value:0,values:null},_create:function(){var d=this,c=this.options,f=this.element.find(".ui-slider-handle").addClass("ui-state-default ui-corner-all"),g=c.values&&c.values.length||1,e=[];this._mouseSliding=this._keySliding=false;this._animateOff=true;this._handleIndex=null;this._detectOrientation();this._mouseInit();this.element.addClass("ui-slider ui-slider-"+
+this.orientation+" ui-widget ui-widget-content ui-corner-all"+(c.disabled?" ui-slider-disabled ui-disabled":""));this.range=a([]);if(c.range){if(c.range===true){if(!c.values)c.values=[this._valueMin(),this._valueMin()];if(c.values.length&&c.values.length!==2)c.values=[c.values[0],c.values[0]]}this.range=a("<div></div>").appendTo(this.element).addClass("ui-slider-range ui-widget-header"+(c.range==="min"||c.range==="max"?" ui-slider-range-"+c.range:""))}for(var i=f.length;i<g;i+=1)e.push("<a class='ui-slider-handle ui-state-default ui-corner-all' href='#'></a>");
+this.handles=f.add(a(e.join("")).appendTo(d.element));this.handle=this.handles.eq(0);this.handles.add(this.range).filter("a").click(function(b){b.preventDefault()}).hover(function(){c.disabled||a(this).addClass("ui-state-hover")},function(){a(this).removeClass("ui-state-hover")}).focus(function(){if(c.disabled)a(this).blur();else{a(".ui-slider .ui-state-focus").removeClass("ui-state-focus");a(this).addClass("ui-state-focus")}}).blur(function(){a(this).removeClass("ui-state-focus")});this.handles.each(function(b){a(this).data("index.ui-slider-handle",
+b)});this.handles.keydown(function(b){var h=true,j=a(this).data("index.ui-slider-handle"),l,o,n;if(!d.options.disabled){switch(b.keyCode){case a.ui.keyCode.HOME:case a.ui.keyCode.END:case a.ui.keyCode.PAGE_UP:case a.ui.keyCode.PAGE_DOWN:case a.ui.keyCode.UP:case a.ui.keyCode.RIGHT:case a.ui.keyCode.DOWN:case a.ui.keyCode.LEFT:h=false;if(!d._keySliding){d._keySliding=true;a(this).addClass("ui-state-active");l=d._start(b,j);if(l===false)return}break}n=d.options.step;l=d.options.values&&d.options.values.length?
+(o=d.values(j)):(o=d.value());switch(b.keyCode){case a.ui.keyCode.HOME:o=d._valueMin();break;case a.ui.keyCode.END:o=d._valueMax();break;case a.ui.keyCode.PAGE_UP:o=d._trimAlignValue(l+(d._valueMax()-d._valueMin())/5);break;case a.ui.keyCode.PAGE_DOWN:o=d._trimAlignValue(l-(d._valueMax()-d._valueMin())/5);break;case a.ui.keyCode.UP:case a.ui.keyCode.RIGHT:if(l===d._valueMax())return;o=d._trimAlignValue(l+n);break;case a.ui.keyCode.DOWN:case a.ui.keyCode.LEFT:if(l===d._valueMin())return;o=d._trimAlignValue(l-
+n);break}d._slide(b,j,o);return h}}).keyup(function(b){var h=a(this).data("index.ui-slider-handle");if(d._keySliding){d._keySliding=false;d._stop(b,h);d._change(b,h);a(this).removeClass("ui-state-active")}});this._refreshValue();this._animateOff=false},destroy:function(){this.handles.remove();this.range.remove();this.element.removeClass("ui-slider ui-slider-horizontal ui-slider-vertical ui-slider-disabled ui-widget ui-widget-content ui-corner-all").removeData("slider").unbind(".slider");this._mouseDestroy();
+return this},_mouseCapture:function(d){var c=this.options,f,g,e,i,b;if(c.disabled)return false;this.elementSize={width:this.element.outerWidth(),height:this.element.outerHeight()};this.elementOffset=this.element.offset();f=this._normValueFromMouse({x:d.pageX,y:d.pageY});g=this._valueMax()-this._valueMin()+1;i=this;this.handles.each(function(h){var j=Math.abs(f-i.values(h));if(g>j){g=j;e=a(this);b=h}});if(c.range===true&&this.values(1)===c.min){b+=1;e=a(this.handles[b])}if(this._start(d,b)===false)return false;
+this._mouseSliding=true;i._handleIndex=b;e.addClass("ui-state-active").focus();c=e.offset();this._clickOffset=!a(d.target).parents().andSelf().is(".ui-slider-handle")?{left:0,top:0}:{left:d.pageX-c.left-e.width()/2,top:d.pageY-c.top-e.height()/2-(parseInt(e.css("borderTopWidth"),10)||0)-(parseInt(e.css("borderBottomWidth"),10)||0)+(parseInt(e.css("marginTop"),10)||0)};this.handles.hasClass("ui-state-hover")||this._slide(d,b,f);return this._animateOff=true},_mouseStart:function(){return true},_mouseDrag:function(d){var c=
+this._normValueFromMouse({x:d.pageX,y:d.pageY});this._slide(d,this._handleIndex,c);return false},_mouseStop:function(d){this.handles.removeClass("ui-state-active");this._mouseSliding=false;this._stop(d,this._handleIndex);this._change(d,this._handleIndex);this._clickOffset=this._handleIndex=null;return this._animateOff=false},_detectOrientation:function(){this.orientation=this.options.orientation==="vertical"?"vertical":"horizontal"},_normValueFromMouse:function(d){var c;if(this.orientation==="horizontal"){c=
+this.elementSize.width;d=d.x-this.elementOffset.left-(this._clickOffset?this._clickOffset.left:0)}else{c=this.elementSize.height;d=d.y-this.elementOffset.top-(this._clickOffset?this._clickOffset.top:0)}c=d/c;if(c>1)c=1;if(c<0)c=0;if(this.orientation==="vertical")c=1-c;d=this._valueMax()-this._valueMin();return this._trimAlignValue(this._valueMin()+c*d)},_start:function(d,c){var f={handle:this.handles[c],value:this.value()};if(this.options.values&&this.options.values.length){f.value=this.values(c);
+f.values=this.values()}return this._trigger("start",d,f)},_slide:function(d,c,f){var g;if(this.options.values&&this.options.values.length){g=this.values(c?0:1);if(this.options.values.length===2&&this.options.range===true&&(c===0&&f>g||c===1&&f<g))f=g;if(f!==this.values(c)){g=this.values();g[c]=f;d=this._trigger("slide",d,{handle:this.handles[c],value:f,values:g});this.values(c?0:1);d!==false&&this.values(c,f,true)}}else if(f!==this.value()){d=this._trigger("slide",d,{handle:this.handles[c],value:f});
+d!==false&&this.value(f)}},_stop:function(d,c){var f={handle:this.handles[c],value:this.value()};if(this.options.values&&this.options.values.length){f.value=this.values(c);f.values=this.values()}this._trigger("stop",d,f)},_change:function(d,c){if(!this._keySliding&&!this._mouseSliding){var f={handle:this.handles[c],value:this.value()};if(this.options.values&&this.options.values.length){f.value=this.values(c);f.values=this.values()}this._trigger("change",d,f)}},value:function(d){if(arguments.length){this.options.value=
+this._trimAlignValue(d);this._refreshValue();this._change(null,0)}else return this._value()},values:function(d,c){var f,g,e;if(arguments.length>1){this.options.values[d]=this._trimAlignValue(c);this._refreshValue();this._change(null,d)}else if(arguments.length)if(a.isArray(arguments[0])){f=this.options.values;g=arguments[0];for(e=0;e<f.length;e+=1){f[e]=this._trimAlignValue(g[e]);this._change(null,e)}this._refreshValue()}else return this.options.values&&this.options.values.length?this._values(d):
+this.value();else return this._values()},_setOption:function(d,c){var f,g=0;if(a.isArray(this.options.values))g=this.options.values.length;a.Widget.prototype._setOption.apply(this,arguments);switch(d){case "disabled":if(c){this.handles.filter(".ui-state-focus").blur();this.handles.removeClass("ui-state-hover");this.handles.attr("disabled","disabled");this.element.addClass("ui-disabled")}else{this.handles.removeAttr("disabled");this.element.removeClass("ui-disabled")}break;case "orientation":this._detectOrientation();
+this.element.removeClass("ui-slider-horizontal ui-slider-vertical").addClass("ui-slider-"+this.orientation);this._refreshValue();break;case "value":this._animateOff=true;this._refreshValue();this._change(null,0);this._animateOff=false;break;case "values":this._animateOff=true;this._refreshValue();for(f=0;f<g;f+=1)this._change(null,f);this._animateOff=false;break}},_value:function(){var d=this.options.value;return d=this._trimAlignValue(d)},_values:function(d){var c,f;if(arguments.length){c=this.options.values[d];
+return c=this._trimAlignValue(c)}else{c=this.options.values.slice();for(f=0;f<c.length;f+=1)c[f]=this._trimAlignValue(c[f]);return c}},_trimAlignValue:function(d){if(d<=this._valueMin())return this._valueMin();if(d>=this._valueMax())return this._valueMax();var c=this.options.step>0?this.options.step:1,f=(d-this._valueMin())%c;alignValue=d-f;if(Math.abs(f)*2>=c)alignValue+=f>0?c:-c;return parseFloat(alignValue.toFixed(5))},_valueMin:function(){return this.options.min},_valueMax:function(){return this.options.max},
+_refreshValue:function(){var d=this.options.range,c=this.options,f=this,g=!this._animateOff?c.animate:false,e,i={},b,h,j,l;if(this.options.values&&this.options.values.length)this.handles.each(function(o){e=(f.values(o)-f._valueMin())/(f._valueMax()-f._valueMin())*100;i[f.orientation==="horizontal"?"left":"bottom"]=e+"%";a(this).stop(1,1)[g?"animate":"css"](i,c.animate);if(f.options.range===true)if(f.orientation==="horizontal"){if(o===0)f.range.stop(1,1)[g?"animate":"css"]({left:e+"%"},c.animate);
+if(o===1)f.range[g?"animate":"css"]({width:e-b+"%"},{queue:false,duration:c.animate})}else{if(o===0)f.range.stop(1,1)[g?"animate":"css"]({bottom:e+"%"},c.animate);if(o===1)f.range[g?"animate":"css"]({height:e-b+"%"},{queue:false,duration:c.animate})}b=e});else{h=this.value();j=this._valueMin();l=this._valueMax();e=l!==j?(h-j)/(l-j)*100:0;i[f.orientation==="horizontal"?"left":"bottom"]=e+"%";this.handle.stop(1,1)[g?"animate":"css"](i,c.animate);if(d==="min"&&this.orientation==="horizontal")this.range.stop(1,
+1)[g?"animate":"css"]({width:e+"%"},c.animate);if(d==="max"&&this.orientation==="horizontal")this.range[g?"animate":"css"]({width:100-e+"%"},{queue:false,duration:c.animate});if(d==="min"&&this.orientation==="vertical")this.range.stop(1,1)[g?"animate":"css"]({height:e+"%"},c.animate);if(d==="max"&&this.orientation==="vertical")this.range[g?"animate":"css"]({height:100-e+"%"},{queue:false,duration:c.animate})}}});a.extend(a.ui.slider,{version:"1.8.13"})})(jQuery);
+(function(a,d){function c(){return++g}function f(){return++e}var g=0,e=0;a.widget("ui.tabs",{options:{add:null,ajaxOptions:null,cache:false,cookie:null,collapsible:false,disable:null,disabled:[],enable:null,event:"click",fx:null,idPrefix:"ui-tabs-",load:null,panelTemplate:"<div></div>",remove:null,select:null,show:null,spinner:"<em>Loading&#8230;</em>",tabTemplate:"<li><a href='#{href}'><span>#{label}</span></a></li>"},_create:function(){this._tabify(true)},_setOption:function(i,b){if(i=="selected")this.options.collapsible&&
+b==this.options.selected||this.select(b);else{this.options[i]=b;this._tabify()}},_tabId:function(i){return i.title&&i.title.replace(/\s/g,"_").replace(/[^\w\u00c0-\uFFFF-]/g,"")||this.options.idPrefix+c()},_sanitizeSelector:function(i){return i.replace(/:/g,"\\:")},_cookie:function(){var i=this.cookie||(this.cookie=this.options.cookie.name||"ui-tabs-"+f());return a.cookie.apply(null,[i].concat(a.makeArray(arguments)))},_ui:function(i,b){return{tab:i,panel:b,index:this.anchors.index(i)}},_cleanup:function(){this.lis.filter(".ui-state-processing").removeClass("ui-state-processing").find("span:data(label.tabs)").each(function(){var i=
+a(this);i.html(i.data("label.tabs")).removeData("label.tabs")})},_tabify:function(i){function b(r,u){r.css("display","");!a.support.opacity&&u.opacity&&r[0].style.removeAttribute("filter")}var h=this,j=this.options,l=/^#.+/;this.list=this.element.find("ol,ul").eq(0);this.lis=a(" > li:has(a[href])",this.list);this.anchors=this.lis.map(function(){return a("a",this)[0]});this.panels=a([]);this.anchors.each(function(r,u){var v=a(u).attr("href"),w=v.split("#")[0],x;if(w&&(w===location.toString().split("#")[0]||
+(x=a("base")[0])&&w===x.href)){v=u.hash;u.href=v}if(l.test(v))h.panels=h.panels.add(h.element.find(h._sanitizeSelector(v)));else if(v&&v!=="#"){a.data(u,"href.tabs",v);a.data(u,"load.tabs",v.replace(/#.*$/,""));v=h._tabId(u);u.href="#"+v;u=h.element.find("#"+v);if(!u.length){u=a(j.panelTemplate).attr("id",v).addClass("ui-tabs-panel ui-widget-content ui-corner-bottom").insertAfter(h.panels[r-1]||h.list);u.data("destroy.tabs",true)}h.panels=h.panels.add(u)}else j.disabled.push(r)});if(i){this.element.addClass("ui-tabs ui-widget ui-widget-content ui-corner-all");
+this.list.addClass("ui-tabs-nav ui-helper-reset ui-helper-clearfix ui-widget-header ui-corner-all");this.lis.addClass("ui-state-default ui-corner-top");this.panels.addClass("ui-tabs-panel ui-widget-content ui-corner-bottom");if(j.selected===d){location.hash&&this.anchors.each(function(r,u){if(u.hash==location.hash){j.selected=r;return false}});if(typeof j.selected!=="number"&&j.cookie)j.selected=parseInt(h._cookie(),10);if(typeof j.selected!=="number"&&this.lis.filter(".ui-tabs-selected").length)j.selected=
+this.lis.index(this.lis.filter(".ui-tabs-selected"));j.selected=j.selected||(this.lis.length?0:-1)}else if(j.selected===null)j.selected=-1;j.selected=j.selected>=0&&this.anchors[j.selected]||j.selected<0?j.selected:0;j.disabled=a.unique(j.disabled.concat(a.map(this.lis.filter(".ui-state-disabled"),function(r){return h.lis.index(r)}))).sort();a.inArray(j.selected,j.disabled)!=-1&&j.disabled.splice(a.inArray(j.selected,j.disabled),1);this.panels.addClass("ui-tabs-hide");this.lis.removeClass("ui-tabs-selected ui-state-active");
+if(j.selected>=0&&this.anchors.length){h.element.find(h._sanitizeSelector(h.anchors[j.selected].hash)).removeClass("ui-tabs-hide");this.lis.eq(j.selected).addClass("ui-tabs-selected ui-state-active");h.element.queue("tabs",function(){h._trigger("show",null,h._ui(h.anchors[j.selected],h.element.find(h._sanitizeSelector(h.anchors[j.selected].hash))[0]))});this.load(j.selected)}a(window).bind("unload",function(){h.lis.add(h.anchors).unbind(".tabs");h.lis=h.anchors=h.panels=null})}else j.selected=this.lis.index(this.lis.filter(".ui-tabs-selected"));
+this.element[j.collapsible?"addClass":"removeClass"]("ui-tabs-collapsible");j.cookie&&this._cookie(j.selected,j.cookie);i=0;for(var o;o=this.lis[i];i++)a(o)[a.inArray(i,j.disabled)!=-1&&!a(o).hasClass("ui-tabs-selected")?"addClass":"removeClass"]("ui-state-disabled");j.cache===false&&this.anchors.removeData("cache.tabs");this.lis.add(this.anchors).unbind(".tabs");if(j.event!=="mouseover"){var n=function(r,u){u.is(":not(.ui-state-disabled)")&&u.addClass("ui-state-"+r)},k=function(r,u){u.removeClass("ui-state-"+
+r)};this.lis.bind("mouseover.tabs",function(){n("hover",a(this))});this.lis.bind("mouseout.tabs",function(){k("hover",a(this))});this.anchors.bind("focus.tabs",function(){n("focus",a(this).closest("li"))});this.anchors.bind("blur.tabs",function(){k("focus",a(this).closest("li"))})}var m,p;if(j.fx)if(a.isArray(j.fx)){m=j.fx[0];p=j.fx[1]}else m=p=j.fx;var q=p?function(r,u){a(r).closest("li").addClass("ui-tabs-selected ui-state-active");u.hide().removeClass("ui-tabs-hide").animate(p,p.duration||"normal",
+function(){b(u,p);h._trigger("show",null,h._ui(r,u[0]))})}:function(r,u){a(r).closest("li").addClass("ui-tabs-selected ui-state-active");u.removeClass("ui-tabs-hide");h._trigger("show",null,h._ui(r,u[0]))},s=m?function(r,u){u.animate(m,m.duration||"normal",function(){h.lis.removeClass("ui-tabs-selected ui-state-active");u.addClass("ui-tabs-hide");b(u,m);h.element.dequeue("tabs")})}:function(r,u){h.lis.removeClass("ui-tabs-selected ui-state-active");u.addClass("ui-tabs-hide");h.element.dequeue("tabs")};
+this.anchors.bind(j.event+".tabs",function(){var r=this,u=a(r).closest("li"),v=h.panels.filter(":not(.ui-tabs-hide)"),w=h.element.find(h._sanitizeSelector(r.hash));if(u.hasClass("ui-tabs-selected")&&!j.collapsible||u.hasClass("ui-state-disabled")||u.hasClass("ui-state-processing")||h.panels.filter(":animated").length||h._trigger("select",null,h._ui(this,w[0]))===false){this.blur();return false}j.selected=h.anchors.index(this);h.abort();if(j.collapsible)if(u.hasClass("ui-tabs-selected")){j.selected=
+-1;j.cookie&&h._cookie(j.selected,j.cookie);h.element.queue("tabs",function(){s(r,v)}).dequeue("tabs");this.blur();return false}else if(!v.length){j.cookie&&h._cookie(j.selected,j.cookie);h.element.queue("tabs",function(){q(r,w)});h.load(h.anchors.index(this));this.blur();return false}j.cookie&&h._cookie(j.selected,j.cookie);if(w.length){v.length&&h.element.queue("tabs",function(){s(r,v)});h.element.queue("tabs",function(){q(r,w)});h.load(h.anchors.index(this))}else throw"jQuery UI Tabs: Mismatching fragment identifier.";
+a.browser.msie&&this.blur()});this.anchors.bind("click.tabs",function(){return false})},_getIndex:function(i){if(typeof i=="string")i=this.anchors.index(this.anchors.filter("[href$="+i+"]"));return i},destroy:function(){var i=this.options;this.abort();this.element.unbind(".tabs").removeClass("ui-tabs ui-widget ui-widget-content ui-corner-all ui-tabs-collapsible").removeData("tabs");this.list.removeClass("ui-tabs-nav ui-helper-reset ui-helper-clearfix ui-widget-header ui-corner-all");this.anchors.each(function(){var b=
+a.data(this,"href.tabs");if(b)this.href=b;var h=a(this).unbind(".tabs");a.each(["href","load","cache"],function(j,l){h.removeData(l+".tabs")})});this.lis.unbind(".tabs").add(this.panels).each(function(){a.data(this,"destroy.tabs")?a(this).remove():a(this).removeClass("ui-state-default ui-corner-top ui-tabs-selected ui-state-active ui-state-hover ui-state-focus ui-state-disabled ui-tabs-panel ui-widget-content ui-corner-bottom ui-tabs-hide")});i.cookie&&this._cookie(null,i.cookie);return this},add:function(i,
+b,h){if(h===d)h=this.anchors.length;var j=this,l=this.options;b=a(l.tabTemplate.replace(/#\{href\}/g,i).replace(/#\{label\}/g,b));i=!i.indexOf("#")?i.replace("#",""):this._tabId(a("a",b)[0]);b.addClass("ui-state-default ui-corner-top").data("destroy.tabs",true);var o=j.element.find("#"+i);o.length||(o=a(l.panelTemplate).attr("id",i).data("destroy.tabs",true));o.addClass("ui-tabs-panel ui-widget-content ui-corner-bottom ui-tabs-hide");if(h>=this.lis.length){b.appendTo(this.list);o.appendTo(this.list[0].parentNode)}else{b.insertBefore(this.lis[h]);
+o.insertBefore(this.panels[h])}l.disabled=a.map(l.disabled,function(n){return n>=h?++n:n});this._tabify();if(this.anchors.length==1){l.selected=0;b.addClass("ui-tabs-selected ui-state-active");o.removeClass("ui-tabs-hide");this.element.queue("tabs",function(){j._trigger("show",null,j._ui(j.anchors[0],j.panels[0]))});this.load(0)}this._trigger("add",null,this._ui(this.anchors[h],this.panels[h]));return this},remove:function(i){i=this._getIndex(i);var b=this.options,h=this.lis.eq(i).remove(),j=this.panels.eq(i).remove();
+if(h.hasClass("ui-tabs-selected")&&this.anchors.length>1)this.select(i+(i+1<this.anchors.length?1:-1));b.disabled=a.map(a.grep(b.disabled,function(l){return l!=i}),function(l){return l>=i?--l:l});this._tabify();this._trigger("remove",null,this._ui(h.find("a")[0],j[0]));return this},enable:function(i){i=this._getIndex(i);var b=this.options;if(a.inArray(i,b.disabled)!=-1){this.lis.eq(i).removeClass("ui-state-disabled");b.disabled=a.grep(b.disabled,function(h){return h!=i});this._trigger("enable",null,
+this._ui(this.anchors[i],this.panels[i]));return this}},disable:function(i){i=this._getIndex(i);var b=this.options;if(i!=b.selected){this.lis.eq(i).addClass("ui-state-disabled");b.disabled.push(i);b.disabled.sort();this._trigger("disable",null,this._ui(this.anchors[i],this.panels[i]))}return this},select:function(i){i=this._getIndex(i);if(i==-1)if(this.options.collapsible&&this.options.selected!=-1)i=this.options.selected;else return this;this.anchors.eq(i).trigger(this.options.event+".tabs");return this},
+load:function(i){i=this._getIndex(i);var b=this,h=this.options,j=this.anchors.eq(i)[0],l=a.data(j,"load.tabs");this.abort();if(!l||this.element.queue("tabs").length!==0&&a.data(j,"cache.tabs"))this.element.dequeue("tabs");else{this.lis.eq(i).addClass("ui-state-processing");if(h.spinner){var o=a("span",j);o.data("label.tabs",o.html()).html(h.spinner)}this.xhr=a.ajax(a.extend({},h.ajaxOptions,{url:l,success:function(n,k){b.element.find(b._sanitizeSelector(j.hash)).html(n);b._cleanup();h.cache&&a.data(j,
+"cache.tabs",true);b._trigger("load",null,b._ui(b.anchors[i],b.panels[i]));try{h.ajaxOptions.success(n,k)}catch(m){}},error:function(n,k){b._cleanup();b._trigger("load",null,b._ui(b.anchors[i],b.panels[i]));try{h.ajaxOptions.error(n,k,i,j)}catch(m){}}}));b.element.dequeue("tabs");return this}},abort:function(){this.element.queue([]);this.panels.stop(false,true);this.element.queue("tabs",this.element.queue("tabs").splice(-2,2));if(this.xhr){this.xhr.abort();delete this.xhr}this._cleanup();return this},
+url:function(i,b){this.anchors.eq(i).removeData("cache.tabs").data("load.tabs",b);return this},length:function(){return this.anchors.length}});a.extend(a.ui.tabs,{version:"1.8.13"});a.extend(a.ui.tabs.prototype,{rotation:null,rotate:function(i,b){var h=this,j=this.options,l=h._rotate||(h._rotate=function(o){clearTimeout(h.rotation);h.rotation=setTimeout(function(){var n=j.selected;h.select(++n<h.anchors.length?n:0)},i);o&&o.stopPropagation()});b=h._unrotate||(h._unrotate=!b?function(o){o.clientX&&
+h.rotate(null)}:function(){t=j.selected;l()});if(i){this.element.bind("tabsshow",l);this.anchors.bind(j.event+".tabs",b);l()}else{clearTimeout(h.rotation);this.element.unbind("tabsshow",l);this.anchors.unbind(j.event+".tabs",b);delete this._rotate;delete this._unrotate}return this}})})(jQuery);

js/jquery-ui.min.js

@@ -0,0 +1 @@
+jquery-ui-1.8.13.min.js

js/plugins/jqplot.BezierCurveRenderer.js

@@ -0,0 +1,312 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    // Class: $.jqplot.BezierCurveRenderer.js
+    // Renderer which draws lines as stacked bezier curves.
+    // Data for the line will not be specified as an array of
+    // [x, y] data point values, but as a an array of [start piont, bezier curve]
+    // So, the line is specified as: [[xstart, ystart], [cp1x, cp1y, cp2x, cp2y, xend, yend]].
+    $.jqplot.BezierCurveRenderer = function(){
+        $.jqplot.LineRenderer.call(this);
+    };
+    
+    $.jqplot.BezierCurveRenderer.prototype = new $.jqplot.LineRenderer();
+    $.jqplot.BezierCurveRenderer.prototype.constructor = $.jqplot.BezierCurveRenderer;
+
+    
+    // Method: setGridData
+    // converts the user data values to grid coordinates and stores them
+    // in the gridData array.
+    // Called with scope of a series.
+    $.jqplot.BezierCurveRenderer.prototype.setGridData = function(plot) {
+        // recalculate the grid data
+        var xp = this._xaxis.series_u2p;
+        var yp = this._yaxis.series_u2p;
+        // this._plotData should be same as this.data
+        var data = this.data;
+        this.gridData = [];
+        this._prevGridData = [];
+        // if seriesIndex = 0, fill to x axis.
+        // if seriesIndex > 0, fill to previous series data.
+        var idx = this.index;
+        if (data.length == 2) {
+            if (idx == 0) {
+                this.gridData = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[1][2]), yp.call(this._yaxis, data[1][3]),  
+                        xp.call(this._xaxis, data[1][4]), yp.call(this._yaxis, data[1][5])],
+                    [xp.call(this._xaxis, data[1][4]), yp.call(this._yaxis, this._yaxis.min)],
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, this._yaxis.min)]
+                ];
+            }
+            else {
+                var psd = plot.series[idx-1].data;
+                this.gridData = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[1][2]), yp.call(this._yaxis, data[1][3]),  
+                        xp.call(this._xaxis, data[1][4]), yp.call(this._yaxis, data[1][5])],
+                    [xp.call(this._xaxis, psd[1][4]), yp.call(this._yaxis, psd[1][5])],
+                    [xp.call(this._xaxis, psd[1][2]), yp.call(this._yaxis, psd[1][3]), 
+                        xp.call(this._xaxis, psd[1][0]), yp.call(this._yaxis, psd[1][1]),  
+                        xp.call(this._xaxis, psd[0][0]), yp.call(this._yaxis, psd[0][1])]
+                ];
+            }
+        }
+        else {
+            if (idx == 0) {
+                this.gridData = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[2][0]), yp.call(this._yaxis, data[2][1]),  
+                        xp.call(this._xaxis, data[3][0]), yp.call(this._yaxis, data[3][1])],
+                    [xp.call(this._xaxis, data[3][1]), yp.call(this._yaxis, this._yaxis.min)],
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, this._yaxis.min)]
+                ];
+            }
+            else {
+                var psd = plot.series[idx-1].data;
+                this.gridData = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[2][0]), yp.call(this._yaxis, data[2][1]),  
+                        xp.call(this._xaxis, data[3][0]), yp.call(this._yaxis, data[3][1])],
+                    [xp.call(this._xaxis, psd[3][0]), yp.call(this._yaxis, psd[3][1])],
+                    [xp.call(this._xaxis, psd[2][0]), yp.call(this._yaxis, psd[2][1]), 
+                        xp.call(this._xaxis, psd[1][0]), yp.call(this._yaxis, psd[1][1]),  
+                        xp.call(this._xaxis, psd[0][0]), yp.call(this._yaxis, psd[0][1])]
+                ];
+            }
+        }
+    };
+    
+    // Method: makeGridData
+    // converts any arbitrary data values to grid coordinates and
+    // returns them.  This method exists so that plugins can use a series'
+    // linerenderer to generate grid data points without overwriting the
+    // grid data associated with that series.
+    // Called with scope of a series.
+    $.jqplot.BezierCurveRenderer.prototype.makeGridData = function(data, plot) {
+        // recalculate the grid data
+        var xp = this._xaxis.series_u2p;
+        var yp = this._yaxis.series_u2p;
+        var gd = [];
+        var pgd = [];
+        // if seriesIndex = 0, fill to x axis.
+        // if seriesIndex > 0, fill to previous series data.
+        var idx = this.index;
+        if (data.length == 2) {
+            if (idx == 0) {
+                gd = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[1][2]), yp.call(this._yaxis, data[1][3]),  
+                        xp.call(this._xaxis, data[1][4]), yp.call(this._yaxis, data[1][5])],
+                    [xp.call(this._xaxis, data[1][4]), yp.call(this._yaxis, this._yaxis.min)],
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, this._yaxis.min)]
+                ];
+            }
+            else {
+                var psd = plot.series[idx-1].data;
+                gd = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[1][2]), yp.call(this._yaxis, data[1][3]),  
+                        xp.call(this._xaxis, data[1][4]), yp.call(this._yaxis, data[1][5])],
+                    [xp.call(this._xaxis, psd[1][4]), yp.call(this._yaxis, psd[1][5])],
+                    [xp.call(this._xaxis, psd[1][2]), yp.call(this._yaxis, psd[1][3]), 
+                        xp.call(this._xaxis, psd[1][0]), yp.call(this._yaxis, psd[1][1]),  
+                        xp.call(this._xaxis, psd[0][0]), yp.call(this._yaxis, psd[0][1])]
+                ];
+            }
+        }
+        else {
+            if (idx == 0) {
+                gd = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[2][0]), yp.call(this._yaxis, data[2][1]),  
+                        xp.call(this._xaxis, data[3][0]), yp.call(this._yaxis, data[3][1])],
+                    [xp.call(this._xaxis, data[3][1]), yp.call(this._yaxis, this._yaxis.min)],
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, this._yaxis.min)]
+                ];
+            }
+            else {
+                var psd = plot.series[idx-1].data;
+                gd = [
+                    [xp.call(this._xaxis, data[0][0]), yp.call(this._yaxis, data[0][1])], 
+                    [xp.call(this._xaxis, data[1][0]), yp.call(this._yaxis, data[1][1]), 
+                        xp.call(this._xaxis, data[2][0]), yp.call(this._yaxis, data[2][1]),  
+                        xp.call(this._xaxis, data[3][0]), yp.call(this._yaxis, data[3][1])],
+                    [xp.call(this._xaxis, psd[3][0]), yp.call(this._yaxis, psd[3][1])],
+                    [xp.call(this._xaxis, psd[2][0]), yp.call(this._yaxis, psd[2][1]), 
+                        xp.call(this._xaxis, psd[1][0]), yp.call(this._yaxis, psd[1][1]),  
+                        xp.call(this._xaxis, psd[0][0]), yp.call(this._yaxis, psd[0][1])]
+                ];
+            }
+        }
+        return gd;
+    };
+    
+
+    // called within scope of series.
+    $.jqplot.BezierCurveRenderer.prototype.draw = function(ctx, gd, options) {
+        var i;
+        ctx.save();
+        if (gd.length) {
+            if (this.showLine) {
+                ctx.save();
+                var opts = (options != null) ? options : {};
+                ctx.fillStyle = opts.fillStyle || this.color;
+                ctx.beginPath();
+                ctx.moveTo(gd[0][0], gd[0][1]);
+                ctx.bezierCurveTo(gd[1][0], gd[1][1], gd[1][2], gd[1][3], gd[1][4], gd[1][5]);
+                ctx.lineTo(gd[2][0], gd[2][1]);
+                if (gd[3].length == 2) {
+                    ctx.lineTo(gd[3][0], gd[3][1]);
+                }
+                else {
+                    ctx.bezierCurveTo(gd[3][0], gd[3][1], gd[3][2], gd[3][3], gd[3][4], gd[3][5]);
+                }
+                ctx.closePath();
+                ctx.fill();
+                ctx.restore();
+            }
+        }
+        
+        ctx.restore();
+    };  
+    
+    $.jqplot.BezierCurveRenderer.prototype.drawShadow = function(ctx, gd, options) {
+        // This is a no-op, shadows drawn with lines.
+    };
+    
+    $.jqplot.BezierAxisRenderer = function() {
+        $.jqplot.LinearAxisRenderer.call(this);
+    };
+    
+    $.jqplot.BezierAxisRenderer.prototype = new $.jqplot.LinearAxisRenderer();
+    $.jqplot.BezierAxisRenderer.prototype.constructor = $.jqplot.BezierAxisRenderer;
+        
+    
+    // Axes on a plot with Bezier Curves
+    $.jqplot.BezierAxisRenderer.prototype.init = function(options){
+        $.extend(true, this, options);
+        var db = this._dataBounds;
+        // Go through all the series attached to this axis and find
+        // the min/max bounds for this axis.
+        for (var i=0; i<this._series.length; i++) {
+            var s = this._series[i];
+            var d = s.data;  
+            if (d.length == 4) {
+                for (var j=0; j<d.length; j++) { 
+                    if (this.name == 'xaxis' || this.name == 'x2axis') {
+                        if (d[j][0] < db.min || db.min == null) {
+                            db.min = d[j][0];
+                        }
+                        if (d[j][0] > db.max || db.max == null) {
+                            db.max = d[j][0];
+                        }
+                    }              
+                    else {
+                        if (d[j][1] < db.min || db.min == null) {
+                            db.min = d[j][1];
+                        }
+                        if (d[j][1] > db.max || db.max == null) {
+                            db.max = d[j][1];
+                        }
+                    }              
+                }
+            }          
+            else {    
+                if (this.name == 'xaxis' || this.name == 'x2axis') {
+                    if (d[0][0] < db.min || db.min == null) {
+                        db.min = d[0][0];
+                    }
+                    if (d[0][0] > db.max || db.max == null) {
+                        db.max = d[0][0];
+                    }
+                    for (var j=0; j<5; j+=2) {
+                        if (d[1][j] < db.min || db.min == null) {
+                            db.min = d[1][j];
+                        }
+                        if (d[1][j] > db.max || db.max == null) {
+                            db.max = d[1][j];
+                        }
+                    }
+                }              
+                else {
+                    if (d[0][1] < db.min || db.min == null) {
+                        db.min = d[0][1];
+                    }
+                    if (d[0][1] > db.max || db.max == null) {
+                        db.max = d[0][1];
+                    }
+                    for (var j=1; j<6; j+=2) {
+                        if (d[1][j] < db.min || db.min == null) {
+                            db.min = d[1][j];
+                        }
+                        if (d[1][j] > db.max || db.max == null) {
+                            db.max = d[1][j];
+                        }
+                    }
+                }           
+            }
+        }
+    };
+    
+    // setup default renderers for axes and legend so user doesn't have to
+    // called with scope of plot
+    function preInit(target, data, options) {
+        options = options || {};
+        options.axesDefaults = $.extend(true, {pad:0}, options.axesDefaults);
+        options.legend = $.extend(true, {placement:'outside'}, options.legend);
+        // only set these if there is a pie series
+        var setopts = false;
+        if (options.seriesDefaults.renderer == $.jqplot.BezierCurveRenderer) {
+            setopts = true;
+        }
+        else if (options.series) {
+            for (var i=0; i < options.series.length; i++) {
+                if (options.series[i].renderer == $.jqplot.BezierCurveRenderer) {
+                    setopts = true;
+                }
+            }
+        }
+        
+        if (setopts) {
+            options.axesDefaults.renderer = $.jqplot.BezierAxisRenderer;
+        }
+    }
+    
+    $.jqplot.preInitHooks.push(preInit);
+    
+})(jQuery);    

js/plugins/jqplot.barRenderer.js

@@ -0,0 +1,709 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    
+    // Class: $.jqplot.BarRenderer
+    // A plugin renderer for jqPlot to draw a bar plot.
+    // Draws series as a line.
+    
+    $.jqplot.BarRenderer = function(){
+        $.jqplot.LineRenderer.call(this);
+    };
+    
+    $.jqplot.BarRenderer.prototype = new $.jqplot.LineRenderer();
+    $.jqplot.BarRenderer.prototype.constructor = $.jqplot.BarRenderer;
+    
+    // called with scope of series.
+    $.jqplot.BarRenderer.prototype.init = function(options, plot) {
+        // Group: Properties
+        //
+        // prop: barPadding
+        // Number of pixels between adjacent bars at the same axis value.
+        this.barPadding = 8;
+        // prop: barMargin
+        // Number of pixels between groups of bars at adjacent axis values.
+        this.barMargin = 10;
+        // prop: barDirection
+        // 'vertical' = up and down bars, 'horizontal' = side to side bars
+        this.barDirection = 'vertical';
+        // prop: barWidth
+        // Width of the bar in pixels (auto by devaul).  null = calculated automatically.
+        this.barWidth = null;
+        // prop: shadowOffset
+        // offset of the shadow from the slice and offset of 
+        // each succesive stroke of the shadow from the last.
+        this.shadowOffset = 2;
+        // prop: shadowDepth
+        // number of strokes to apply to the shadow, 
+        // each stroke offset shadowOffset from the last.
+        this.shadowDepth = 5;
+        // prop: shadowAlpha
+        // transparency of the shadow (0 = transparent, 1 = opaque)
+        this.shadowAlpha = 0.08;
+        // prop: waterfall
+        // true to enable waterfall plot.
+        this.waterfall = false;
+        // prop: groups
+        // group bars into this many groups
+        this.groups = 1;
+        // prop: varyBarColor
+        // true to color each bar of a series separately rather than
+        // have every bar of a given series the same color.
+        // If used for non-stacked multiple series bar plots, user should
+        // specify a separate 'seriesColors' array for each series.
+        // Otherwise, each series will set their bars to the same color array.
+        // This option has no Effect for stacked bar charts and is disabled.
+        this.varyBarColor = false;
+        // prop: highlightMouseOver
+        // True to highlight slice when moused over.
+        // This must be false to enable highlightMouseDown to highlight when clicking on a slice.
+        this.highlightMouseOver = true;
+        // prop: highlightMouseDown
+        // True to highlight when a mouse button is pressed over a slice.
+        // This will be disabled if highlightMouseOver is true.
+        this.highlightMouseDown = false;
+        // prop: highlightColors
+        // an array of colors to use when highlighting a bar.
+        this.highlightColors = [];
+        this._type = 'bar';
+        
+        // if user has passed in highlightMouseDown option and not set highlightMouseOver, disable highlightMouseOver
+        if (options.highlightMouseDown && options.highlightMouseOver == null) {
+            options.highlightMouseOver = false;
+        }
+        
+        $.extend(true, this, options);
+        // fill is still needed to properly draw the legend.
+        // bars have to be filled.
+        this.fill = true;
+        
+        if (this.waterfall) {
+            this.fillToZero = false;
+            this.disableStack = true;
+        }
+        
+        if (this.barDirection == 'vertical' ) {
+            this._primaryAxis = '_xaxis';
+            this._stackAxis = 'y';
+            this.fillAxis = 'y';
+        }
+        else {
+            this._primaryAxis = '_yaxis';
+            this._stackAxis = 'x';
+            this.fillAxis = 'x';
+        }
+        // index of the currenty highlighted point, if any
+        this._highlightedPoint = null;
+        // total number of values for all bar series, total number of bar series, and position of this series
+        this._plotSeriesInfo = null;
+        // Array of actual data colors used for each data point.
+        this._dataColors = [];
+        this._barPoints = [];
+        
+        // set the shape renderer options
+        var opts = {lineJoin:'miter', lineCap:'round', fill:true, isarc:false, strokeStyle:this.color, fillStyle:this.color, closePath:this.fill};
+        this.renderer.shapeRenderer.init(opts);
+        // set the shadow renderer options
+        var sopts = {lineJoin:'miter', lineCap:'round', fill:true, isarc:false, angle:this.shadowAngle, offset:this.shadowOffset, alpha:this.shadowAlpha, depth:this.shadowDepth, closePath:this.fill};
+        this.renderer.shadowRenderer.init(sopts);
+        
+        plot.postInitHooks.addOnce(postInit);
+        plot.postDrawHooks.addOnce(postPlotDraw);
+        plot.eventListenerHooks.addOnce('jqplotMouseMove', handleMove);
+        plot.eventListenerHooks.addOnce('jqplotMouseDown', handleMouseDown);
+        plot.eventListenerHooks.addOnce('jqplotMouseUp', handleMouseUp);
+        plot.eventListenerHooks.addOnce('jqplotClick', handleClick);
+        plot.eventListenerHooks.addOnce('jqplotRightClick', handleRightClick); 
+    };
+    
+    // called with scope of series
+    function barPreInit(target, data, seriesDefaults, options) {
+        if (this.rendererOptions.barDirection == 'horizontal') {
+            this._stackAxis = 'x';
+            this._primaryAxis = '_yaxis';
+        }
+        if (this.rendererOptions.waterfall == true) {
+            this._data = $.extend(true, [], this.data);
+            var sum = 0;
+            var pos = (!this.rendererOptions.barDirection || this.rendererOptions.barDirection == 'vertical') ? 1 : 0;
+            for(var i=0; i<this.data.length; i++) {
+                sum += this.data[i][pos];
+                if (i>0) {
+                    this.data[i][pos] += this.data[i-1][pos];
+                }
+            }
+            this.data[this.data.length] = (pos == 1) ? [this.data.length+1, sum] : [sum, this.data.length+1];
+            this._data[this._data.length] = (pos == 1) ? [this._data.length+1, sum] : [sum, this._data.length+1];
+        }
+        if (this.rendererOptions.groups > 1) {
+            this.breakOnNull = true;
+            var l = this.data.length;
+            var skip = parseInt(l/this.rendererOptions.groups, 10);
+            var count = 0;
+            for (var i=skip; i<l; i+=skip) {
+                this.data.splice(i+count, 0, [null, null]);
+                count++;
+            }
+            for (i=0; i<this.data.length; i++) {
+                if (this._primaryAxis == '_xaxis') {
+                    this.data[i][0] = i+1;
+                }
+                else {
+                    this.data[i][1] = i+1;
+                }
+            }
+        }
+    }
+    
+    $.jqplot.preSeriesInitHooks.push(barPreInit);
+    
+    // needs to be called with scope of series, not renderer.
+    $.jqplot.BarRenderer.prototype.calcSeriesNumbers = function() {
+        var nvals = 0;
+        var nseries = 0;
+        var paxis = this[this._primaryAxis];
+        var s, series, pos;
+        // loop through all series on this axis
+        for (var i=0; i < paxis._series.length; i++) {
+            series = paxis._series[i];
+            if (series === this) {
+                pos = i;
+            }
+            // is the series rendered as a bar?
+            if (series.renderer.constructor == $.jqplot.BarRenderer) {
+                // gridData may not be computed yet, use data length insted
+                nvals += series.data.length;
+                nseries += 1;
+            }
+        }
+        // return total number of values for all bar series, total number of bar series, and position of this series
+        return [nvals, nseries, pos];
+    };
+
+    $.jqplot.BarRenderer.prototype.setBarWidth = function() {
+        // need to know how many data values we have on the approprate axis and figure it out.
+        var i;
+        var nvals = 0;
+        var nseries = 0;
+        var paxis = this[this._primaryAxis];
+        var s, series, pos;
+        var temp = this._plotSeriesInfo = this.renderer.calcSeriesNumbers.call(this);
+        nvals = temp[0];
+        nseries = temp[1];
+        var nticks = paxis.numberTicks;
+        var nbins = (nticks-1)/2;
+        // so, now we have total number of axis values.
+        if (paxis.name == 'xaxis' || paxis.name == 'x2axis') {
+            if (this._stack) {
+                this.barWidth = (paxis._offsets.max - paxis._offsets.min) / nvals * nseries - this.barMargin;
+            }
+            else {
+                this.barWidth = ((paxis._offsets.max - paxis._offsets.min)/nbins  - this.barPadding * (nseries-1) - this.barMargin*2)/nseries;
+                // this.barWidth = (paxis._offsets.max - paxis._offsets.min) / nvals - this.barPadding - this.barMargin/nseries;
+            }
+        }
+        else {
+            if (this._stack) {
+                this.barWidth = (paxis._offsets.min - paxis._offsets.max) / nvals * nseries - this.barMargin;
+            }
+            else {
+                this.barWidth = ((paxis._offsets.min - paxis._offsets.max)/nbins  - this.barPadding * (nseries-1) - this.barMargin*2)/nseries;
+                // this.barWidth = (paxis._offsets.min - paxis._offsets.max) / nvals - this.barPadding - this.barMargin/nseries;
+            }
+        }
+        return [nvals, nseries];
+    };
+
+    function computeHighlightColors (colors) {
+        var ret = [];
+        for (var i=0; i<colors.length; i++){
+            var rgba = $.jqplot.getColorComponents(colors[i]);
+            var newrgb = [rgba[0], rgba[1], rgba[2]];
+            var sum = newrgb[0] + newrgb[1] + newrgb[2];
+            for (var j=0; j<3; j++) {
+                // when darkening, lowest color component can be is 60.
+                newrgb[j] = (sum > 570) ?  newrgb[j] * 0.8 : newrgb[j] + 0.3 * (255 - newrgb[j]);
+                newrgb[j] = parseInt(newrgb[j], 10);
+            }
+            ret.push('rgb('+newrgb[0]+','+newrgb[1]+','+newrgb[2]+')');
+        }
+        return ret;
+    }
+    
+    $.jqplot.BarRenderer.prototype.draw = function(ctx, gridData, options) {
+        var i;
+        // Ughhh, have to make a copy of options b/c it may be modified later.
+        var opts = $.extend({}, options);
+        var shadow = (opts.shadow != undefined) ? opts.shadow : this.shadow;
+        var showLine = (opts.showLine != undefined) ? opts.showLine : this.showLine;
+        var fill = (opts.fill != undefined) ? opts.fill : this.fill;
+        var xaxis = this.xaxis;
+        var yaxis = this.yaxis;
+        var xp = this._xaxis.series_u2p;
+        var yp = this._yaxis.series_u2p;
+        var pointx, pointy;
+        // clear out data colors.
+        this._dataColors = [];
+        this._barPoints = [];
+        
+        if (this.barWidth == null) {
+            this.renderer.setBarWidth.call(this);
+        }
+        
+        var temp = this._plotSeriesInfo = this.renderer.calcSeriesNumbers.call(this);
+        var nvals = temp[0];
+        var nseries = temp[1];
+        var pos = temp[2];
+		var points = [];
+        
+        if (this._stack) {
+            this._barNudge = 0;
+        }
+        else {
+            this._barNudge = (-Math.abs(nseries/2 - 0.5) + pos) * (this.barWidth + this.barPadding);
+        }
+        if (showLine) {
+            var negativeColors = new $.jqplot.ColorGenerator(this.negativeSeriesColors);
+            var positiveColors = new $.jqplot.ColorGenerator(this.seriesColors);
+            var negativeColor = negativeColors.get(this.index);
+            if (! this.useNegativeColors) {
+                negativeColor = opts.fillStyle;
+            }
+            var positiveColor = opts.fillStyle;
+			var base;
+			var xstart; 
+			var ystart;
+            
+            if (this.barDirection == 'vertical') {
+                for (var i=0; i<gridData.length; i++) {
+                    if (this.data[i][1] == null) {
+                        continue;
+                    }
+                    points = [];
+                    base = gridData[i][0] + this._barNudge;
+                    ystart;
+                    
+                    // stacked
+                    if (this._stack && this._prevGridData.length) {
+                        ystart = this._prevGridData[i][1];
+                    }
+                    // not stacked and first series in stack
+                    else {
+                        if (this.fillToZero) {
+                            ystart = this._yaxis.series_u2p(0);
+                        }
+                        else if (this.waterfall && i > 0 && i < this.gridData.length-1) {
+                            ystart = this.gridData[i-1][1];
+                        }
+                        else if (this.waterfall && i == 0 && i < this.gridData.length-1) {
+                            if (this._yaxis.min <= 0 && this._yaxis.max >= 0) {
+                                ystart = this._yaxis.series_u2p(0);
+                            }
+                            else if (this._yaxis.min > 0) {
+                                ystart = ctx.canvas.height;
+                            }
+                            else {
+                                ystart = 0;
+                            }
+                        }
+                        else if (this.waterfall && i == this.gridData.length - 1) {
+                            if (this._yaxis.min <= 0 && this._yaxis.max >= 0) {
+                                ystart = this._yaxis.series_u2p(0);
+                            }
+                            else if (this._yaxis.min > 0) {
+                                ystart = ctx.canvas.height;
+                            }
+                            else {
+                                ystart = 0;
+                            }
+                        }
+                        else {
+                            ystart = ctx.canvas.height;
+                        }
+                    }
+                    if ((this.fillToZero && this._plotData[i][1] < 0) || (this.waterfall && this._data[i][1] < 0)) {
+                        if (this.varyBarColor && !this._stack) {
+                            if (this.useNegativeColors) {
+                                opts.fillStyle = negativeColors.next();
+                            }
+                            else {
+                                opts.fillStyle = positiveColors.next();
+                            }
+                        }
+                        else {
+                            opts.fillStyle = negativeColor;
+                        }
+                    }
+                    else {
+                        if (this.varyBarColor && !this._stack) {
+                            opts.fillStyle = positiveColors.next();
+                        }
+                        else {
+                            opts.fillStyle = positiveColor;
+                        }
+                    }
+					
+					if (!this.fillToZero || this._plotData[i][1] >= 0) { 
+						points.push([base-this.barWidth/2, ystart]);
+						points.push([base-this.barWidth/2, gridData[i][1]]);
+						points.push([base+this.barWidth/2, gridData[i][1]]);
+						points.push([base+this.barWidth/2, ystart]);
+					}
+					// for negative bars make sure points are always ordered clockwise
+					else {              
+						points.push([base-this.barWidth/2, gridData[i][1]]);
+						points.push([base-this.barWidth/2, ystart]);
+						points.push([base+this.barWidth/2, ystart]);
+						points.push([base+this.barWidth/2, gridData[i][1]]);
+					}
+                    this._barPoints.push(points);
+                    // now draw the shadows if not stacked.
+                    // for stacked plots, they are predrawn by drawShadow
+                    if (shadow && !this._stack) {
+                        var sopts = $.extend(true, {}, opts);
+                        // need to get rid of fillStyle on shadow.
+                        delete sopts.fillStyle;
+                        this.renderer.shadowRenderer.draw(ctx, points, sopts);
+                    }
+                    var clr = opts.fillStyle || this.color;
+                    this._dataColors.push(clr);
+                    this.renderer.shapeRenderer.draw(ctx, points, opts); 
+                }
+            }
+            
+            else if (this.barDirection == 'horizontal'){
+                for (var i=0; i<gridData.length; i++) {
+                    if (this.data[i][0] == null) {
+                        continue;
+                    }
+                    points = [];
+                    base = gridData[i][1] - this._barNudge;
+                    xstart;
+                    
+                    if (this._stack && this._prevGridData.length) {
+                        xstart = this._prevGridData[i][0];
+                    }
+                    // not stacked and first series in stack
+                    else {
+                        if (this.fillToZero) {
+                            xstart = this._xaxis.series_u2p(0);
+                        }
+                        else if (this.waterfall && i > 0 && i < this.gridData.length-1) {
+                            xstart = this.gridData[i-1][1];
+                        }
+                        else if (this.waterfall && i == 0 && i < this.gridData.length-1) {
+                            if (this._xaxis.min <= 0 && this._xaxis.max >= 0) {
+                                xstart = this._xaxis.series_u2p(0);
+                            }
+                            else if (this._xaxis.min > 0) {
+                                xstart = 0;
+                            }
+                            else {
+                                xstart = ctx.canvas.width;
+                            }
+                        }
+                        else if (this.waterfall && i == this.gridData.length - 1) {
+                            if (this._xaxis.min <= 0 && this._xaxis.max >= 0) {
+                                xstart = this._xaxis.series_u2p(0);
+                            }
+                            else if (this._xaxis.min > 0) {
+                                xstart = 0;
+                            }
+                            else {
+                                xstart = ctx.canvas.width;
+                            }
+                        }
+                        else {
+                            xstart = 0;
+                        }
+                    }
+                    if ((this.fillToZero && this._plotData[i][1] < 0) || (this.waterfall && this._data[i][1] < 0)) {
+                        if (this.varyBarColor && !this._stack) {
+                            if (this.useNegativeColors) {
+                                opts.fillStyle = negativeColors.next();
+                            }
+                            else {
+                                opts.fillStyle = positiveColors.next();
+                            }
+                        }
+                    }
+                    else {
+                        if (this.varyBarColor && !this._stack) {
+                            opts.fillStyle = positiveColors.next();
+                        }
+                        else {
+                            opts.fillStyle = positiveColor;
+                        }                    
+                    }
+                    
+                    points.push([xstart, base+this.barWidth/2]);
+                    points.push([xstart, base-this.barWidth/2]);
+                    points.push([gridData[i][0], base-this.barWidth/2]);
+                    points.push([gridData[i][0], base+this.barWidth/2]);
+                    this._barPoints.push(points);
+                    // now draw the shadows if not stacked.
+                    // for stacked plots, they are predrawn by drawShadow
+                    if (shadow && !this._stack) {
+                        var sopts = $.extend(true, {}, opts);
+                        delete sopts.fillStyle;
+                        this.renderer.shadowRenderer.draw(ctx, points, sopts);
+                    }
+                    var clr = opts.fillStyle || this.color;
+                    this._dataColors.push(clr);
+                    this.renderer.shapeRenderer.draw(ctx, points, opts); 
+                }  
+            }
+        }                
+        
+        if (this.highlightColors.length == 0) {
+            this.highlightColors = computeHighlightColors(this._dataColors);
+        }
+        
+        else if (typeof(this.highlightColors) == 'string') {
+            var temp = this.highlightColors;
+            this.highlightColors = [];
+            for (var i=0; i<this._dataColors.length; i++) {
+                this.highlightColors.push(temp);
+            }
+        }
+        
+    };
+    
+     
+    // for stacked plots, shadows will be pre drawn by drawShadow.
+    $.jqplot.BarRenderer.prototype.drawShadow = function(ctx, gridData, options) {
+        var i;
+        var opts = (options != undefined) ? options : {};
+        var shadow = (opts.shadow != undefined) ? opts.shadow : this.shadow;
+        var showLine = (opts.showLine != undefined) ? opts.showLine : this.showLine;
+        var fill = (opts.fill != undefined) ? opts.fill : this.fill;
+        var xaxis = this.xaxis;
+        var yaxis = this.yaxis;
+        var xp = this._xaxis.series_u2p;
+        var yp = this._yaxis.series_u2p;
+        var pointx, points, pointy, nvals, nseries, pos;
+        
+        if (this._stack && this.shadow) {
+            if (this.barWidth == null) {
+                this.renderer.setBarWidth.call(this);
+            }
+        
+            var temp = this._plotSeriesInfo = this.renderer.calcSeriesNumbers.call(this);
+            nvals = temp[0];
+            nseries = temp[1];
+            pos = temp[2];
+        
+            if (this._stack) {
+                this._barNudge = 0;
+            }
+            else {
+                this._barNudge = (-Math.abs(nseries/2 - 0.5) + pos) * (this.barWidth + this.barPadding);
+            }
+            if (showLine) {
+            
+                if (this.barDirection == 'vertical') {
+                    for (var i=0; i<gridData.length; i++) {
+                        if (this.data[i][1] == null) {
+                            continue;
+                        }
+                        points = [];
+                        var base = gridData[i][0] + this._barNudge;
+                        var ystart;
+                    
+                        if (this._stack && this._prevGridData.length) {
+                            ystart = this._prevGridData[i][1];
+                        }
+                        else {
+                            if (this.fillToZero) {
+                                ystart = this._yaxis.series_u2p(0);
+                            }
+                            else {
+                                ystart = ctx.canvas.height;
+                            }
+                        }
+                    
+                        points.push([base-this.barWidth/2, ystart]);
+                        points.push([base-this.barWidth/2, gridData[i][1]]);
+                        points.push([base+this.barWidth/2, gridData[i][1]]);
+                        points.push([base+this.barWidth/2, ystart]);
+                        this.renderer.shadowRenderer.draw(ctx, points, opts);
+                    }
+                }
+            
+                else if (this.barDirection == 'horizontal'){
+                    for (var i=0; i<gridData.length; i++) {
+                        if (this.data[i][0] == null) {
+                            continue;
+                        }
+                        points = [];
+                        var base = gridData[i][1] - this._barNudge;
+                        var xstart;
+                    
+                        if (this._stack && this._prevGridData.length) {
+                            xstart = this._prevGridData[i][0];
+                        }
+                        else {
+                            xstart = 0;
+                        }
+                    
+                        points.push([xstart, base+this.barWidth/2]);
+                        points.push([gridData[i][0], base+this.barWidth/2]);
+                        points.push([gridData[i][0], base-this.barWidth/2]);
+                        points.push([xstart, base-this.barWidth/2]);
+                        this.renderer.shadowRenderer.draw(ctx, points, opts);
+                    }  
+                }
+            }   
+            
+        }
+    };
+    
+    function postInit(target, data, options) {
+        for (var i=0; i<this.series.length; i++) {
+            if (this.series[i].renderer.constructor == $.jqplot.BarRenderer) {
+                // don't allow mouseover and mousedown at same time.
+                if (this.series[i].highlightMouseOver) {
+                    this.series[i].highlightMouseDown = false;
+                }
+            }
+        }
+        this.target.bind('mouseout', {plot:this}, function (ev) { unhighlight(ev.data.plot); });
+    }
+    
+    // called within context of plot
+    // create a canvas which we can draw on.
+    // insert it before the eventCanvas, so eventCanvas will still capture events.
+    function postPlotDraw() {
+        // Memory Leaks patch    
+        if (this.plugins.barRenderer && this.plugins.barRenderer.highlightCanvas) {
+
+            this.plugins.barRenderer.highlightCanvas.resetCanvas();
+            this.plugins.barRenderer.highlightCanvas = null;
+        }
+         
+        this.plugins.barRenderer = {highlightedSeriesIndex:null};
+        this.plugins.barRenderer.highlightCanvas = new $.jqplot.GenericCanvas();
+        
+        this.eventCanvas._elem.before(this.plugins.barRenderer.highlightCanvas.createElement(this._gridPadding, 'jqplot-barRenderer-highlight-canvas', this._plotDimensions, this));
+        this.plugins.barRenderer.highlightCanvas.setContext();
+    }   
+    
+    function highlight (plot, sidx, pidx, points) {
+        var s = plot.series[sidx];
+        var canvas = plot.plugins.barRenderer.highlightCanvas;
+        canvas._ctx.clearRect(0,0,canvas._ctx.canvas.width, canvas._ctx.canvas.height);
+        s._highlightedPoint = pidx;
+        plot.plugins.barRenderer.highlightedSeriesIndex = sidx;
+        var opts = {fillStyle: s.highlightColors[pidx]};
+        s.renderer.shapeRenderer.draw(canvas._ctx, points, opts);
+        canvas = null;
+    }
+    
+    function unhighlight (plot) {
+        var canvas = plot.plugins.barRenderer.highlightCanvas;
+        canvas._ctx.clearRect(0,0, canvas._ctx.canvas.width, canvas._ctx.canvas.height);
+        for (var i=0; i<plot.series.length; i++) {
+            plot.series[i]._highlightedPoint = null;
+        }
+        plot.plugins.barRenderer.highlightedSeriesIndex = null;
+        plot.target.trigger('jqplotDataUnhighlight');
+        canvas =  null;
+    }
+    
+    
+    function handleMove(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var ins = [neighbor.seriesIndex, neighbor.pointIndex, neighbor.data];
+            var evt1 = jQuery.Event('jqplotDataMouseOver');
+            evt1.pageX = ev.pageX;
+            evt1.pageY = ev.pageY;
+            plot.target.trigger(evt1, ins);
+            if (plot.series[ins[0]].highlightMouseOver && !(ins[0] == plot.plugins.barRenderer.highlightedSeriesIndex && ins[1] == plot.series[ins[0]]._highlightedPoint)) {
+                var evt = jQuery.Event('jqplotDataHighlight');
+                evt.pageX = ev.pageX;
+                evt.pageY = ev.pageY;
+                plot.target.trigger(evt, ins);
+                highlight (plot, neighbor.seriesIndex, neighbor.pointIndex, neighbor.points);
+            }
+        }
+        else if (neighbor == null) {
+            unhighlight (plot);
+        }
+    }
+    
+    function handleMouseDown(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var ins = [neighbor.seriesIndex, neighbor.pointIndex, neighbor.data];
+            if (plot.series[ins[0]].highlightMouseDown && !(ins[0] == plot.plugins.barRenderer.highlightedSeriesIndex && ins[1] == plot.series[ins[0]]._highlightedPoint)) {
+                var evt = jQuery.Event('jqplotDataHighlight');
+                evt.pageX = ev.pageX;
+                evt.pageY = ev.pageY;
+                plot.target.trigger(evt, ins);
+                highlight (plot, neighbor.seriesIndex, neighbor.pointIndex, neighbor.points);
+            }
+        }
+        else if (neighbor == null) {
+            unhighlight (plot);
+        }
+    }
+    
+    function handleMouseUp(ev, gridpos, datapos, neighbor, plot) {
+        var idx = plot.plugins.barRenderer.highlightedSeriesIndex;
+        if (idx != null && plot.series[idx].highlightMouseDown) {
+            unhighlight(plot);
+        }
+    }
+    
+    function handleClick(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var ins = [neighbor.seriesIndex, neighbor.pointIndex, neighbor.data];
+            var evt = jQuery.Event('jqplotDataClick');
+            evt.pageX = ev.pageX;
+            evt.pageY = ev.pageY;
+            plot.target.trigger(evt, ins);
+        }
+    }
+    
+    function handleRightClick(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var ins = [neighbor.seriesIndex, neighbor.pointIndex, neighbor.data];
+            var idx = plot.plugins.barRenderer.highlightedSeriesIndex;
+            if (idx != null && plot.series[idx].highlightMouseDown) {
+                unhighlight(plot);
+            }
+            var evt = jQuery.Event('jqplotDataRightClick');
+            evt.pageX = ev.pageX;
+            evt.pageY = ev.pageY;
+            plot.target.trigger(evt, ins);
+        }
+    }
+    
+    
+})(jQuery);    

js/plugins/jqplot.blockRenderer.js

@@ -0,0 +1,234 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    /**
+     * Class: $.jqplot.BlockRenderer
+     * Plugin renderer to draw a x-y block chart.  A Block chart has data points displayed as
+     * colored squares with a text label inside.  Data must be supplied in the form:
+     * 
+     * > [[x1, y1, "label 1", {css}], [x2, y2, "label 2", {css}], ...]
+     * 
+     * The label and css object are optional.  If the label is ommitted, the
+     * box will collapse unless a css height and/or width is specified.
+     * 
+     * The css object is an object specifying css properties 
+     * such as:
+     * 
+     * > {background:'#4f98a5', border:'3px solid gray', padding:'1px'}
+     * 
+     * Note that css properties specified with the data point override defaults
+     * specified with the series.
+     * 
+     */
+    $.jqplot.BlockRenderer = function(){
+        $.jqplot.LineRenderer.call(this);
+    };
+    
+    $.jqplot.BlockRenderer.prototype = new $.jqplot.LineRenderer();
+    $.jqplot.BlockRenderer.prototype.constructor = $.jqplot.BlockRenderer;
+    
+    // called with scope of a series
+    $.jqplot.BlockRenderer.prototype.init = function(options) {
+        // Group: Properties
+        //
+        // prop: css
+        // default css styles that will be applied to all data blocks.
+        // these values will be overridden by css styles supplied with the
+        // individulal data points.
+        this.css = {padding:'2px', border:'1px solid #999', textAlign:'center'};
+        // prop: escapeHtml
+        // true to escape html in the box label.
+        this.escapeHtml = false;
+        // prop: insertBreaks
+        // true to turn spaces in data block label into html breaks <br />.
+        this.insertBreaks = true;
+        // prop: varyBlockColors
+        // true to vary the color of each block in this series according to
+        // the seriesColors array.  False to set each block to the color
+        // specified on this series.  This has no effect if a css background color
+        // option is specified in the renderer css options.
+        this.varyBlockColors = false;
+        $.extend(true, this, options);
+        if (this.css.backgroundColor) {
+            this.color = this.css.backgroundColor;
+        }
+        else if (this.css.background) {
+            this.color = this.css.background;
+        }
+        else if (!this.varyBlockColors) {
+            this.css.background = this.color;
+        }
+        this.canvas = new $.jqplot.BlockCanvas();
+        this.shadowCanvas =  new $.jqplot.BlockCanvas();
+        this.canvas._plotDimensions = this._plotDimensions;
+        this.shadowCanvas._plotDimensions = this._plotDimensions;
+        this._type = 'block';
+        
+        // group: Methods 
+        //
+        // Method: moveBlock
+        // Moves an individual block.  More efficient than redrawing
+        // the whole series by calling plot.drawSeries().
+        // Properties:
+        // idx - the 0 based index of the block or point in this series.
+        // x - the x coordinate in data units (value on x axis) to move the block to.
+        // y - the y coordinate in data units (value on the y axis) to move the block to.
+        // duration - optional parameter to create an animated movement.  Can be a
+        // number (higher is slower animation) or 'fast', 'normal' or 'slow'.  If not
+        // provided, the element is moved without any animation.
+        this.moveBlock = function (idx, x, y, duration) {
+            // update plotData, stackData, data and gridData
+            // x and y are in data coordinates.
+            var el = this.canvas._elem.children(':eq('+idx+')');
+            this.data[idx][0] = x;
+            this.data[idx][1] = y;
+            this._plotData[idx][0] = x;
+            this._plotData[idx][1] = y;
+            this._stackData[idx][0] = x;
+            this._stackData[idx][1] = y;
+            this.gridData[idx][0] = this._xaxis.series_u2p(x);
+            this.gridData[idx][1] = this._yaxis.series_u2p(y);
+            var w = el.outerWidth();
+            var h = el.outerHeight();
+            var left = this.gridData[idx][0] - w/2 + 'px';
+            var top = this.gridData[idx][1] - h/2 + 'px';
+            if (duration) {
+                if (parseInt(duration, 10)) {
+                    duration = parseInt(duration, 10);
+                }
+                el.animate({left:left, top:top}, duration);
+            }
+            else {
+                el.css({left:left, top:top});
+            }
+            el = null;
+        };
+    };
+    
+    // called with scope of series
+    $.jqplot.BlockRenderer.prototype.draw = function (ctx, gd, options) {
+        if (this.plugins.pointLabels) {
+            this.plugins.pointLabels.show = false;
+        }
+        var i, el, d, gd, t, css, w, h, left, top;
+        var opts = (options != undefined) ? options : {};
+        var colorGenerator = new $.jqplot.ColorGenerator(this.seriesColors);
+        this.canvas._elem.empty();
+        for (i=0; i<this.gridData.length; i++) {
+            d = this.data[i];
+            gd = this.gridData[i];
+            t = '';
+            css = {};
+            if (typeof d[2] == 'string') {
+                t = d[2];
+            }
+            else if (typeof d[2] == 'object') {
+                css = d[2];
+            }
+            if (typeof d[3] ==  'object') {
+                css = d[3];
+            }
+            if (this.insertBreaks){ 
+                t = t.replace(/ /g, '<br />');
+            }
+            css = $.extend(true, {}, this.css, css);
+            // create a div
+            el = $('<div style="position:absolute;margin-left:auto;margin-right:auto;"></div>');
+            this.canvas._elem.append(el);
+            // set text
+            this.escapeHtml ? el.text(t) : el.html(t);
+            // style it
+            // remove styles we don't want overridden.
+            delete css.position;
+            delete css.marginRight;
+            delete css.marginLeft;
+            if (!css.background && !css.backgroundColor && !css.backgroundImage){ 
+                css.background = colorGenerator.next();
+            }
+            el.css(css);
+            w = el.outerWidth();
+            h = el.outerHeight();
+            left = gd[0] - w/2 + 'px';
+            top = gd[1] - h/2 + 'px';
+            el.css({left:left, top:top});
+            el = null;
+        }
+    };
+    
+    $.jqplot.BlockCanvas = function() {
+        $.jqplot.ElemContainer.call(this);
+        this._ctx;  
+    };
+    
+    $.jqplot.BlockCanvas.prototype = new $.jqplot.ElemContainer();
+    $.jqplot.BlockCanvas.prototype.constructor = $.jqplot.BlockCanvas;
+    
+    $.jqplot.BlockCanvas.prototype.createElement = function(offsets, clss, plotDimensions) {
+        this._offsets = offsets;
+        var klass = 'jqplot-blockCanvas';
+        if (clss != undefined) {
+            klass = clss;
+        }
+        var elem;
+        // if this canvas already has a dom element, don't make a new one.
+        if (this._elem) {
+            elem = this._elem.get(0);
+        }
+        else {
+            elem = document.createElement('div');
+        }
+        // if new plotDimensions supplied, use them.
+        if (plotDimensions != undefined) {
+            this._plotDimensions = plotDimensions;
+        }
+        
+        var w = this._plotDimensions.width - this._offsets.left - this._offsets.right + 'px';
+        var h = this._plotDimensions.height - this._offsets.top - this._offsets.bottom + 'px';
+        this._elem = $(elem);
+        this._elem.css({ position: 'absolute', width:w, height:h, left: this._offsets.left, top: this._offsets.top });
+        
+        this._elem.addClass(klass);
+        return this._elem;
+    };
+    
+    $.jqplot.BlockCanvas.prototype.setContext = function() {
+        this._ctx = {
+            canvas:{
+                width:0,
+                height:0
+            },
+            clearRect:function(){return null;}
+        };
+        return this._ctx;
+    };
+    
+})(jQuery);
+    
+    

js/plugins/jqplot.blockRenderer.min.js

@@ -0,0 +1,30 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function(a){a.jqplot.BlockRenderer=function(){a.jqplot.LineRenderer.call(this)};a.jqplot.BlockRenderer.prototype=new a.jqplot.LineRenderer();a.jqplot.BlockRenderer.prototype.constructor=a.jqplot.BlockRenderer;a.jqplot.BlockRenderer.prototype.init=function(b){this.css={padding:"2px",border:"1px solid #999",textAlign:"center"};this.escapeHtml=false;this.insertBreaks=true;this.varyBlockColors=false;a.extend(true,this,b);if(this.css.backgroundColor){this.color=this.css.backgroundColor}else{if(this.css.background){this.color=this.css.background}else{if(!this.varyBlockColors){this.css.background=this.color}}}this.canvas=new a.jqplot.BlockCanvas();this.shadowCanvas=new a.jqplot.BlockCanvas();this.canvas._plotDimensions=this._plotDimensions;this.shadowCanvas._plotDimensions=this._plotDimensions;this._type="block";this.moveBlock=function(l,j,i,e){var c=this.canvas._elem.children(":eq("+l+")");this.data[l][0]=j;this.data[l][1]=i;this._plotData[l][0]=j;this._plotData[l][1]=i;this._stackData[l][0]=j;this._stackData[l][1]=i;this.gridData[l][0]=this._xaxis.series_u2p(j);this.gridData[l][1]=this._yaxis.series_u2p(i);var k=c.outerWidth();var f=c.outerHeight();var d=this.gridData[l][0]-k/2+"px";var g=this.gridData[l][1]-f/2+"px";if(e){if(parseInt(e,10)){e=parseInt(e,10)}c.animate({left:d,top:g},e)}else{c.css({left:d,top:g})}c=null}};a.jqplot.BlockRenderer.prototype.draw=function(q,o,r){if(this.plugins.pointLabels){this.plugins.pointLabels.show=false}var f,c,l,o,p,k,n,g,e,m;var b=(r!=undefined)?r:{};var j=new a.jqplot.ColorGenerator(this.seriesColors);this.canvas._elem.empty();for(f=0;f<this.gridData.length;f++){l=this.data[f];o=this.gridData[f];p="";k={};if(typeof l[2]=="string"){p=l[2]}else{if(typeof l[2]=="object"){k=l[2]}}if(typeof l[3]=="object"){k=l[3]}if(this.insertBreaks){p=p.replace(/ /g,"<br />")}k=a.extend(true,{},this.css,k);c=a('<div style="position:absolute;margin-left:auto;margin-right:auto;"></div>');this.canvas._elem.append(c);this.escapeHtml?c.text(p):c.html(p);delete k.position;delete k.marginRight;delete k.marginLeft;if(!k.background&&!k.backgroundColor&&!k.backgroundImage){k.background=j.next()}c.css(k);n=c.outerWidth();g=c.outerHeight();e=o[0]-n/2+"px";m=o[1]-g/2+"px";c.css({left:e,top:m});c=null}};a.jqplot.BlockCanvas=function(){a.jqplot.ElemContainer.call(this);this._ctx};a.jqplot.BlockCanvas.prototype=new a.jqplot.ElemContainer();a.jqplot.BlockCanvas.prototype.constructor=a.jqplot.BlockCanvas;a.jqplot.BlockCanvas.prototype.createElement=function(i,e,c){this._offsets=i;var b="jqplot-blockCanvas";if(e!=undefined){b=e}var g;if(this._elem){g=this._elem.get(0)}else{g=document.createElement("div")}if(c!=undefined){this._plotDimensions=c}var d=this._plotDimensions.width-this._offsets.left-this._offsets.right+"px";var f=this._plotDimensions.height-this._offsets.top-this._offsets.bottom+"px";this._elem=a(g);this._elem.css({position:"absolute",width:d,height:f,left:this._offsets.left,top:this._offsets.top});this._elem.addClass(b);return this._elem};a.jqplot.BlockCanvas.prototype.setContext=function(){this._ctx={canvas:{width:0,height:0},clearRect:function(){return null}};return this._ctx}})(jQuery);

js/plugins/jqplot.bubbleRenderer.js

@@ -0,0 +1,754 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    var arrayMax = function( array ){
+        return Math.max.apply( Math, array );
+    };
+    var arrayMin = function( array ){
+        return Math.min.apply( Math, array );
+    };
+
+    /**
+     * Class: $.jqplot.BubbleRenderer
+     * Plugin renderer to draw a bubble chart.  A Bubble chart has data points displayed as
+     * colored circles with an optional text label inside.  To use
+     * the bubble renderer, you must include the bubble renderer like:
+     * 
+     * > <script language="javascript" type="text/javascript" src="../src/plugins/jqplot.bubbleRenderer.js"></script>
+     * 
+     * Data must be supplied in 
+     * the form:
+     * 
+     * > [[x1, y1, r1, <label or {label:'text', color:color}>], ...]
+     * 
+     * where the label or options 
+     * object is optional.  
+     * 
+     * Note that all bubble colors will be the same
+     * unless the "varyBubbleColors" option is set to true.  Colors can be specified in the data array
+     * or in the seriesColors array option on the series.  If no colors are defined, the default jqPlot
+     * series of 16 colors are used.  Colors are automatically cycled around again if there are more
+     * bubbles than colors.
+     * 
+     * Bubbles are autoscaled by default to fit within the chart area while maintaining 
+     * relative sizes.  If the "autoscaleBubbles" option is set to false, the r(adius) values
+     * in the data array a treated as literal pixel values for the radii of the bubbles.
+     * 
+     * Properties are passed into the bubble renderer in the rendererOptions object of
+     * the series options like:
+     * 
+     * > seriesDefaults: {
+     * >     renderer: $.jqplot.BubbleRenderer,
+     * >     rendererOptions: {
+     * >         bubbleAlpha: 0.7,
+     * >         varyBubbleColors: false
+     * >     }
+     * > }
+     * 
+     */
+    $.jqplot.BubbleRenderer = function(){
+        $.jqplot.LineRenderer.call(this);
+    };
+    
+    $.jqplot.BubbleRenderer.prototype = new $.jqplot.LineRenderer();
+    $.jqplot.BubbleRenderer.prototype.constructor = $.jqplot.BubbleRenderer;
+    
+    // called with scope of a series
+    $.jqplot.BubbleRenderer.prototype.init = function(options, plot) {
+        // Group: Properties
+        //
+        // prop: varyBubbleColors
+        // True to vary the color of each bubble in this series according to
+        // the seriesColors array.  False to set each bubble to the color
+        // specified on this series.  This has no effect if a css background color
+        // option is specified in the renderer css options.
+        this.varyBubbleColors = true;
+        // prop: autoscaleBubbles
+        // True to scale the bubble radius based on plot size.
+        // False will use the radius value as provided as a raw pixel value for
+        // bubble radius.
+        this.autoscaleBubbles = true;
+        // prop: autoscaleMultiplier
+        // Multiplier the bubble size if autoscaleBubbles is true.
+        this.autoscaleMultiplier = 1.0;
+        // prop: autoscalePointsFactor
+        // Factor which decreases bubble size based on how many bubbles on on the chart.
+        // 0 means no adjustment for number of bubbles.  Negative values will decrease
+        // size of bubbles as more bubbles are added.  Values between 0 and -0.2
+        // should work well.
+        this.autoscalePointsFactor = -0.07;
+        // prop: escapeHtml
+        // True to escape html in bubble label text.
+        this.escapeHtml = true;
+        // prop: highlightMouseOver
+        // True to highlight bubbles when moused over.
+        // This must be false to enable highlightMouseDown to highlight when clicking on a slice.
+        this.highlightMouseOver = true;
+        // prop: highlightMouseDown
+        // True to highlight when a mouse button is pressed over a bubble.
+        // This will be disabled if highlightMouseOver is true.
+        this.highlightMouseDown = false;
+        // prop: highlightColors
+        // An array of colors to use when highlighting a slice.  Calculated automatically
+        // if not supplied.
+        this.highlightColors = [];
+        // prop: bubbleAlpha
+        // Alpha transparency to apply to all bubbles in this series.
+        this.bubbleAlpha = 1.0;
+        // prop: highlightAlpha
+        // Alpha transparency to apply when highlighting bubble.
+        // Set to value of bubbleAlpha by default.
+        this.highlightAlpha = null;
+        // prop: bubbleGradients
+        // True to color the bubbles with gradient fills instead of flat colors.
+        // NOT AVAILABLE IN IE due to lack of excanvas support for radial gradient fills.
+        // will be ignored in IE.
+        this.bubbleGradients = false;
+        // prop: showLabels
+        // True to show labels on bubbles (if any), false to not show.
+        this.showLabels = true;
+        // array of [point index, radius] which will be sorted in descending order to plot 
+        // largest points below smaller points.
+        this.radii = [];
+        this.maxRadius = 0;
+        // index of the currenty highlighted point, if any
+        this._highlightedPoint = null;
+        // array of jQuery labels.
+        this.labels = [];
+        this.bubbleCanvases = [];
+        this._type = 'bubble';
+        
+        // if user has passed in highlightMouseDown option and not set highlightMouseOver, disable highlightMouseOver
+        if (options.highlightMouseDown && options.highlightMouseOver == null) {
+            options.highlightMouseOver = false;
+        }
+        
+        $.extend(true, this, options);
+        
+        if (this.highlightAlpha == null) {
+            this.highlightAlpha = this.bubbleAlpha;
+            if (this.bubbleGradients) {
+                this.highlightAlpha = 0.35;
+            }
+        }
+        
+        this.autoscaleMultiplier = this.autoscaleMultiplier * Math.pow(this.data.length, this.autoscalePointsFactor);
+        
+        // index of the currenty highlighted point, if any
+        this._highlightedPoint = null;
+        
+        // adjust the series colors for options colors passed in with data or for alpha.
+        // note, this can leave undefined holes in the seriesColors array.
+        var comps;
+        for (var i=0; i<this.data.length; i++) {
+            var color = null;
+            var d = this.data[i];
+            this.maxRadius = Math.max(this.maxRadius, d[2]);
+            if (d[3]) {
+                if (typeof(d[3]) == 'object') {
+                    color = d[3]['color'];
+                }
+            }
+            
+            if (color == null) {
+                if (this.seriesColors[i] != null) {
+                    color = this.seriesColors[i];
+                }
+            }
+            
+            if (color && this.bubbleAlpha < 1.0) {
+                comps = $.jqplot.getColorComponents(color);
+                color = 'rgba('+comps[0]+', '+comps[1]+', '+comps[2]+', '+this.bubbleAlpha+')';
+            }
+            
+            if (color) {
+                this.seriesColors[i] = color;
+            }
+        }
+        
+        if (!this.varyBubbleColors) {
+            this.seriesColors = [this.color];
+        }
+        
+        this.colorGenerator = new $.jqplot.ColorGenerator(this.seriesColors);
+        
+        // set highlight colors if none provided
+        if (this.highlightColors.length == 0) {
+            for (var i=0; i<this.seriesColors.length; i++){
+                var rgba = $.jqplot.getColorComponents(this.seriesColors[i]);
+                var newrgb = [rgba[0], rgba[1], rgba[2]];
+                var sum = newrgb[0] + newrgb[1] + newrgb[2];
+                for (var j=0; j<3; j++) {
+                    // when darkening, lowest color component can be is 60.
+                    newrgb[j] = (sum > 570) ?  newrgb[j] * 0.8 : newrgb[j] + 0.3 * (255 - newrgb[j]);
+                    newrgb[j] = parseInt(newrgb[j], 10);
+                }
+                this.highlightColors.push('rgba('+newrgb[0]+','+newrgb[1]+','+newrgb[2]+', '+this.highlightAlpha+')');
+            }
+        }
+        
+        this.highlightColorGenerator = new $.jqplot.ColorGenerator(this.highlightColors);
+        
+        var sopts = {fill:true, isarc:true, angle:this.shadowAngle, alpha:this.shadowAlpha, closePath:true};
+        
+        this.renderer.shadowRenderer.init(sopts);
+        
+        this.canvas = new $.jqplot.DivCanvas();
+        this.canvas._plotDimensions = this._plotDimensions;
+        
+        plot.eventListenerHooks.addOnce('jqplotMouseMove', handleMove);
+        plot.eventListenerHooks.addOnce('jqplotMouseDown', handleMouseDown);
+        plot.eventListenerHooks.addOnce('jqplotMouseUp', handleMouseUp);
+        plot.eventListenerHooks.addOnce('jqplotClick', handleClick);
+        plot.eventListenerHooks.addOnce('jqplotRightClick', handleRightClick);
+        plot.postDrawHooks.addOnce(postPlotDraw);
+        
+    };
+    
+
+    // converts the user data values to grid coordinates and stores them
+    // in the gridData array.
+    // Called with scope of a series.
+    $.jqplot.BubbleRenderer.prototype.setGridData = function(plot) {
+        // recalculate the grid data
+        var xp = this._xaxis.series_u2p;
+        var yp = this._yaxis.series_u2p;
+        var data = this._plotData;
+        this.gridData = [];
+        var radii = [];
+        this.radii = [];
+        var dim = Math.min(plot._height, plot._width);
+        for (var i=0; i<this.data.length; i++) {
+            if (data[i] != null) {
+                this.gridData.push([xp.call(this._xaxis, data[i][0]), yp.call(this._yaxis, data[i][1]), data[i][2]]);
+                this.radii.push([i, data[i][2]]);
+                radii.push(data[i][2]);
+            }
+        }
+        var r, val, maxr = this.maxRadius = arrayMax(radii);
+        var l = this.gridData.length;
+        if (this.autoscaleBubbles) {
+            for (var i=0; i<l; i++) {
+                val = radii[i]/maxr;
+                r = this.autoscaleMultiplier * dim / 6;
+                this.gridData[i][2] = r * val;
+            }
+        }
+        
+        this.radii.sort(function(a, b) { return b[1] - a[1]; });
+    };
+    
+    // converts any arbitrary data values to grid coordinates and
+    // returns them.  This method exists so that plugins can use a series'
+    // linerenderer to generate grid data points without overwriting the
+    // grid data associated with that series.
+    // Called with scope of a series.
+    $.jqplot.BubbleRenderer.prototype.makeGridData = function(data, plot) {
+        // recalculate the grid data
+        var xp = this._xaxis.series_u2p;
+        var yp = this._yaxis.series_u2p;
+        var gd = [];
+        var radii = [];
+        this.radii = [];
+        var dim = Math.min(plot._height, plot._width);
+        for (var i=0; i<data.length; i++) {
+            if (data[i] != null) {
+                gd.push([xp.call(this._xaxis, data[i][0]), yp.call(this._yaxis, data[i][1]), data[i][2]]);
+                radii.push(data[i][2]);
+                this.radii.push([i, data[i][2]]);
+            }
+        }
+        var r, val, maxr = this.maxRadius = arrayMax(radii);
+        var l = this.gridData.length;
+        if (this.autoscaleBubbles) {
+            for (var i=0; i<l; i++) {
+                val = radii[i]/maxr;
+                r = this.autoscaleMultiplier * dim / 6;
+                gd[i][2] = r * val;
+            }
+        }
+        this.radii.sort(function(a, b) { return b[1] - a[1]; });
+        return gd;
+    };
+    
+    // called with scope of series
+    $.jqplot.BubbleRenderer.prototype.draw = function (ctx, gd, options) {
+        if (this.plugins.pointLabels) {
+            this.plugins.pointLabels.show = false;
+        }
+        var opts = (options != undefined) ? options : {};
+        var shadow = (opts.shadow != undefined) ? opts.shadow : this.shadow;
+        this.canvas._elem.empty();
+        for (var i=0; i<this.radii.length; i++) {
+            var idx = this.radii[i][0];
+            var t=null;
+            var color = null;
+            var el = null;
+            var tel = null;
+            var d = this.data[idx];
+            var gd = this.gridData[idx];
+            if (d[3]) {
+                if (typeof(d[3]) == 'object') {
+                    t = d[3]['label'];
+                }
+                else if (typeof(d[3]) == 'string') {
+                    t = d[3];
+                }
+            }
+            
+            // color = (this.varyBubbleColors) ? this.colorGenerator.get(idx) : this.color;
+            color = this.colorGenerator.get(idx);
+            
+            // If we're drawing a shadow, expand the canvas dimensions to accomodate.
+            var canvasRadius = gd[2];
+            var offset, depth;
+            if (this.shadow) {
+                offset = (0.7 + gd[2]/40).toFixed(1);
+                depth = 1 + Math.ceil(gd[2]/15);
+                canvasRadius += offset*depth;
+            }
+            this.bubbleCanvases[idx] = new $.jqplot.BubbleCanvas();
+            this.canvas._elem.append(this.bubbleCanvases[idx].createElement(gd[0], gd[1], canvasRadius));
+            this.bubbleCanvases[idx].setContext();
+            var ctx = this.bubbleCanvases[idx]._ctx;
+            var x = ctx.canvas.width/2;
+            var y = ctx.canvas.height/2;
+            if (this.shadow) {
+                this.renderer.shadowRenderer.draw(ctx, [x, y, gd[2], 0, 2*Math.PI], {offset: offset, depth: depth});
+            }
+            this.bubbleCanvases[idx].draw(gd[2], color, this.bubbleGradients, this.shadowAngle/180*Math.PI);
+            
+            // now draw label.
+            if (t && this.showLabels) {
+                tel = $('<div style="position:absolute;" class="jqplot-bubble-label"></div>');
+                if (this.escapeHtml) {
+                    tel.text(t);
+                }
+                else {
+                    tel.html(t);
+                }
+                this.canvas._elem.append(tel);
+                var h = $(tel).outerHeight();
+                var w = $(tel).outerWidth();
+                var top = gd[1] - 0.5*h;
+                var left = gd[0] - 0.5*w;
+                tel.css({top: top, left: left});
+                this.labels[idx] = $(tel);
+            }
+        }
+    };
+
+    
+    $.jqplot.DivCanvas = function() {
+        $.jqplot.ElemContainer.call(this);
+        this._ctx;  
+    };
+    
+    $.jqplot.DivCanvas.prototype = new $.jqplot.ElemContainer();
+    $.jqplot.DivCanvas.prototype.constructor = $.jqplot.DivCanvas;
+    
+    $.jqplot.DivCanvas.prototype.createElement = function(offsets, clss, plotDimensions) {
+        this._offsets = offsets;
+        var klass = 'jqplot-DivCanvas';
+        if (clss != undefined) {
+            klass = clss;
+        }
+        var elem;
+        // if this canvas already has a dom element, don't make a new one.
+        if (this._elem) {
+            elem = this._elem.get(0);
+        }
+        else {
+            elem = document.createElement('div');
+        }
+        // if new plotDimensions supplied, use them.
+        if (plotDimensions != undefined) {
+            this._plotDimensions = plotDimensions;
+        }
+        
+        var w = this._plotDimensions.width - this._offsets.left - this._offsets.right + 'px';
+        var h = this._plotDimensions.height - this._offsets.top - this._offsets.bottom + 'px';
+        this._elem = $(elem);
+        this._elem.css({ position: 'absolute', width:w, height:h, left: this._offsets.left, top: this._offsets.top });
+        
+        this._elem.addClass(klass);
+        return this._elem;
+    };
+    
+    $.jqplot.DivCanvas.prototype.setContext = function() {
+        this._ctx = {
+            canvas:{
+                width:0,
+                height:0
+            },
+            clearRect:function(){return null;}
+        };
+        return this._ctx;
+    };
+    
+    $.jqplot.BubbleCanvas = function() {
+        $.jqplot.ElemContainer.call(this);
+        this._ctx;
+    };
+    
+    $.jqplot.BubbleCanvas.prototype = new $.jqplot.ElemContainer();
+    $.jqplot.BubbleCanvas.prototype.constructor = $.jqplot.BubbleCanvas;
+    
+    // initialize with the x,y pont of bubble center and the bubble radius.
+    $.jqplot.BubbleCanvas.prototype.createElement = function(x, y, r) {     
+        var klass = 'jqplot-bubble-point';
+
+        var elem;
+        // if this canvas already has a dom element, don't make a new one.
+        if (this._elem) {
+            elem = this._elem.get(0);
+        }
+        else {
+            elem = document.createElement('canvas');
+        }
+        
+        elem.width = (r != null) ? 2*r : elem.width;
+        elem.height = (r != null) ? 2*r : elem.height;
+        this._elem = $(elem);
+        var l = (x != null && r != null) ? x - r : this._elem.css('left');
+        var t = (y != null && r != null) ? y - r : this._elem.css('top');
+        this._elem.css({ position: 'absolute', left: l, top: t });
+        
+        this._elem.addClass(klass);
+        if ($.jqplot.use_excanvas) {
+            window.G_vmlCanvasManager.init_(document);
+            elem = window.G_vmlCanvasManager.initElement(elem);
+        }
+        
+        return this._elem;
+    };
+    
+    $.jqplot.BubbleCanvas.prototype.draw = function(r, color, gradients, angle) {
+        var ctx = this._ctx;
+        // r = Math.floor(r*1.04);
+        // var x = Math.round(ctx.canvas.width/2);
+        // var y = Math.round(ctx.canvas.height/2);
+        var x = ctx.canvas.width/2;
+        var y = ctx.canvas.height/2;
+        ctx.save();
+        if (gradients && !$.jqplot.use_excanvas) {
+            r = r*1.04;
+            var comps = $.jqplot.getColorComponents(color);
+            var colorinner = 'rgba('+Math.round(comps[0]+0.8*(255-comps[0]))+', '+Math.round(comps[1]+0.8*(255-comps[1]))+', '+Math.round(comps[2]+0.8*(255-comps[2]))+', '+comps[3]+')';
+            var colorend = 'rgba('+comps[0]+', '+comps[1]+', '+comps[2]+', 0)';
+            // var rinner = Math.round(0.35 * r);
+            // var xinner = Math.round(x - Math.cos(angle) * 0.33 * r);
+            // var yinner = Math.round(y - Math.sin(angle) * 0.33 * r);
+            var rinner = 0.35 * r;
+            var xinner = x - Math.cos(angle) * 0.33 * r;
+            var yinner = y - Math.sin(angle) * 0.33 * r;
+            var radgrad = ctx.createRadialGradient(xinner, yinner, rinner, x, y, r);
+            radgrad.addColorStop(0, colorinner);
+            radgrad.addColorStop(0.93, color);
+            radgrad.addColorStop(0.96, colorend);
+            radgrad.addColorStop(1, colorend);
+            // radgrad.addColorStop(.98, colorend);
+            ctx.fillStyle = radgrad;
+            ctx.fillRect(0,0, ctx.canvas.width, ctx.canvas.height);
+        }
+        else {
+            ctx.fillStyle = color;
+            ctx.strokeStyle = color;
+            ctx.lineWidth = 1;
+            ctx.beginPath();
+            var ang = 2*Math.PI;
+            ctx.arc(x, y, r, 0, ang, 0);
+            ctx.closePath();
+            ctx.fill();
+        }
+        ctx.restore();
+    };
+    
+    $.jqplot.BubbleCanvas.prototype.setContext = function() {
+        this._ctx = this._elem.get(0).getContext("2d");
+        return this._ctx;
+    };
+    
+    $.jqplot.BubbleAxisRenderer = function() {
+        $.jqplot.LinearAxisRenderer.call(this);
+    };
+    
+    $.jqplot.BubbleAxisRenderer.prototype = new $.jqplot.LinearAxisRenderer();
+    $.jqplot.BubbleAxisRenderer.prototype.constructor = $.jqplot.BubbleAxisRenderer;
+        
+    // called with scope of axis object.
+    $.jqplot.BubbleAxisRenderer.prototype.init = function(options){
+        $.extend(true, this, options);
+        var db = this._dataBounds;
+        var minsidx = 0,
+            minpidx = 0,
+            maxsidx = 0,
+            maxpidx = 0,
+            maxr = 0,
+            minr = 0,
+            minMaxRadius = 0,
+            maxMaxRadius = 0,
+            maxMult = 0,
+            minMult = 0;
+        // Go through all the series attached to this axis and find
+        // the min/max bounds for this axis.
+        for (var i=0; i<this._series.length; i++) {
+            var s = this._series[i];
+            var d = s._plotData;
+            
+            for (var j=0; j<d.length; j++) { 
+                if (this.name == 'xaxis' || this.name == 'x2axis') {
+                    if (d[j][0] < db.min || db.min == null) {
+                        db.min = d[j][0];
+                        minsidx=i;
+                        minpidx=j;
+                        minr = d[j][2];
+                        minMaxRadius = s.maxRadius;
+                        minMult = s.autoscaleMultiplier;
+                    }
+                    if (d[j][0] > db.max || db.max == null) {
+                        db.max = d[j][0];
+                        maxsidx=i;
+                        maxpidx=j;
+                        maxr = d[j][2];
+                        maxMaxRadius = s.maxRadius;
+                        maxMult = s.autoscaleMultiplier;
+                    }
+                }              
+                else {
+                    if (d[j][1] < db.min || db.min == null) {
+                        db.min = d[j][1];
+                        minsidx=i;
+                        minpidx=j;
+                        minr = d[j][2];
+                        minMaxRadius = s.maxRadius;
+                        minMult = s.autoscaleMultiplier;
+                    }
+                    if (d[j][1] > db.max || db.max == null) {
+                        db.max = d[j][1];
+                        maxsidx=i;
+                        maxpidx=j;
+                        maxr = d[j][2];
+                        maxMaxRadius = s.maxRadius;
+                        maxMult = s.autoscaleMultiplier;
+                    }
+                }              
+            }
+        }
+        
+        var minRatio = minr/minMaxRadius;
+        var maxRatio = maxr/maxMaxRadius;
+        
+        // need to estimate the effect of the radius on total axis span and adjust axis accordingly.
+        var span = db.max - db.min;
+        // var dim = (this.name == 'xaxis' || this.name == 'x2axis') ? this._plotDimensions.width : this._plotDimensions.height;
+        var dim = Math.min(this._plotDimensions.width, this._plotDimensions.height);
+        
+        var minfact = minRatio * minMult/3 * span;
+        var maxfact = maxRatio * maxMult/3 * span;
+        db.max += maxfact;
+        db.min -= minfact;
+    };
+    
+    function highlight (plot, sidx, pidx) {
+        plot.plugins.bubbleRenderer.highlightLabelCanvas.empty();
+        var s = plot.series[sidx];
+        var canvas = plot.plugins.bubbleRenderer.highlightCanvas;
+        var ctx = canvas._ctx;
+        ctx.clearRect(0,0,ctx.canvas.width, ctx.canvas.height);
+        s._highlightedPoint = pidx;
+        plot.plugins.bubbleRenderer.highlightedSeriesIndex = sidx;
+        
+        var color = s.highlightColorGenerator.get(pidx);
+        var x = s.gridData[pidx][0],
+            y = s.gridData[pidx][1],
+            r = s.gridData[pidx][2];
+        ctx.save();
+        ctx.fillStyle = color;
+        ctx.strokeStyle = color;
+        ctx.lineWidth = 1;
+        ctx.beginPath();
+        ctx.arc(x, y, r, 0, 2*Math.PI, 0);
+        ctx.closePath();
+        ctx.fill();
+        ctx.restore();        
+        // bring label to front
+        if (s.labels[pidx]) {
+            plot.plugins.bubbleRenderer.highlightLabel = s.labels[pidx].clone();
+            plot.plugins.bubbleRenderer.highlightLabel.appendTo(plot.plugins.bubbleRenderer.highlightLabelCanvas);
+            plot.plugins.bubbleRenderer.highlightLabel.addClass('jqplot-bubble-label-highlight');
+        }
+    }
+    
+    function unhighlight (plot) {
+        var canvas = plot.plugins.bubbleRenderer.highlightCanvas;
+        var sidx = plot.plugins.bubbleRenderer.highlightedSeriesIndex;
+        plot.plugins.bubbleRenderer.highlightLabelCanvas.empty();
+        canvas._ctx.clearRect(0,0, canvas._ctx.canvas.width, canvas._ctx.canvas.height);
+        for (var i=0; i<plot.series.length; i++) {
+            plot.series[i]._highlightedPoint = null;
+        }
+        plot.plugins.bubbleRenderer.highlightedSeriesIndex = null;
+        plot.target.trigger('jqplotDataUnhighlight');
+    }
+    
+ 
+    function handleMove(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var si = neighbor.seriesIndex;
+            var pi = neighbor.pointIndex;
+            var ins = [si, pi, neighbor.data, plot.series[si].gridData[pi][2]];
+            var evt1 = jQuery.Event('jqplotDataMouseOver');
+            evt1.pageX = ev.pageX;
+            evt1.pageY = ev.pageY;
+            plot.target.trigger(evt1, ins);
+            if (plot.series[ins[0]].highlightMouseOver && !(ins[0] == plot.plugins.bubbleRenderer.highlightedSeriesIndex && ins[1] == plot.series[ins[0]]._highlightedPoint)) {
+                var evt = jQuery.Event('jqplotDataHighlight');
+                evt.pageX = ev.pageX;
+                evt.pageY = ev.pageY;
+                plot.target.trigger(evt, ins);
+                highlight (plot, ins[0], ins[1]);
+            }
+        }
+        else if (neighbor == null) {
+            unhighlight (plot);
+        }
+    } 
+    
+    function handleMouseDown(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var si = neighbor.seriesIndex;
+            var pi = neighbor.pointIndex;
+            var ins = [si, pi, neighbor.data, plot.series[si].gridData[pi][2]];
+            if (plot.series[ins[0]].highlightMouseDown && !(ins[0] == plot.plugins.bubbleRenderer.highlightedSeriesIndex && ins[1] == plot.series[ins[0]]._highlightedPoint)) {
+                var evt = jQuery.Event('jqplotDataHighlight');
+                evt.pageX = ev.pageX;
+                evt.pageY = ev.pageY;
+                plot.target.trigger(evt, ins);
+                highlight (plot, ins[0], ins[1]);
+            }
+        }
+        else if (neighbor == null) {
+            unhighlight (plot);
+        }
+    }
+    
+    function handleMouseUp(ev, gridpos, datapos, neighbor, plot) {
+        var idx = plot.plugins.bubbleRenderer.highlightedSeriesIndex;
+        if (idx != null && plot.series[idx].highlightMouseDown) {
+            unhighlight(plot);
+        }
+    }
+    
+    function handleClick(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var si = neighbor.seriesIndex;
+            var pi = neighbor.pointIndex;
+            var ins = [si, pi, neighbor.data, plot.series[si].gridData[pi][2]];
+            var evt = jQuery.Event('jqplotDataClick');
+            evt.pageX = ev.pageX;
+            evt.pageY = ev.pageY;
+            plot.target.trigger(evt, ins);
+        }
+    }
+    
+    function handleRightClick(ev, gridpos, datapos, neighbor, plot) {
+        if (neighbor) {
+            var si = neighbor.seriesIndex;
+            var pi = neighbor.pointIndex;
+            var ins = [si, pi, neighbor.data, plot.series[si].gridData[pi][2]];
+            var idx = plot.plugins.bubbleRenderer.highlightedSeriesIndex;
+            if (idx != null && plot.series[idx].highlightMouseDown) {
+                unhighlight(plot);
+            }
+            var evt = jQuery.Event('jqplotDataRightClick');
+            evt.pageX = ev.pageX;
+            evt.pageY = ev.pageY;
+            plot.target.trigger(evt, ins);
+        }
+    }
+    
+    // called within context of plot
+    // create a canvas which we can draw on.
+    // insert it before the eventCanvas, so eventCanvas will still capture events.
+    function postPlotDraw() {
+        // Memory Leaks patch    
+        if (this.plugins.bubbleRenderer && this.plugins.bubbleRenderer.highlightCanvas) {
+            this.plugins.bubbleRenderer.highlightCanvas.resetCanvas();
+            this.plugins.bubbleRenderer.highlightCanvas = null;
+        }
+        
+        this.plugins.bubbleRenderer = {highlightedSeriesIndex:null};
+        this.plugins.bubbleRenderer.highlightCanvas = new $.jqplot.GenericCanvas();
+        this.plugins.bubbleRenderer.highlightLabel = null;
+        this.plugins.bubbleRenderer.highlightLabelCanvas = $('<div style="position:absolute;"></div>');
+        var top = this._gridPadding.top;
+        var left = this._gridPadding.left;
+        var width = this._plotDimensions.width - this._gridPadding.left - this._gridPadding.right;
+        var height = this._plotDimensions.height - this._gridPadding.top - this._gridPadding.bottom;
+        this.plugins.bubbleRenderer.highlightLabelCanvas.css({top:top, left:left, width:width+'px', height:height+'px'});
+
+        this.eventCanvas._elem.before(this.plugins.bubbleRenderer.highlightCanvas.createElement(this._gridPadding, 'jqplot-bubbleRenderer-highlight-canvas', this._plotDimensions, this));
+        this.eventCanvas._elem.before(this.plugins.bubbleRenderer.highlightLabelCanvas);
+        
+        var hctx = this.plugins.bubbleRenderer.highlightCanvas.setContext();
+    }
+
+    
+    // setup default renderers for axes and legend so user doesn't have to
+    // called with scope of plot
+    function preInit(target, data, options) {
+        options = options || {};
+        options.axesDefaults = options.axesDefaults || {};
+        options.seriesDefaults = options.seriesDefaults || {};
+        // only set these if there is a Bubble series
+        var setopts = false;
+        if (options.seriesDefaults.renderer == $.jqplot.BubbleRenderer) {
+            setopts = true;
+        }
+        else if (options.series) {
+            for (var i=0; i < options.series.length; i++) {
+                if (options.series[i].renderer == $.jqplot.BubbleRenderer) {
+                    setopts = true;
+                }
+            }
+        }
+        
+        if (setopts) {
+            options.axesDefaults.renderer = $.jqplot.BubbleAxisRenderer;
+            options.sortData = false;
+        }
+    }
+    
+    $.jqplot.preInitHooks.push(preInit);
+    
+})(jQuery);
+    
+    

js/plugins/jqplot.canvasAxisLabelRenderer.js

@@ -0,0 +1,207 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    /**
+    * Class: $.jqplot.CanvasAxisLabelRenderer
+    * Renderer to draw axis labels with a canvas element to support advanced
+    * featrues such as rotated text.  This renderer uses a separate rendering engine
+    * to draw the text on the canvas.  Two modes of rendering the text are available.
+    * If the browser has native font support for canvas fonts (currently Mozila 3.5
+    * and Safari 4), you can enable text rendering with the canvas fillText method.
+    * You do so by setting the "enableFontSupport" option to true. 
+    * 
+    * Browsers lacking native font support will have the text drawn on the canvas
+    * using the Hershey font metrics.  Even if the "enableFontSupport" option is true
+    * non-supporting browsers will still render with the Hershey font.
+    * 
+    */
+    $.jqplot.CanvasAxisLabelRenderer = function(options) {
+        // Group: Properties
+        
+        // prop: angle
+        // angle of text, measured clockwise from x axis.
+        this.angle = 0;
+        // name of the axis associated with this tick
+        this.axis;
+        // prop: show
+        // wether or not to show the tick (mark and label).
+        this.show = true;
+        // prop: showLabel
+        // wether or not to show the label.
+        this.showLabel = true;
+        // prop: label
+        // label for the axis.
+        this.label = '';
+        // prop: fontFamily
+        // CSS spec for the font-family css attribute.
+        // Applies only to browsers supporting native font rendering in the
+        // canvas tag.  Currently Mozilla 3.5 and Safari 4.
+        this.fontFamily = '"Trebuchet MS", Arial, Helvetica, sans-serif';
+        // prop: fontSize
+        // CSS spec for font size.
+        this.fontSize = '11pt';
+        // prop: fontWeight
+        // CSS spec for fontWeight:  normal, bold, bolder, lighter or a number 100 - 900
+        this.fontWeight = 'normal';
+        // prop: fontStretch
+        // Multiplier to condense or expand font width.  
+        // Applies only to browsers which don't support canvas native font rendering.
+        this.fontStretch = 1.0;
+        // prop: textColor
+        // css spec for the color attribute.
+        this.textColor = '#666666';
+        // prop: enableFontSupport
+        // true to turn on native canvas font support in Mozilla 3.5+ and Safari 4+.
+        // If true, label will be drawn with canvas tag native support for fonts.
+        // If false, label will be drawn with Hershey font metrics.
+        this.enableFontSupport = true;
+        // prop: pt2px
+        // Point to pixel scaling factor, used for computing height of bounding box
+        // around a label.  The labels text renderer has a default setting of 1.4, which 
+        // should be suitable for most fonts.  Leave as null to use default.  If tops of
+        // letters appear clipped, increase this.  If bounding box seems too big, decrease.
+        // This is an issue only with the native font renderering capabilities of Mozilla
+        // 3.5 and Safari 4 since they do not provide a method to determine the font height.
+        this.pt2px = null;
+        
+        this._elem;
+        this._ctx;
+        this._plotWidth;
+        this._plotHeight;
+        this._plotDimensions = {height:null, width:null};
+        
+        $.extend(true, this, options);
+        
+        if (options.angle == null && this.axis != 'xaxis' && this.axis != 'x2axis') {
+            this.angle = -90;
+        }
+        
+        var ropts = {fontSize:this.fontSize, fontWeight:this.fontWeight, fontStretch:this.fontStretch, fillStyle:this.textColor, angle:this.getAngleRad(), fontFamily:this.fontFamily};
+        if (this.pt2px) {
+            ropts.pt2px = this.pt2px;
+        }
+        
+        if (this.enableFontSupport) {
+            
+            function support_canvas_text() {
+                return !!(document.createElement('canvas').getContext && typeof document.createElement('canvas').getContext('2d').fillText == 'function');
+            }
+            
+            if (support_canvas_text()) {
+                this._textRenderer = new $.jqplot.CanvasFontRenderer(ropts);
+            }
+            
+            else {
+                this._textRenderer = new $.jqplot.CanvasTextRenderer(ropts); 
+            }
+        }
+        else {
+            this._textRenderer = new $.jqplot.CanvasTextRenderer(ropts); 
+        }
+    };
+    
+    $.jqplot.CanvasAxisLabelRenderer.prototype.init = function(options) {
+        $.extend(true, this, options);
+        this._textRenderer.init({fontSize:this.fontSize, fontWeight:this.fontWeight, fontStretch:this.fontStretch, fillStyle:this.textColor, angle:this.getAngleRad(), fontFamily:this.fontFamily});
+    };
+    
+    // return width along the x axis
+    // will check first to see if an element exists.
+    // if not, will return the computed text box width.
+    $.jqplot.CanvasAxisLabelRenderer.prototype.getWidth = function(ctx) {
+        if (this._elem) {
+         return this._elem.outerWidth(true);
+        }
+        else {
+            var tr = this._textRenderer;
+            var l = tr.getWidth(ctx);
+            var h = tr.getHeight(ctx);
+            var w = Math.abs(Math.sin(tr.angle)*h) + Math.abs(Math.cos(tr.angle)*l);
+            return w;
+        }
+    };
+    
+    // return height along the y axis.
+    $.jqplot.CanvasAxisLabelRenderer.prototype.getHeight = function(ctx) {
+        if (this._elem) {
+         return this._elem.outerHeight(true);
+        }
+        else {
+            var tr = this._textRenderer;
+            var l = tr.getWidth(ctx);
+            var h = tr.getHeight(ctx);
+            var w = Math.abs(Math.cos(tr.angle)*h) + Math.abs(Math.sin(tr.angle)*l);
+            return w;
+        }
+    };
+    
+    $.jqplot.CanvasAxisLabelRenderer.prototype.getAngleRad = function() {
+        var a = this.angle * Math.PI/180;
+        return a;
+    };
+    
+    $.jqplot.CanvasAxisLabelRenderer.prototype.draw = function(ctx, plot) {
+          // Memory Leaks patch
+          if (this._elem) {
+              if ($.jqplot.use_excanvas) {
+                  window.G_vmlCanvasManager.uninitElement(this._elem.get(0));
+              }
+            
+              this._elem.emptyForce();
+              this._elem = null;
+          }
+
+        // create a canvas here, but can't draw on it untill it is appended
+        // to dom for IE compatability.
+        var elem = plot.canvasManager.getCanvas();
+
+        this._textRenderer.setText(this.label, ctx);
+        var w = this.getWidth(ctx);
+        var h = this.getHeight(ctx);
+        elem.width = w;
+        elem.height = h;
+        elem.style.width = w;
+        elem.style.height = h;
+        
+		elem = plot.canvasManager.initCanvas(elem);
+		
+        this._elem = $(elem);
+        this._elem.css({ position: 'absolute'});
+        this._elem.addClass('jqplot-'+this.axis+'-label');
+        
+        elem = null;
+        return this._elem;
+    };
+    
+    $.jqplot.CanvasAxisLabelRenderer.prototype.pack = function() {
+        this._textRenderer.draw(this._elem.get(0).getContext("2d"), this.label);
+    };
+    
+})(jQuery);

js/plugins/jqplot.canvasAxisLabelRenderer.min.js

@@ -0,0 +1,30 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function(a){a.jqplot.CanvasAxisLabelRenderer=function(b){this.angle=0;this.axis;this.show=true;this.showLabel=true;this.label="";this.fontFamily='"Trebuchet MS", Arial, Helvetica, sans-serif';this.fontSize="11pt";this.fontWeight="normal";this.fontStretch=1;this.textColor="#666666";this.enableFontSupport=true;this.pt2px=null;this._elem;this._ctx;this._plotWidth;this._plotHeight;this._plotDimensions={height:null,width:null};a.extend(true,this,b);if(b.angle==null&&this.axis!="xaxis"&&this.axis!="x2axis"){this.angle=-90}var c={fontSize:this.fontSize,fontWeight:this.fontWeight,fontStretch:this.fontStretch,fillStyle:this.textColor,angle:this.getAngleRad(),fontFamily:this.fontFamily};if(this.pt2px){c.pt2px=this.pt2px}if(this.enableFontSupport){function d(){return !!(document.createElement("canvas").getContext&&typeof document.createElement("canvas").getContext("2d").fillText=="function")}if(d()){this._textRenderer=new a.jqplot.CanvasFontRenderer(c)}else{this._textRenderer=new a.jqplot.CanvasTextRenderer(c)}}else{this._textRenderer=new a.jqplot.CanvasTextRenderer(c)}};a.jqplot.CanvasAxisLabelRenderer.prototype.init=function(b){a.extend(true,this,b);this._textRenderer.init({fontSize:this.fontSize,fontWeight:this.fontWeight,fontStretch:this.fontStretch,fillStyle:this.textColor,angle:this.getAngleRad(),fontFamily:this.fontFamily})};a.jqplot.CanvasAxisLabelRenderer.prototype.getWidth=function(d){if(this._elem){return this._elem.outerWidth(true)}else{var f=this._textRenderer;var c=f.getWidth(d);var e=f.getHeight(d);var b=Math.abs(Math.sin(f.angle)*e)+Math.abs(Math.cos(f.angle)*c);return b}};a.jqplot.CanvasAxisLabelRenderer.prototype.getHeight=function(d){if(this._elem){return this._elem.outerHeight(true)}else{var f=this._textRenderer;var c=f.getWidth(d);var e=f.getHeight(d);var b=Math.abs(Math.cos(f.angle)*e)+Math.abs(Math.sin(f.angle)*c);return b}};a.jqplot.CanvasAxisLabelRenderer.prototype.getAngleRad=function(){var b=this.angle*Math.PI/180;return b};a.jqplot.CanvasAxisLabelRenderer.prototype.draw=function(c,f){if(this._elem){if(a.jqplot.use_excanvas){window.G_vmlCanvasManager.uninitElement(this._elem.get(0))}this._elem.emptyForce();this._elem=null}var e=f.canvasManager.getCanvas();this._textRenderer.setText(this.label,c);var b=this.getWidth(c);var d=this.getHeight(c);e.width=b;e.height=d;e.style.width=b;e.style.height=d;e=f.canvasManager.initCanvas(e);this._elem=a(e);this._elem.css({position:"absolute"});this._elem.addClass("jqplot-"+this.axis+"-label");e=null;return this._elem};a.jqplot.CanvasAxisLabelRenderer.prototype.pack=function(){this._textRenderer.draw(this._elem.get(0).getContext("2d"),this.label)}})(jQuery);

js/plugins/jqplot.canvasAxisTickRenderer.js

@@ -0,0 +1,247 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    /**
+    *  Class: $.jqplot.CanvasAxisTickRenderer
+    * Renderer to draw axis ticks with a canvas element to support advanced
+    * featrues such as rotated text.  This renderer uses a separate rendering engine
+    * to draw the text on the canvas.  Two modes of rendering the text are available.
+    * If the browser has native font support for canvas fonts (currently Mozila 3.5
+    * and Safari 4), you can enable text rendering with the canvas fillText method.
+    * You do so by setting the "enableFontSupport" option to true. 
+    * 
+    * Browsers lacking native font support will have the text drawn on the canvas
+    * using the Hershey font metrics.  Even if the "enableFontSupport" option is true
+    * non-supporting browsers will still render with the Hershey font.
+    */
+    $.jqplot.CanvasAxisTickRenderer = function(options) {
+        // Group: Properties
+        
+        // prop: mark
+        // tick mark on the axis.  One of 'inside', 'outside', 'cross', '' or null.
+        this.mark = 'outside';
+        // prop: showMark
+        // wether or not to show the mark on the axis.
+        this.showMark = true;
+        // prop: showGridline
+        // wether or not to draw the gridline on the grid at this tick.
+        this.showGridline = true;
+        // prop: isMinorTick
+        // if this is a minor tick.
+        this.isMinorTick = false;
+        // prop: angle
+        // angle of text, measured clockwise from x axis.
+        this.angle = 0;
+        // prop:  markSize
+        // Length of the tick marks in pixels.  For 'cross' style, length
+        // will be stoked above and below axis, so total length will be twice this.
+        this.markSize = 4;
+        // prop: show
+        // wether or not to show the tick (mark and label).
+        this.show = true;
+        // prop: showLabel
+        // wether or not to show the label.
+        this.showLabel = true;
+        // prop: labelPosition
+        // 'auto', 'start', 'middle' or 'end'.
+        // Whether tick label should be positioned so the start, middle, or end
+        // of the tick mark.
+        this.labelPosition = 'auto';
+        this.label = '';
+        this.value = null;
+        this._styles = {};
+        // prop: formatter
+        // A class of a formatter for the tick text.
+        // The default $.jqplot.DefaultTickFormatter uses sprintf.
+        this.formatter = $.jqplot.DefaultTickFormatter;
+        // prop: formatString
+        // string passed to the formatter.
+        this.formatString = '';
+        // prop: prefix
+        // String to prepend to the tick label.
+        // Prefix is prepended to the formatted tick label.
+        this.prefix = '';
+        // prop: fontFamily
+        // css spec for the font-family css attribute.
+        this.fontFamily = '"Trebuchet MS", Arial, Helvetica, sans-serif';
+        // prop: fontSize
+        // CSS spec for font size.
+        this.fontSize = '10pt';
+        // prop: fontWeight
+        // CSS spec for fontWeight
+        this.fontWeight = 'normal';
+        // prop: fontStretch
+        // Multiplier to condense or expand font width.  
+        // Applies only to browsers which don't support canvas native font rendering.
+        this.fontStretch = 1.0;
+        // prop: textColor
+        // css spec for the color attribute.
+        this.textColor = '#666666';
+        // prop: enableFontSupport
+        // true to turn on native canvas font support in Mozilla 3.5+ and Safari 4+.
+        // If true, tick label will be drawn with canvas tag native support for fonts.
+        // If false, tick label will be drawn with Hershey font metrics.
+        this.enableFontSupport = true;
+        // prop: pt2px
+        // Point to pixel scaling factor, used for computing height of bounding box
+        // around a label.  The labels text renderer has a default setting of 1.4, which 
+        // should be suitable for most fonts.  Leave as null to use default.  If tops of
+        // letters appear clipped, increase this.  If bounding box seems too big, decrease.
+        // This is an issue only with the native font renderering capabilities of Mozilla
+        // 3.5 and Safari 4 since they do not provide a method to determine the font height.
+        this.pt2px = null;
+        
+        this._elem;
+        this._ctx;
+        this._plotWidth;
+        this._plotHeight;
+        this._plotDimensions = {height:null, width:null};
+        
+        $.extend(true, this, options);
+        
+        var ropts = {fontSize:this.fontSize, fontWeight:this.fontWeight, fontStretch:this.fontStretch, fillStyle:this.textColor, angle:this.getAngleRad(), fontFamily:this.fontFamily};
+        if (this.pt2px) {
+            ropts.pt2px = this.pt2px;
+        }
+        
+        if (this.enableFontSupport) {
+            
+            function support_canvas_text() {
+                return !!(document.createElement('canvas').getContext && typeof document.createElement('canvas').getContext('2d').fillText == 'function');
+            }
+            
+            if (support_canvas_text()) {
+                this._textRenderer = new $.jqplot.CanvasFontRenderer(ropts);
+            }
+            
+            else {
+                this._textRenderer = new $.jqplot.CanvasTextRenderer(ropts); 
+            }
+        }
+        else {
+            this._textRenderer = new $.jqplot.CanvasTextRenderer(ropts); 
+        }
+    };
+    
+    $.jqplot.CanvasAxisTickRenderer.prototype.init = function(options) {
+        $.extend(true, this, options);
+        this._textRenderer.init({fontSize:this.fontSize, fontWeight:this.fontWeight, fontStretch:this.fontStretch, fillStyle:this.textColor, angle:this.getAngleRad(), fontFamily:this.fontFamily});
+    };
+    
+    // return width along the x axis
+    // will check first to see if an element exists.
+    // if not, will return the computed text box width.
+    $.jqplot.CanvasAxisTickRenderer.prototype.getWidth = function(ctx) {
+        if (this._elem) {
+         return this._elem.outerWidth(true);
+        }
+        else {
+            var tr = this._textRenderer;
+            var l = tr.getWidth(ctx);
+            var h = tr.getHeight(ctx);
+            var w = Math.abs(Math.sin(tr.angle)*h) + Math.abs(Math.cos(tr.angle)*l);
+            return w;
+        }
+    };
+    
+    // return height along the y axis.
+    $.jqplot.CanvasAxisTickRenderer.prototype.getHeight = function(ctx) {
+        if (this._elem) {
+         return this._elem.outerHeight(true);
+        }
+        else {
+            var tr = this._textRenderer;
+            var l = tr.getWidth(ctx);
+            var h = tr.getHeight(ctx);
+            var w = Math.abs(Math.cos(tr.angle)*h) + Math.abs(Math.sin(tr.angle)*l);
+            return w;
+        }
+    };
+    
+    $.jqplot.CanvasAxisTickRenderer.prototype.getAngleRad = function() {
+        var a = this.angle * Math.PI/180;
+        return a;
+    };
+    
+    
+    $.jqplot.CanvasAxisTickRenderer.prototype.setTick = function(value, axisName, isMinor) {
+        this.value = value;
+        if (isMinor) {
+            this.isMinorTick = true;
+        }
+        return this;
+    };
+    
+    $.jqplot.CanvasAxisTickRenderer.prototype.draw = function(ctx, plot) {
+        if (!this.label) {
+            this.label = this.prefix + this.formatter(this.formatString, this.value);
+        }
+        
+        // Memory Leaks patch
+        if (this._elem) {
+            if ($.jqplot.use_excanvas) {
+                window.G_vmlCanvasManager.uninitElement(this._elem.get(0));
+            }
+            
+            this._elem.emptyForce();
+            this._elem = null;
+        }
+
+        // create a canvas here, but can't draw on it untill it is appended
+        // to dom for IE compatability.
+
+        var elem = plot.canvasManager.getCanvas();
+
+        this._textRenderer.setText(this.label, ctx);
+        var w = this.getWidth(ctx);
+        var h = this.getHeight(ctx);
+        // canvases seem to need to have width and heigh attributes directly set.
+        elem.width = w;
+        elem.height = h;
+        elem.style.width = w;
+        elem.style.height = h;
+        elem.style.textAlign = 'left';
+        elem.style.position = 'absolute';
+		
+		elem = plot.canvasManager.initCanvas(elem);
+		
+        this._elem = $(elem);
+        this._elem.css(this._styles);
+        this._elem.addClass('jqplot-'+this.axis+'-tick');
+		
+        elem = null;
+        return this._elem;
+    };
+    
+    $.jqplot.CanvasAxisTickRenderer.prototype.pack = function() {
+        this._textRenderer.draw(this._elem.get(0).getContext("2d"), this.label);
+    };
+    
+})(jQuery);

js/plugins/jqplot.canvasAxisTickRenderer.min.js

@@ -0,0 +1,30 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function(a){a.jqplot.CanvasAxisTickRenderer=function(b){this.mark="outside";this.showMark=true;this.showGridline=true;this.isMinorTick=false;this.angle=0;this.markSize=4;this.show=true;this.showLabel=true;this.labelPosition="auto";this.label="";this.value=null;this._styles={};this.formatter=a.jqplot.DefaultTickFormatter;this.formatString="";this.prefix="";this.fontFamily='"Trebuchet MS", Arial, Helvetica, sans-serif';this.fontSize="10pt";this.fontWeight="normal";this.fontStretch=1;this.textColor="#666666";this.enableFontSupport=true;this.pt2px=null;this._elem;this._ctx;this._plotWidth;this._plotHeight;this._plotDimensions={height:null,width:null};a.extend(true,this,b);var c={fontSize:this.fontSize,fontWeight:this.fontWeight,fontStretch:this.fontStretch,fillStyle:this.textColor,angle:this.getAngleRad(),fontFamily:this.fontFamily};if(this.pt2px){c.pt2px=this.pt2px}if(this.enableFontSupport){function d(){return !!(document.createElement("canvas").getContext&&typeof document.createElement("canvas").getContext("2d").fillText=="function")}if(d()){this._textRenderer=new a.jqplot.CanvasFontRenderer(c)}else{this._textRenderer=new a.jqplot.CanvasTextRenderer(c)}}else{this._textRenderer=new a.jqplot.CanvasTextRenderer(c)}};a.jqplot.CanvasAxisTickRenderer.prototype.init=function(b){a.extend(true,this,b);this._textRenderer.init({fontSize:this.fontSize,fontWeight:this.fontWeight,fontStretch:this.fontStretch,fillStyle:this.textColor,angle:this.getAngleRad(),fontFamily:this.fontFamily})};a.jqplot.CanvasAxisTickRenderer.prototype.getWidth=function(d){if(this._elem){return this._elem.outerWidth(true)}else{var f=this._textRenderer;var c=f.getWidth(d);var e=f.getHeight(d);var b=Math.abs(Math.sin(f.angle)*e)+Math.abs(Math.cos(f.angle)*c);return b}};a.jqplot.CanvasAxisTickRenderer.prototype.getHeight=function(d){if(this._elem){return this._elem.outerHeight(true)}else{var f=this._textRenderer;var c=f.getWidth(d);var e=f.getHeight(d);var b=Math.abs(Math.cos(f.angle)*e)+Math.abs(Math.sin(f.angle)*c);return b}};a.jqplot.CanvasAxisTickRenderer.prototype.getAngleRad=function(){var b=this.angle*Math.PI/180;return b};a.jqplot.CanvasAxisTickRenderer.prototype.setTick=function(b,d,c){this.value=b;if(c){this.isMinorTick=true}return this};a.jqplot.CanvasAxisTickRenderer.prototype.draw=function(c,f){if(!this.label){this.label=this.prefix+this.formatter(this.formatString,this.value)}if(this._elem){if(a.jqplot.use_excanvas){window.G_vmlCanvasManager.uninitElement(this._elem.get(0))}this._elem.emptyForce();this._elem=null}var e=f.canvasManager.getCanvas();this._textRenderer.setText(this.label,c);var b=this.getWidth(c);var d=this.getHeight(c);e.width=b;e.height=d;e.style.width=b;e.style.height=d;e.style.textAlign="left";e.style.position="absolute";e=f.canvasManager.initCanvas(e);this._elem=a(e);this._elem.css(this._styles);this._elem.addClass("jqplot-"+this.axis+"-tick");e=null;return this._elem};a.jqplot.CanvasAxisTickRenderer.prototype.pack=function(){this._textRenderer.draw(this._elem.get(0).getContext("2d"),this.label)}})(jQuery);

js/plugins/jqplot.canvasOverlay.js

@@ -0,0 +1,705 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    // class: $.jqplot.CanvasOverlay
+    $.jqplot.CanvasOverlay = function(opts){
+		var options = opts || {};
+        this.options = {
+			show: $.jqplot.config.enablePlugins,
+			deferDraw: false
+		};
+		// prop: objects
+		this.objects = [];
+		this.objectNames = [];
+        this.canvas = null;
+		this.markerRenderer = new $.jqplot.MarkerRenderer({style:'line'});
+		this.markerRenderer.init();
+		if (options.objects) {
+			var objs = options.objects,
+				obj;
+			for (var i=0; i<objs.length; i++) {
+				obj = objs[i];
+				for (var n in obj) {
+					switch (n) {
+						case 'line':
+							this.addLine(obj[n]);
+							break;
+						case 'horizontalLine':
+							this.addHorizontalLine(obj[n]);
+							break;
+						case 'dashedHorizontalLine':
+							this.addDashedHorizontalLine(obj[n]);
+							break;
+						case 'verticalLine':
+							this.addVerticalLine(obj[n]);
+							break;
+						case 'dashedVerticalLine':
+							this.addDashedVerticalLine(obj[n]);
+							break;
+						default:
+							break;
+					}
+				}	
+			}
+		}
+		$.extend(true, this.options, options);
+	};
+	
+	// called with scope of a plot object
+	$.jqplot.CanvasOverlay.postPlotInit = function (target, data, opts) {
+        var options = opts || {};
+        // add a canvasOverlay attribute to the plot
+        this.plugins.canvasOverlay = new $.jqplot.CanvasOverlay(options.canvasOverlay);		
+	};
+
+	/**
+	 * Class: Line
+	 * A straight line.
+	 */
+	function Line(options) {
+		this.type = 'line';
+		this.options = {
+			// prop: name
+			// Optional name for this overlay object.
+			// Can be later used to retrieve the object by name.
+			name: null,
+			// prop: show
+			// true to show (draw), false to not draw.
+			show: true,
+			// prop: lineWidth
+			// Width of the line.
+			lineWidth: 2,
+			// prop: lineCap
+			// Type of ending placed on the line ['round', 'butt', 'square']
+			lineCap: 'round',
+			// prop: color
+			// color of the line
+			color: '#666666',
+	        // prop: shadow
+	        // wether or not to draw a shadow on the line
+	        shadow: true,
+	        // prop: shadowAngle
+	        // Shadow angle in degrees
+	        shadowAngle: 45,
+	        // prop: shadowOffset
+	        // Shadow offset from line in pixels
+	        shadowOffset: 1,
+	        // prop: shadowDepth
+	        // Number of times shadow is stroked, each stroke offset shadowOffset from the last.
+	        shadowDepth: 3,
+	        // prop: shadowAlpha
+	        // Alpha channel transparency of shadow.  0 = transparent.
+	        shadowAlpha: '0.07',
+	        // prop: xaxis
+	        // X axis to use for positioning/scaling the line.
+			xaxis: 'xaxis',
+	        // prop: yaxis
+	        // Y axis to use for positioning/scaling the line.
+			yaxis: 'yaxis',
+			// prop: start
+			// [x, y] coordinates for the start of the line.
+			start: [],
+			// prop: stop
+			// [x, y] coordinates for the end of the line.
+			stop: []
+		};
+		$.extend(true, this.options, options);
+	}
+
+	/**
+	 * Class: HorizontalLine
+	 * A straight horizontal line.
+	 */
+	function HorizontalLine(options) {
+		this.type = 'horizontalLine';
+		this.options = {
+			// prop: name
+			// Optional name for this overlay object.
+			// Can be later used to retrieve the object by name.
+			name: null,
+			// prop: show
+			// true to show (draw), false to not draw.
+			show: true,
+			// prop: lineWidth
+			// Width of the line.
+			lineWidth: 2,
+			// prop: lineCap
+			// Type of ending placed on the line ['round', 'butt', 'square']
+			lineCap: 'round',
+			// prop: color
+			// color of the line
+			color: '#666666',
+	        // prop: shadow
+	        // wether or not to draw a shadow on the line
+	        shadow: true,
+	        // prop: shadowAngle
+	        // Shadow angle in degrees
+	        shadowAngle: 45,
+	        // prop: shadowOffset
+	        // Shadow offset from line in pixels
+	        shadowOffset: 1,
+	        // prop: shadowDepth
+	        // Number of times shadow is stroked, each stroke offset shadowOffset from the last.
+	        shadowDepth: 3,
+	        // prop: shadowAlpha
+	        // Alpha channel transparency of shadow.  0 = transparent.
+	        shadowAlpha: '0.07',
+	        // prop: xaxis
+	        // X axis to use for positioning/scaling the line.
+			xaxis: 'xaxis',
+	        // prop: yaxis
+	        // Y axis to use for positioning/scaling the line.
+			yaxis: 'yaxis',
+			// prop: y
+			// y value to position the line
+			y: null,
+			// prop: xmin
+			// x value for the start of the line, null to scale to axis min.
+			xmin: null,
+			// prop: xmax
+			// x value for the end of the line, null to scale to axis max.
+			xmax: null,
+			// prop xOffset
+			// offset ends of the line inside the grid.  Number 
+			xOffset: '6px',	// number or string.  Number interpreted as units, string as pixels.
+			xminOffset: null,
+			xmaxOffset: null
+		};
+		$.extend(true, this.options, options);
+	}
+	
+
+	/**
+	 * Class: DashedHorizontalLine
+	 * A straight dashed horizontal line.
+	 */
+	function DashedHorizontalLine(options) {
+		this.type = 'dashedHorizontalLine';
+		this.options = {
+			// prop: name
+			// Optional name for this overlay object.
+			// Can be later used to retrieve the object by name.
+			name: null,
+			// prop: show
+			// true to show (draw), false to not draw.
+			show: true,
+			// prop: lineWidth
+			// Width of the line.
+			lineWidth: 2,
+			// prop: lineCap
+			// Type of ending placed on the line ['round', 'butt', 'square']
+			lineCap: 'butt',
+			// prop: color
+			// color of the line
+			color: '#666666',
+	        // prop: shadow
+	        // wether or not to draw a shadow on the line
+	        shadow: true,
+	        // prop: shadowAngle
+	        // Shadow angle in degrees
+	        shadowAngle: 45,
+	        // prop: shadowOffset
+	        // Shadow offset from line in pixels
+	        shadowOffset: 1,
+	        // prop: shadowDepth
+	        // Number of times shadow is stroked, each stroke offset shadowOffset from the last.
+	        shadowDepth: 3,
+	        // prop: shadowAlpha
+	        // Alpha channel transparency of shadow.  0 = transparent.
+	        shadowAlpha: '0.07',
+	        // prop: xaxis
+	        // X axis to use for positioning/scaling the line.
+			xaxis: 'xaxis',
+	        // prop: yaxis
+	        // Y axis to use for positioning/scaling the line.
+			yaxis: 'yaxis',
+			y: null,
+			xmin: null,
+			xmax: null,
+			xOffset: '6px',	// number or string.  Number interpreted as units, string as pixels.
+			xminOffset: null,
+			xmaxOffset: null,
+			// prop: dashPattern
+			// Array of line, space settings in pixels.
+			// Default is 8 pixel of line, 8 pixel of space.
+			// Note, limit to a 2 element array b/c of bug with higher order arrays.
+			dashPattern: [8,8]
+		};
+		$.extend(true, this.options, options);
+	}
+	
+
+	/**
+	 * Class: VerticalLine
+	 * A straight vertical line.
+	 */
+	function VerticalLine(options) {
+		this.type = 'verticalLine';
+		this.options = {
+			// prop: name
+			// Optional name for this overlay object.
+			// Can be later used to retrieve the object by name.
+			name: null,
+			// prop: show
+			// true to show (draw), false to not draw.
+			show: true,
+			// prop: lineWidth
+			// Width of the line.
+			lineWidth: 2,
+			// prop: lineCap
+			// Type of ending placed on the line ['round', 'butt', 'square']
+			lineCap: 'round',
+			// prop: color
+			// color of the line
+			color: '#666666',
+	        // prop: shadow
+	        // wether or not to draw a shadow on the line
+	        shadow: true,
+	        // prop: shadowAngle
+	        // Shadow angle in degrees
+	        shadowAngle: 45,
+	        // prop: shadowOffset
+	        // Shadow offset from line in pixels
+	        shadowOffset: 1,
+	        // prop: shadowDepth
+	        // Number of times shadow is stroked, each stroke offset shadowOffset from the last.
+	        shadowDepth: 3,
+	        // prop: shadowAlpha
+	        // Alpha channel transparency of shadow.  0 = transparent.
+	        shadowAlpha: '0.07',
+	        // prop: xaxis
+	        // X axis to use for positioning/scaling the line.
+			xaxis: 'xaxis',
+	        // prop: yaxis
+	        // Y axis to use for positioning/scaling the line.
+			yaxis: 'yaxis',
+			x: null,
+			ymin: null,
+			ymax: null,
+			yOffset: '6px',	// number or string.  Number interpreted as units, string as pixels.
+			yminOffset: null,
+			ymaxOffset: null
+		};
+		$.extend(true, this.options, options);
+	}
+	
+
+	/**
+	 * Class: DashedVerticalLine
+	 * A straight dashed vertical line.
+	 */
+	function DashedVerticalLine(options) {
+		this.type = 'dashedVerticalLine';
+		this.options = {
+			// prop: name
+			// Optional name for this overlay object.
+			// Can be later used to retrieve the object by name.
+			name: null,
+			// prop: show
+			// true to show (draw), false to not draw.
+			show: true,
+			// prop: lineWidth
+			// Width of the line.
+			lineWidth: 2,
+			// prop: lineCap
+			// Type of ending placed on the line ['round', 'butt', 'square']
+			lineCap: 'butt',
+			// prop: color
+			// color of the line
+			color: '#666666',
+	        // prop: shadow
+	        // wether or not to draw a shadow on the line
+	        shadow: true,
+	        // prop: shadowAngle
+	        // Shadow angle in degrees
+	        shadowAngle: 45,
+	        // prop: shadowOffset
+	        // Shadow offset from line in pixels
+	        shadowOffset: 1,
+	        // prop: shadowDepth
+	        // Number of times shadow is stroked, each stroke offset shadowOffset from the last.
+	        shadowDepth: 3,
+	        // prop: shadowAlpha
+	        // Alpha channel transparency of shadow.  0 = transparent.
+	        shadowAlpha: '0.07',
+	        // prop: xaxis
+	        // X axis to use for positioning/scaling the line.
+			xaxis: 'xaxis',
+	        // prop: yaxis
+	        // Y axis to use for positioning/scaling the line.
+			yaxis: 'yaxis',
+			x: null,
+			ymin: null,
+			ymax: null,
+			yOffset: '6px',	// number or string.  Number interpreted as units, string as pixels.
+			yminOffset: null,
+			ymaxOffset: null,
+			// prop: dashPattern
+			// Array of line, space settings in pixels.
+			// Default is 8 pixel of line, 8 pixel of space.
+			// Note, limit to a 2 element array b/c of bug with higher order arrays.
+			dashPattern: [8,8]
+		};
+		$.extend(true, this.options, options);
+	}
+	
+	$.jqplot.CanvasOverlay.prototype.addLine = function(opts) {
+		var line = new Line(opts);
+		this.objects.push(line);
+		this.objectNames.push(line.options.name);
+	};
+	
+	$.jqplot.CanvasOverlay.prototype.addHorizontalLine = function(opts) {
+		var line = new HorizontalLine(opts);
+		this.objects.push(line);
+		this.objectNames.push(line.options.name);
+	};
+	
+	$.jqplot.CanvasOverlay.prototype.addDashedHorizontalLine = function(opts) {
+		var line = new DashedHorizontalLine(opts);
+		this.objects.push(line);
+		this.objectNames.push(line.options.name);
+	};
+	
+	$.jqplot.CanvasOverlay.prototype.addVerticalLine = function(opts) {
+		var line = new VerticalLine(opts);
+		this.objects.push(line);
+		this.objectNames.push(line.options.name);
+	};
+	
+	$.jqplot.CanvasOverlay.prototype.addDashedVerticalLine = function(opts) {
+		var line = new DashedVerticalLine(opts);
+		this.objects.push(line);
+		this.objectNames.push(line.options.name);
+	};
+	
+	$.jqplot.CanvasOverlay.prototype.removeObject = function(idx) {
+		// check if integer, remove by index
+		if ($.type(idx) == 'number') {
+			this.objects.splice(idx, 1);
+			this.objectNames.splice(idx, 1);
+		}
+		// if string, remove by name
+		else {
+			var id = $.inArray(idx, this.objectNames);
+			if (id != -1) {
+				this.objects.splice(id, 1);
+				this.objectNames.splice(id, 1);
+			}
+		}
+	};
+	
+	$.jqplot.CanvasOverlay.prototype.getObject = function(idx) {
+		// check if integer, remove by index
+		if ($.type(idx) == 'number') {
+			return this.objects[idx];
+		}
+		// if string, remove by name
+		else {
+			var id = $.inArray(idx, this.objectNames);
+			if (id != -1) {
+				return this.objects[id];
+			}
+		}
+	};
+	
+	// Set get as alias for getObject.
+	$.jqplot.CanvasOverlay.prototype.get = $.jqplot.CanvasOverlay.prototype.getObject;
+	
+	$.jqplot.CanvasOverlay.prototype.clear = function(plot) {
+		this.canvas._ctx.clearRect(0,0,this.canvas.getWidth(), this.canvas.getHeight());
+	};
+	
+	$.jqplot.CanvasOverlay.prototype.draw = function(plot) {
+		var obj, 
+			objs = this.objects,
+			mr = this.markerRenderer,
+			start,
+			stop;
+		if (this.options.show) {
+			this.canvas._ctx.clearRect(0,0,this.canvas.getWidth(), this.canvas.getHeight());
+			for (var k=0; k<objs.length; k++) {
+				obj = objs[k];
+				var opts = $.extend(true, {}, obj.options);
+				if (obj.options.show) {
+					// style and shadow properties should be set before
+					// every draw of marker renderer.
+					mr.shadow = obj.options.shadow;
+					switch (obj.type) {
+						case 'line':
+							// style and shadow properties should be set before
+							// every draw of marker renderer.
+							mr.style = 'line';
+							opts.closePath = false;
+							start = [plot.axes[obj.options.xaxis].series_u2p(obj.options.start[0]), plot.axes[obj.options.yaxis].series_u2p(obj.options.start[1])];
+							stop = [plot.axes[obj.options.xaxis].series_u2p(obj.options.stop[0]), plot.axes[obj.options.yaxis].series_u2p(obj.options.stop[1])];
+							mr.draw(start, stop, this.canvas._ctx, opts);
+							break;
+						case 'horizontalLine':
+							
+							// style and shadow properties should be set before
+							// every draw of marker renderer.
+							if (obj.options.y != null) {
+								mr.style = 'line';
+								opts.closePath = false;
+								var xaxis = plot.axes[obj.options.xaxis],
+									xstart,
+									xstop,
+									y = plot.axes[obj.options.yaxis].series_u2p(obj.options.y),
+									xminoff = obj.options.xminOffset || obj.options.xOffset,
+									xmaxoff = obj.options.xmaxOffset || obj.options.xOffset;
+								if (obj.options.xmin != null) {
+									xstart = xaxis.series_u2p(obj.options.xmin);
+								}
+								else if (xminoff != null) {
+									if ($.type(xminoff) == "number") {
+										xstart = xaxis.series_u2p(xaxis.min + xminoff);
+									}
+									else if ($.type(xminoff) == "string") {
+										xstart = xaxis.series_u2p(xaxis.min) + parseFloat(xminoff);
+									}
+								}
+								if (obj.options.xmax != null) {
+									xstop = xaxis.series_u2p(obj.options.xmax);
+								}
+								else if (xmaxoff != null) {
+									if ($.type(xmaxoff) == "number") {
+										xstop = xaxis.series_u2p(xaxis.max - xmaxoff);
+									}
+									else if ($.type(xmaxoff) == "string") {
+										xstop = xaxis.series_u2p(xaxis.max) - parseFloat(xmaxoff);
+									}
+								}
+								if (xstop != null && xstart != null) {
+									mr.draw([xstart, y], [xstop, y], this.canvas._ctx, opts);
+								}
+							}
+							break;
+
+						case 'dashedHorizontalLine':
+							
+							var dashPat = obj.options.dashPattern;
+							var dashPatLen = 0;
+							for (var i=0; i<dashPat.length; i++) {
+								dashPatLen += dashPat[i];
+							}
+
+							// style and shadow properties should be set before
+							// every draw of marker renderer.
+							if (obj.options.y != null) {
+								mr.style = 'line';
+								opts.closePath = false;
+								var xaxis = plot.axes[obj.options.xaxis],
+									xstart,
+									xstop,
+									y = plot.axes[obj.options.yaxis].series_u2p(obj.options.y),
+									xminoff = obj.options.xminOffset || obj.options.xOffset,
+									xmaxoff = obj.options.xmaxOffset || obj.options.xOffset;
+								if (obj.options.xmin != null) {
+									xstart = xaxis.series_u2p(obj.options.xmin);
+								}
+								else if (xminoff != null) {
+									if ($.type(xminoff) == "number") {
+										xstart = xaxis.series_u2p(xaxis.min + xminoff);
+									}
+									else if ($.type(xminoff) == "string") {
+										xstart = xaxis.series_u2p(xaxis.min) + parseFloat(xminoff);
+									}
+								}
+								if (obj.options.xmax != null) {
+									xstop = xaxis.series_u2p(obj.options.xmax);
+								}
+								else if (xmaxoff != null) {
+									if ($.type(xmaxoff) == "number") {
+										xstop = xaxis.series_u2p(xaxis.max - xmaxoff);
+									}
+									else if ($.type(xmaxoff) == "string") {
+										xstop = xaxis.series_u2p(xaxis.max) - parseFloat(xmaxoff);
+									}
+								}
+								if (xstop != null && xstart != null) {
+									var numDash = Math.ceil((xstop - xstart)/dashPatLen);
+									var b=xstart, e;
+									for (var i=0; i<numDash; i++) {
+										for (var j=0; j<dashPat.length; j+=2) {
+											e = b+dashPat[j];
+											mr.draw([b, y], [e, y], this.canvas._ctx, opts);
+											b += dashPat[j];
+											if (j < dashPat.length-1) {
+												b += dashPat[j+1];
+											}
+										}
+									}
+								}
+							}
+							break;
+
+						case 'verticalLine':
+							
+							// style and shadow properties should be set before
+							// every draw of marker renderer.
+							if (obj.options.x != null) {
+								mr.style = 'line';
+								opts.closePath = false;
+								var yaxis = plot.axes[obj.options.yaxis],
+									ystart,
+									ystop,
+									x = plot.axes[obj.options.xaxis].series_u2p(obj.options.x),
+									yminoff = obj.options.yminOffset || obj.options.yOffset,
+									ymaxoff = obj.options.ymaxOffset || obj.options.yOffset;
+								if (obj.options.ymin != null) {
+									ystart = yaxis.series_u2p(obj.options.ymin);
+								}
+								else if (yminoff != null) {
+									if ($.type(yminoff) == "number") {
+										ystart = yaxis.series_u2p(yaxis.min - yminoff);
+									}
+									else if ($.type(yminoff) == "string") {
+										ystart = yaxis.series_u2p(yaxis.min) - parseFloat(yminoff);
+									}
+								}
+								if (obj.options.ymax != null) {
+									ystop = yaxis.series_u2p(obj.options.ymax);
+								}
+								else if (ymaxoff != null) {
+									if ($.type(ymaxoff) == "number") {
+										ystop = yaxis.series_u2p(yaxis.max + ymaxoff);
+									}
+									else if ($.type(ymaxoff) == "string") {
+										ystop = yaxis.series_u2p(yaxis.max) + parseFloat(ymaxoff);
+									}
+								}
+								if (ystop != null && ystart != null) {
+									mr.draw([x, ystart], [x, ystop], this.canvas._ctx, opts);
+								}
+							}
+							break;
+
+						case 'dashedVerticalLine':
+							
+							var dashPat = obj.options.dashPattern;
+							var dashPatLen = 0;
+							for (var i=0; i<dashPat.length; i++) {
+								dashPatLen += dashPat[i];
+							}
+
+							// style and shadow properties should be set before
+							// every draw of marker renderer.
+							if (obj.options.x != null) {
+								mr.style = 'line';
+								opts.closePath = false;
+								var yaxis = plot.axes[obj.options.yaxis],
+									ystart,
+									ystop,
+									x = plot.axes[obj.options.xaxis].series_u2p(obj.options.x),
+									yminoff = obj.options.yminOffset || obj.options.yOffset,
+									ymaxoff = obj.options.ymaxOffset || obj.options.yOffset;
+								if (obj.options.ymin != null) {
+									ystart = yaxis.series_u2p(obj.options.ymin);
+								}
+								else if (yminoff != null) {
+									if ($.type(yminoff) == "number") {
+										ystart = yaxis.series_u2p(yaxis.min - yminoff);
+									}
+									else if ($.type(yminoff) == "string") {
+										ystart = yaxis.series_u2p(yaxis.min) - parseFloat(yminoff);
+									}
+								}
+								if (obj.options.ymax != null) {
+									ystop = yaxis.series_u2p(obj.options.ymax);
+								}
+								else if (ymaxoff != null) {
+									if ($.type(ymaxoff) == "number") {
+										ystop = yaxis.series_u2p(yaxis.max + ymaxoff);
+									}
+									else if ($.type(ymaxoff) == "string") {
+										ystop = yaxis.series_u2p(yaxis.max) + parseFloat(ymaxoff);
+									}
+								}
+
+
+								if (ystop != null && ystart != null) {
+									var numDash = Math.ceil((ystart - ystop)/dashPatLen);
+									var firstDashAdjust = ((numDash * dashPatLen) - (ystart - ystop))/2.0;
+									var b=ystart, e, bs, es;
+									for (var i=0; i<numDash; i++) {
+										for (var j=0; j<dashPat.length; j+=2) {
+											e = b - dashPat[j];
+											if (e < ystop) {
+												e = ystop;
+											}
+											if (b < ystop) {
+												b = ystop;
+											}
+											// es = e;
+											// if (i == 0) {
+											// 	es += firstDashAdjust;
+											// }
+											mr.draw([x, b], [x, e], this.canvas._ctx, opts);
+											b -= dashPat[j];
+											if (j < dashPat.length-1) {
+												b -= dashPat[j+1];
+											}
+										}
+									}
+								}
+							}
+							break;
+
+						default:
+							break;
+					}
+				}
+			}
+		}
+	};
+    
+    // called within context of plot
+    // create a canvas which we can draw on.
+    // insert it before the eventCanvas, so eventCanvas will still capture events.
+    $.jqplot.CanvasOverlay.postPlotDraw = function() {
+        // Memory Leaks patch    
+        if (this.plugins.canvasOverlay && this.plugins.canvasOverlay.highlightCanvas) {
+            this.plugins.canvasOverlay.highlightCanvas.resetCanvas();
+            this.plugins.canvasOverlay.highlightCanvas = null;
+        }
+        this.plugins.canvasOverlay.canvas = new $.jqplot.GenericCanvas();
+        
+        this.eventCanvas._elem.before(this.plugins.canvasOverlay.canvas.createElement(this._gridPadding, 'jqplot-overlayCanvas-canvas', this._plotDimensions, this));
+        this.plugins.canvasOverlay.canvas.setContext();
+		if (!this.plugins.canvasOverlay.deferDraw) {
+			this.plugins.canvasOverlay.draw(this);
+		}
+    };
+    
+    $.jqplot.postInitHooks.push($.jqplot.CanvasOverlay.postPlotInit);
+    $.jqplot.postDrawHooks.push($.jqplot.CanvasOverlay.postPlotDraw);
+
+})(jQuery);

js/plugins/jqplot.canvasTextRenderer.js

@@ -0,0 +1,420 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {    
+    // This code is a modified version of the canvastext.js code, copyright below:
+    //
+    // This code is released to the public domain by Jim Studt, 2007.
+    // He may keep some sort of up to date copy at http://www.federated.com/~jim/canvastext/
+    //
+    $.jqplot.CanvasTextRenderer = function(options){
+        this.fontStyle = 'normal';  // normal, italic, oblique [not implemented]
+        this.fontVariant = 'normal';    // normal, small caps [not implemented]
+        this.fontWeight = 'normal'; // normal, bold, bolder, lighter, 100 - 900
+        this.fontSize = '10px'; 
+        this.fontFamily = 'sans-serif';
+        this.fontStretch = 1.0;
+        this.fillStyle = '#666666';
+        this.angle = 0;
+        this.textAlign = 'start';
+        this.textBaseline = 'alphabetic';
+        this.text;
+        this.width;
+        this.height;
+        this.pt2px = 1.28;
+
+        $.extend(true, this, options);
+        this.normalizedFontSize = this.normalizeFontSize(this.fontSize);
+        this.setHeight();
+    };
+    
+    $.jqplot.CanvasTextRenderer.prototype.init = function(options) {
+        $.extend(true, this, options);
+        this.normalizedFontSize = this.normalizeFontSize(this.fontSize);
+        this.setHeight();
+    };
+    
+    // convert css spec into point size
+    // returns float
+    $.jqplot.CanvasTextRenderer.prototype.normalizeFontSize = function(sz) {
+        sz = String(sz);
+        var n = parseFloat(sz);
+        if (sz.indexOf('px') > -1) {
+            return n/this.pt2px;
+        }
+        else if (sz.indexOf('pt') > -1) {
+            return n;
+        }
+        else if (sz.indexOf('em') > -1) {
+            return n*12;
+        }
+        else if (sz.indexOf('%') > -1) {
+            return n*12/100;
+        }
+        // default to pixels;
+        else {
+            return n/this.pt2px;
+        }
+    };
+    
+    
+    $.jqplot.CanvasTextRenderer.prototype.fontWeight2Float = function(w) {
+        // w = normal | bold | bolder | lighter | 100 | 200 | 300 | 400 | 500 | 600 | 700 | 800 | 900
+        // return values adjusted for Hershey font.
+        if (Number(w)) {
+            return w/400;
+        }
+        else {
+            switch (w) {
+                case 'normal':
+                    return 1;
+                    break;
+                case 'bold':
+                    return 1.75;
+                    break;
+                case 'bolder':
+                    return 2.25;
+                    break;
+                case 'lighter':
+                    return 0.75;
+                    break;
+                default:
+                    return 1;
+                    break;
+             }   
+        }
+    };
+    
+    $.jqplot.CanvasTextRenderer.prototype.getText = function() {
+        return this.text;
+    };
+    
+    $.jqplot.CanvasTextRenderer.prototype.setText = function(t, ctx) {
+        this.text = t;
+        this.setWidth(ctx);
+        return this;
+    };
+    
+    $.jqplot.CanvasTextRenderer.prototype.getWidth = function(ctx) {
+        return this.width;
+    };
+    
+    $.jqplot.CanvasTextRenderer.prototype.setWidth = function(ctx, w) {
+        if (!w) {
+            this.width = this.measure(ctx, this.text);
+        }
+        else {
+            this.width = w;   
+        }
+        return this;
+    };
+    
+    // return height in pixels.
+    $.jqplot.CanvasTextRenderer.prototype.getHeight = function(ctx) {
+        return this.height;
+    };
+    
+    // w - height in pt
+    // set heigh in px
+    $.jqplot.CanvasTextRenderer.prototype.setHeight = function(w) {
+        if (!w) {
+            //height = this.fontSize /0.75;
+            this.height = this.normalizedFontSize * this.pt2px;
+        }
+        else {
+            this.height = w;   
+        }
+        return this;
+    };
+
+    $.jqplot.CanvasTextRenderer.prototype.letter = function (ch)
+    {
+        return this.letters[ch];
+    };
+
+    $.jqplot.CanvasTextRenderer.prototype.ascent = function()
+    {
+        return this.normalizedFontSize;
+    };
+
+    $.jqplot.CanvasTextRenderer.prototype.descent = function()
+    {
+        return 7.0*this.normalizedFontSize/25.0;
+    };
+
+    $.jqplot.CanvasTextRenderer.prototype.measure = function(ctx, str)
+    {
+        var total = 0;
+        var len = str.length;
+ 
+        for (var i = 0; i < len; i++) {
+            var c = this.letter(str.charAt(i));
+            if (c) {
+                total += c.width * this.normalizedFontSize / 25.0 * this.fontStretch;
+            }
+        }
+        return total;
+    };
+
+    $.jqplot.CanvasTextRenderer.prototype.draw = function(ctx,str)
+    {
+        var x = 0;
+        // leave room at bottom for descenders.
+        var y = this.height*0.72;
+         var total = 0;
+         var len = str.length;
+         var mag = this.normalizedFontSize / 25.0;
+
+         ctx.save();
+         var tx, ty;
+         
+         // 1st quadrant
+         if ((-Math.PI/2 <= this.angle && this.angle <= 0) || (Math.PI*3/2 <= this.angle && this.angle <= Math.PI*2)) {
+             tx = 0;
+             ty = -Math.sin(this.angle) * this.width;
+         }
+         // 4th quadrant
+         else if ((0 < this.angle && this.angle <= Math.PI/2) || (-Math.PI*2 <= this.angle && this.angle <= -Math.PI*3/2)) {
+             tx = Math.sin(this.angle) * this.height;
+             ty = 0;
+         }
+         // 2nd quadrant
+         else if ((-Math.PI < this.angle && this.angle < -Math.PI/2) || (Math.PI <= this.angle && this.angle <= Math.PI*3/2)) {
+             tx = -Math.cos(this.angle) * this.width;
+             ty = -Math.sin(this.angle) * this.width - Math.cos(this.angle) * this.height;
+         }
+         // 3rd quadrant
+         else if ((-Math.PI*3/2 < this.angle && this.angle < Math.PI) || (Math.PI/2 < this.angle && this.angle < Math.PI)) {
+             tx = Math.sin(this.angle) * this.height - Math.cos(this.angle)*this.width;
+             ty = -Math.cos(this.angle) * this.height;
+         }
+         
+         ctx.strokeStyle = this.fillStyle;
+         ctx.fillStyle = this.fillStyle;
+         ctx.translate(tx, ty);
+         ctx.rotate(this.angle);
+         ctx.lineCap = "round";
+         // multiplier was 2.0
+         var fact = (this.normalizedFontSize > 30) ? 2.0 : 2 + (30 - this.normalizedFontSize)/20;
+         ctx.lineWidth = fact * mag * this.fontWeight2Float(this.fontWeight);
+         
+         for ( var i = 0; i < len; i++) {
+            var c = this.letter( str.charAt(i));
+            if ( !c) {
+                continue;
+            }
+
+            ctx.beginPath();
+
+            var penUp = 1;
+            var needStroke = 0;
+            for ( var j = 0; j < c.points.length; j++) {
+              var a = c.points[j];
+              if ( a[0] == -1 && a[1] == -1) {
+                  penUp = 1;
+                  continue;
+              }
+              if ( penUp) {
+                  ctx.moveTo( x + a[0]*mag*this.fontStretch, y - a[1]*mag);
+                  penUp = false;
+              } else {
+                  ctx.lineTo( x + a[0]*mag*this.fontStretch, y - a[1]*mag);
+              }
+            }
+            ctx.stroke();
+            x += c.width*mag*this.fontStretch;
+         }
+         ctx.restore();
+         return total;
+    };
+
+    $.jqplot.CanvasTextRenderer.prototype.letters = {
+         ' ': { width: 16, points: [] },
+         '!': { width: 10, points: [[5,21],[5,7],[-1,-1],[5,2],[4,1],[5,0],[6,1],[5,2]] },
+         '"': { width: 16, points: [[4,21],[4,14],[-1,-1],[12,21],[12,14]] },
+         '#': { width: 21, points: [[11,25],[4,-7],[-1,-1],[17,25],[10,-7],[-1,-1],[4,12],[18,12],[-1,-1],[3,6],[17,6]] },
+         '$': { width: 20, points: [[8,25],[8,-4],[-1,-1],[12,25],[12,-4],[-1,-1],[17,18],[15,20],[12,21],[8,21],[5,20],[3,18],[3,16],[4,14],[5,13],[7,12],[13,10],[15,9],[16,8],[17,6],[17,3],[15,1],[12,0],[8,0],[5,1],[3,3]] },
+         '%': { width: 24, points: [[21,21],[3,0],[-1,-1],[8,21],[10,19],[10,17],[9,15],[7,14],[5,14],[3,16],[3,18],[4,20],[6,21],[8,21],[10,20],[13,19],[16,19],[19,20],[21,21],[-1,-1],[17,7],[15,6],[14,4],[14,2],[16,0],[18,0],[20,1],[21,3],[21,5],[19,7],[17,7]] },
+         '&': { width: 26, points: [[23,12],[23,13],[22,14],[21,14],[20,13],[19,11],[17,6],[15,3],[13,1],[11,0],[7,0],[5,1],[4,2],[3,4],[3,6],[4,8],[5,9],[12,13],[13,14],[14,16],[14,18],[13,20],[11,21],[9,20],[8,18],[8,16],[9,13],[11,10],[16,3],[18,1],[20,0],[22,0],[23,1],[23,2]] },
+         '\'': { width: 10, points: [[5,19],[4,20],[5,21],[6,20],[6,18],[5,16],[4,15]] },
+         '(': { width: 14, points: [[11,25],[9,23],[7,20],[5,16],[4,11],[4,7],[5,2],[7,-2],[9,-5],[11,-7]] },
+         ')': { width: 14, points: [[3,25],[5,23],[7,20],[9,16],[10,11],[10,7],[9,2],[7,-2],[5,-5],[3,-7]] },
+         '*': { width: 16, points: [[8,21],[8,9],[-1,-1],[3,18],[13,12],[-1,-1],[13,18],[3,12]] },
+         '+': { width: 26, points: [[13,18],[13,0],[-1,-1],[4,9],[22,9]] },
+         ',': { width: 10, points: [[6,1],[5,0],[4,1],[5,2],[6,1],[6,-1],[5,-3],[4,-4]] },
+         '-': { width: 18, points: [[6,9],[12,9]] },
+         '.': { width: 10, points: [[5,2],[4,1],[5,0],[6,1],[5,2]] },
+         '/': { width: 22, points: [[20,25],[2,-7]] },
+         '0': { width: 20, points: [[9,21],[6,20],[4,17],[3,12],[3,9],[4,4],[6,1],[9,0],[11,0],[14,1],[16,4],[17,9],[17,12],[16,17],[14,20],[11,21],[9,21]] },
+         '1': { width: 20, points: [[6,17],[8,18],[11,21],[11,0]] },
+         '2': { width: 20, points: [[4,16],[4,17],[5,19],[6,20],[8,21],[12,21],[14,20],[15,19],[16,17],[16,15],[15,13],[13,10],[3,0],[17,0]] },
+         '3': { width: 20, points: [[5,21],[16,21],[10,13],[13,13],[15,12],[16,11],[17,8],[17,6],[16,3],[14,1],[11,0],[8,0],[5,1],[4,2],[3,4]] },
+         '4': { width: 20, points: [[13,21],[3,7],[18,7],[-1,-1],[13,21],[13,0]] },
+         '5': { width: 20, points: [[15,21],[5,21],[4,12],[5,13],[8,14],[11,14],[14,13],[16,11],[17,8],[17,6],[16,3],[14,1],[11,0],[8,0],[5,1],[4,2],[3,4]] },
+         '6': { width: 20, points: [[16,18],[15,20],[12,21],[10,21],[7,20],[5,17],[4,12],[4,7],[5,3],[7,1],[10,0],[11,0],[14,1],[16,3],[17,6],[17,7],[16,10],[14,12],[11,13],[10,13],[7,12],[5,10],[4,7]] },
+         '7': { width: 20, points: [[17,21],[7,0],[-1,-1],[3,21],[17,21]] },
+         '8': { width: 20, points: [[8,21],[5,20],[4,18],[4,16],[5,14],[7,13],[11,12],[14,11],[16,9],[17,7],[17,4],[16,2],[15,1],[12,0],[8,0],[5,1],[4,2],[3,4],[3,7],[4,9],[6,11],[9,12],[13,13],[15,14],[16,16],[16,18],[15,20],[12,21],[8,21]] },
+         '9': { width: 20, points: [[16,14],[15,11],[13,9],[10,8],[9,8],[6,9],[4,11],[3,14],[3,15],[4,18],[6,20],[9,21],[10,21],[13,20],[15,18],[16,14],[16,9],[15,4],[13,1],[10,0],[8,0],[5,1],[4,3]] },
+         ':': { width: 10, points: [[5,14],[4,13],[5,12],[6,13],[5,14],[-1,-1],[5,2],[4,1],[5,0],[6,1],[5,2]] },
+         ';': { width: 10, points: [[5,14],[4,13],[5,12],[6,13],[5,14],[-1,-1],[6,1],[5,0],[4,1],[5,2],[6,1],[6,-1],[5,-3],[4,-4]] },
+         '<': { width: 24, points: [[20,18],[4,9],[20,0]] },
+         '=': { width: 26, points: [[4,12],[22,12],[-1,-1],[4,6],[22,6]] },
+         '>': { width: 24, points: [[4,18],[20,9],[4,0]] },
+         '?': { width: 18, points: [[3,16],[3,17],[4,19],[5,20],[7,21],[11,21],[13,20],[14,19],[15,17],[15,15],[14,13],[13,12],[9,10],[9,7],[-1,-1],[9,2],[8,1],[9,0],[10,1],[9,2]] },
+         '@': { width: 27, points: [[18,13],[17,15],[15,16],[12,16],[10,15],[9,14],[8,11],[8,8],[9,6],[11,5],[14,5],[16,6],[17,8],[-1,-1],[12,16],[10,14],[9,11],[9,8],[10,6],[11,5],[-1,-1],[18,16],[17,8],[17,6],[19,5],[21,5],[23,7],[24,10],[24,12],[23,15],[22,17],[20,19],[18,20],[15,21],[12,21],[9,20],[7,19],[5,17],[4,15],[3,12],[3,9],[4,6],[5,4],[7,2],[9,1],[12,0],[15,0],[18,1],[20,2],[21,3],[-1,-1],[19,16],[18,8],[18,6],[19,5]] },
+         'A': { width: 18, points: [[9,21],[1,0],[-1,-1],[9,21],[17,0],[-1,-1],[4,7],[14,7]] },
+         'B': { width: 21, points: [[4,21],[4,0],[-1,-1],[4,21],[13,21],[16,20],[17,19],[18,17],[18,15],[17,13],[16,12],[13,11],[-1,-1],[4,11],[13,11],[16,10],[17,9],[18,7],[18,4],[17,2],[16,1],[13,0],[4,0]] },
+         'C': { width: 21, points: [[18,16],[17,18],[15,20],[13,21],[9,21],[7,20],[5,18],[4,16],[3,13],[3,8],[4,5],[5,3],[7,1],[9,0],[13,0],[15,1],[17,3],[18,5]] },
+         'D': { width: 21, points: [[4,21],[4,0],[-1,-1],[4,21],[11,21],[14,20],[16,18],[17,16],[18,13],[18,8],[17,5],[16,3],[14,1],[11,0],[4,0]] },
+         'E': { width: 19, points: [[4,21],[4,0],[-1,-1],[4,21],[17,21],[-1,-1],[4,11],[12,11],[-1,-1],[4,0],[17,0]] },
+         'F': { width: 18, points: [[4,21],[4,0],[-1,-1],[4,21],[17,21],[-1,-1],[4,11],[12,11]] },
+         'G': { width: 21, points: [[18,16],[17,18],[15,20],[13,21],[9,21],[7,20],[5,18],[4,16],[3,13],[3,8],[4,5],[5,3],[7,1],[9,0],[13,0],[15,1],[17,3],[18,5],[18,8],[-1,-1],[13,8],[18,8]] },
+         'H': { width: 22, points: [[4,21],[4,0],[-1,-1],[18,21],[18,0],[-1,-1],[4,11],[18,11]] },
+         'I': { width: 8, points: [[4,21],[4,0]] },
+         'J': { width: 16, points: [[12,21],[12,5],[11,2],[10,1],[8,0],[6,0],[4,1],[3,2],[2,5],[2,7]] },
+         'K': { width: 21, points: [[4,21],[4,0],[-1,-1],[18,21],[4,7],[-1,-1],[9,12],[18,0]] },
+         'L': { width: 17, points: [[4,21],[4,0],[-1,-1],[4,0],[16,0]] },
+         'M': { width: 24, points: [[4,21],[4,0],[-1,-1],[4,21],[12,0],[-1,-1],[20,21],[12,0],[-1,-1],[20,21],[20,0]] },
+         'N': { width: 22, points: [[4,21],[4,0],[-1,-1],[4,21],[18,0],[-1,-1],[18,21],[18,0]] },
+         'O': { width: 22, points: [[9,21],[7,20],[5,18],[4,16],[3,13],[3,8],[4,5],[5,3],[7,1],[9,0],[13,0],[15,1],[17,3],[18,5],[19,8],[19,13],[18,16],[17,18],[15,20],[13,21],[9,21]] },
+         'P': { width: 21, points: [[4,21],[4,0],[-1,-1],[4,21],[13,21],[16,20],[17,19],[18,17],[18,14],[17,12],[16,11],[13,10],[4,10]] },
+         'Q': { width: 22, points: [[9,21],[7,20],[5,18],[4,16],[3,13],[3,8],[4,5],[5,3],[7,1],[9,0],[13,0],[15,1],[17,3],[18,5],[19,8],[19,13],[18,16],[17,18],[15,20],[13,21],[9,21],[-1,-1],[12,4],[18,-2]] },
+         'R': { width: 21, points: [[4,21],[4,0],[-1,-1],[4,21],[13,21],[16,20],[17,19],[18,17],[18,15],[17,13],[16,12],[13,11],[4,11],[-1,-1],[11,11],[18,0]] },
+         'S': { width: 20, points: [[17,18],[15,20],[12,21],[8,21],[5,20],[3,18],[3,16],[4,14],[5,13],[7,12],[13,10],[15,9],[16,8],[17,6],[17,3],[15,1],[12,0],[8,0],[5,1],[3,3]] },
+         'T': { width: 16, points: [[8,21],[8,0],[-1,-1],[1,21],[15,21]] },
+         'U': { width: 22, points: [[4,21],[4,6],[5,3],[7,1],[10,0],[12,0],[15,1],[17,3],[18,6],[18,21]] },
+         'V': { width: 18, points: [[1,21],[9,0],[-1,-1],[17,21],[9,0]] },
+         'W': { width: 24, points: [[2,21],[7,0],[-1,-1],[12,21],[7,0],[-1,-1],[12,21],[17,0],[-1,-1],[22,21],[17,0]] },
+         'X': { width: 20, points: [[3,21],[17,0],[-1,-1],[17,21],[3,0]] },
+         'Y': { width: 18, points: [[1,21],[9,11],[9,0],[-1,-1],[17,21],[9,11]] },
+         'Z': { width: 20, points: [[17,21],[3,0],[-1,-1],[3,21],[17,21],[-1,-1],[3,0],[17,0]] },
+         '[': { width: 14, points: [[4,25],[4,-7],[-1,-1],[5,25],[5,-7],[-1,-1],[4,25],[11,25],[-1,-1],[4,-7],[11,-7]] },
+         '\\': { width: 14, points: [[0,21],[14,-3]] },
+         ']': { width: 14, points: [[9,25],[9,-7],[-1,-1],[10,25],[10,-7],[-1,-1],[3,25],[10,25],[-1,-1],[3,-7],[10,-7]] },
+         '^': { width: 16, points: [[6,15],[8,18],[10,15],[-1,-1],[3,12],[8,17],[13,12],[-1,-1],[8,17],[8,0]] },
+         '_': { width: 16, points: [[0,-2],[16,-2]] },
+         '`': { width: 10, points: [[6,21],[5,20],[4,18],[4,16],[5,15],[6,16],[5,17]] },
+         'a': { width: 19, points: [[15,14],[15,0],[-1,-1],[15,11],[13,13],[11,14],[8,14],[6,13],[4,11],[3,8],[3,6],[4,3],[6,1],[8,0],[11,0],[13,1],[15,3]] },
+         'b': { width: 19, points: [[4,21],[4,0],[-1,-1],[4,11],[6,13],[8,14],[11,14],[13,13],[15,11],[16,8],[16,6],[15,3],[13,1],[11,0],[8,0],[6,1],[4,3]] },
+         'c': { width: 18, points: [[15,11],[13,13],[11,14],[8,14],[6,13],[4,11],[3,8],[3,6],[4,3],[6,1],[8,0],[11,0],[13,1],[15,3]] },
+         'd': { width: 19, points: [[15,21],[15,0],[-1,-1],[15,11],[13,13],[11,14],[8,14],[6,13],[4,11],[3,8],[3,6],[4,3],[6,1],[8,0],[11,0],[13,1],[15,3]] },
+         'e': { width: 18, points: [[3,8],[15,8],[15,10],[14,12],[13,13],[11,14],[8,14],[6,13],[4,11],[3,8],[3,6],[4,3],[6,1],[8,0],[11,0],[13,1],[15,3]] },
+         'f': { width: 12, points: [[10,21],[8,21],[6,20],[5,17],[5,0],[-1,-1],[2,14],[9,14]] },
+         'g': { width: 19, points: [[15,14],[15,-2],[14,-5],[13,-6],[11,-7],[8,-7],[6,-6],[-1,-1],[15,11],[13,13],[11,14],[8,14],[6,13],[4,11],[3,8],[3,6],[4,3],[6,1],[8,0],[11,0],[13,1],[15,3]] },
+         'h': { width: 19, points: [[4,21],[4,0],[-1,-1],[4,10],[7,13],[9,14],[12,14],[14,13],[15,10],[15,0]] },
+         'i': { width: 8, points: [[3,21],[4,20],[5,21],[4,22],[3,21],[-1,-1],[4,14],[4,0]] },
+         'j': { width: 10, points: [[5,21],[6,20],[7,21],[6,22],[5,21],[-1,-1],[6,14],[6,-3],[5,-6],[3,-7],[1,-7]] },
+         'k': { width: 17, points: [[4,21],[4,0],[-1,-1],[14,14],[4,4],[-1,-1],[8,8],[15,0]] },
+         'l': { width: 8, points: [[4,21],[4,0]] },
+         'm': { width: 30, points: [[4,14],[4,0],[-1,-1],[4,10],[7,13],[9,14],[12,14],[14,13],[15,10],[15,0],[-1,-1],[15,10],[18,13],[20,14],[23,14],[25,13],[26,10],[26,0]] },
+         'n': { width: 19, points: [[4,14],[4,0],[-1,-1],[4,10],[7,13],[9,14],[12,14],[14,13],[15,10],[15,0]] },
+         'o': { width: 19, points: [[8,14],[6,13],[4,11],[3,8],[3,6],[4,3],[6,1],[8,0],[11,0],[13,1],[15,3],[16,6],[16,8],[15,11],[13,13],[11,14],[8,14]] },
+         'p': { width: 19, points: [[4,14],[4,-7],[-1,-1],[4,11],[6,13],[8,14],[11,14],[13,13],[15,11],[16,8],[16,6],[15,3],[13,1],[11,0],[8,0],[6,1],[4,3]] },
+         'q': { width: 19, points: [[15,14],[15,-7],[-1,-1],[15,11],[13,13],[11,14],[8,14],[6,13],[4,11],[3,8],[3,6],[4,3],[6,1],[8,0],[11,0],[13,1],[15,3]] },
+         'r': { width: 13, points: [[4,14],[4,0],[-1,-1],[4,8],[5,11],[7,13],[9,14],[12,14]] },
+         's': { width: 17, points: [[14,11],[13,13],[10,14],[7,14],[4,13],[3,11],[4,9],[6,8],[11,7],[13,6],[14,4],[14,3],[13,1],[10,0],[7,0],[4,1],[3,3]] },
+         't': { width: 12, points: [[5,21],[5,4],[6,1],[8,0],[10,0],[-1,-1],[2,14],[9,14]] },
+         'u': { width: 19, points: [[4,14],[4,4],[5,1],[7,0],[10,0],[12,1],[15,4],[-1,-1],[15,14],[15,0]] },
+         'v': { width: 16, points: [[2,14],[8,0],[-1,-1],[14,14],[8,0]] },
+         'w': { width: 22, points: [[3,14],[7,0],[-1,-1],[11,14],[7,0],[-1,-1],[11,14],[15,0],[-1,-1],[19,14],[15,0]] },
+         'x': { width: 17, points: [[3,14],[14,0],[-1,-1],[14,14],[3,0]] },
+         'y': { width: 16, points: [[2,14],[8,0],[-1,-1],[14,14],[8,0],[6,-4],[4,-6],[2,-7],[1,-7]] },
+         'z': { width: 17, points: [[14,14],[3,0],[-1,-1],[3,14],[14,14],[-1,-1],[3,0],[14,0]] },
+         '{': { width: 14, points: [[9,25],[7,24],[6,23],[5,21],[5,19],[6,17],[7,16],[8,14],[8,12],[6,10],[-1,-1],[7,24],[6,22],[6,20],[7,18],[8,17],[9,15],[9,13],[8,11],[4,9],[8,7],[9,5],[9,3],[8,1],[7,0],[6,-2],[6,-4],[7,-6],[-1,-1],[6,8],[8,6],[8,4],[7,2],[6,1],[5,-1],[5,-3],[6,-5],[7,-6],[9,-7]] },
+         '|': { width: 8, points: [[4,25],[4,-7]] },
+         '}': { width: 14, points: [[5,25],[7,24],[8,23],[9,21],[9,19],[8,17],[7,16],[6,14],[6,12],[8,10],[-1,-1],[7,24],[8,22],[8,20],[7,18],[6,17],[5,15],[5,13],[6,11],[10,9],[6,7],[5,5],[5,3],[6,1],[7,0],[8,-2],[8,-4],[7,-6],[-1,-1],[8,8],[6,6],[6,4],[7,2],[8,1],[9,-1],[9,-3],[8,-5],[7,-6],[5,-7]] },
+         '~': { width: 24, points: [[3,6],[3,8],[4,11],[6,12],[8,12],[10,11],[14,8],[16,7],[18,7],[20,8],[21,10],[-1,-1],[3,8],[4,10],[6,11],[8,11],[10,10],[14,7],[16,6],[18,6],[20,7],[21,10],[21,12]] }
+     };
+     
+    $.jqplot.CanvasFontRenderer = function(options) {
+        options = options || {};
+        if (!options.pt2px) {
+            options.pt2px = 1.5;
+        }
+        $.jqplot.CanvasTextRenderer.call(this, options);
+    };
+    
+    $.jqplot.CanvasFontRenderer.prototype = new $.jqplot.CanvasTextRenderer({});
+    $.jqplot.CanvasFontRenderer.prototype.constructor = $.jqplot.CanvasFontRenderer;
+
+    $.jqplot.CanvasFontRenderer.prototype.measure = function(ctx, str)
+    {
+        // var fstyle = this.fontStyle+' '+this.fontVariant+' '+this.fontWeight+' '+this.fontSize+' '+this.fontFamily;
+        var fstyle = this.fontSize+' '+this.fontFamily;
+        ctx.save();
+        ctx.font = fstyle;
+        var w = ctx.measureText(str).width;
+        ctx.restore();
+        return w;
+    };
+
+    $.jqplot.CanvasFontRenderer.prototype.draw = function(ctx, str)
+    {
+        var x = 0;
+        // leave room at bottom for descenders.
+        var y = this.height*0.72;
+        //var y = 12;
+
+         ctx.save();
+         var tx, ty;
+         
+         // 1st quadrant
+         if ((-Math.PI/2 <= this.angle && this.angle <= 0) || (Math.PI*3/2 <= this.angle && this.angle <= Math.PI*2)) {
+             tx = 0;
+             ty = -Math.sin(this.angle) * this.width;
+         }
+         // 4th quadrant
+         else if ((0 < this.angle && this.angle <= Math.PI/2) || (-Math.PI*2 <= this.angle && this.angle <= -Math.PI*3/2)) {
+             tx = Math.sin(this.angle) * this.height;
+             ty = 0;
+         }
+         // 2nd quadrant
+         else if ((-Math.PI < this.angle && this.angle < -Math.PI/2) || (Math.PI <= this.angle && this.angle <= Math.PI*3/2)) {
+             tx = -Math.cos(this.angle) * this.width;
+             ty = -Math.sin(this.angle) * this.width - Math.cos(this.angle) * this.height;
+         }
+         // 3rd quadrant
+         else if ((-Math.PI*3/2 < this.angle && this.angle < Math.PI) || (Math.PI/2 < this.angle && this.angle < Math.PI)) {
+             tx = Math.sin(this.angle) * this.height - Math.cos(this.angle)*this.width;
+             ty = -Math.cos(this.angle) * this.height;
+         }
+         ctx.strokeStyle = this.fillStyle;
+         ctx.fillStyle = this.fillStyle;
+        // var fstyle = this.fontStyle+' '+this.fontVariant+' '+this.fontWeight+' '+this.fontSize+' '+this.fontFamily;
+        var fstyle = this.fontSize+' '+this.fontFamily;
+         ctx.font = fstyle;
+         ctx.translate(tx, ty);
+         ctx.rotate(this.angle);
+         ctx.fillText(str, x, y);
+         // ctx.strokeText(str, x, y);
+
+         ctx.restore();
+    };
+    
+})(jQuery);

js/plugins/jqplot.categoryAxisRenderer.js

@@ -0,0 +1,636 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {   
+    /**
+    *  class: $.jqplot.CategoryAxisRenderer
+    *  A plugin for jqPlot to render a category style axis, with equal pixel spacing between y data values of a series.
+    *  
+    *  To use this renderer, include the plugin in your source
+    *  > <script type="text/javascript" language="javascript" src="plugins/jqplot.categoryAxisRenderer.js"></script>
+    *  
+    *  and supply the appropriate options to your plot
+    *  
+    *  > {axes:{xaxis:{renderer:$.jqplot.CategoryAxisRenderer}}}
+    **/
+    $.jqplot.CategoryAxisRenderer = function(options) {
+        $.jqplot.LinearAxisRenderer.call(this);
+        // prop: sortMergedLabels
+        // True to sort tick labels when labels are created by merging
+        // x axis values from multiple series.  That is, say you have
+        // two series like:
+        // > line1 = [[2006, 4],            [2008, 9], [2009, 16]];
+        // > line2 = [[2006, 3], [2007, 7], [2008, 6]];
+        // If no label array is specified, tick labels will be collected
+        // from the x values of the series.  With sortMergedLabels
+        // set to true, tick labels will be:
+        // > [2006, 2007, 2008, 2009]
+        // With sortMergedLabels set to false, tick labels will be:
+        // > [2006, 2008, 2009, 2007]
+        //
+        // Note, this property is specified on the renderOptions for the 
+        // axes when creating a plot:
+        // > axes:{xaxis:{renderer:$.jqplot.CategoryAxisRenderer, rendererOptions:{sortMergedLabels:true}}}
+        this.sortMergedLabels = false;
+    };
+    
+    $.jqplot.CategoryAxisRenderer.prototype = new $.jqplot.LinearAxisRenderer();
+    $.jqplot.CategoryAxisRenderer.prototype.constructor = $.jqplot.CategoryAxisRenderer;
+    
+    $.jqplot.CategoryAxisRenderer.prototype.init = function(options){
+        this.groups = 1;
+        this.groupLabels = [];
+        this._groupLabels = [];
+        this._grouped = false;
+        this._barsPerGroup = null;
+        // prop: tickRenderer
+        // A class of a rendering engine for creating the ticks labels displayed on the plot, 
+        // See <$.jqplot.AxisTickRenderer>.
+        // this.tickRenderer = $.jqplot.AxisTickRenderer;
+        // this.labelRenderer = $.jqplot.AxisLabelRenderer;
+        $.extend(true, this, {tickOptions:{formatString:'%d'}}, options);
+        var db = this._dataBounds;
+        // Go through all the series attached to this axis and find
+        // the min/max bounds for this axis.
+        for (var i=0; i<this._series.length; i++) {
+            var s = this._series[i];
+            if (s.groups) {
+                this.groups = s.groups;
+            }
+            var d = s.data;
+            
+            for (var j=0; j<d.length; j++) { 
+                if (this.name == 'xaxis' || this.name == 'x2axis') {
+                    if (d[j][0] < db.min || db.min == null) {
+                        db.min = d[j][0];
+                    }
+                    if (d[j][0] > db.max || db.max == null) {
+                        db.max = d[j][0];
+                    }
+                }              
+                else {
+                    if (d[j][1] < db.min || db.min == null) {
+                        db.min = d[j][1];
+                    }
+                    if (d[j][1] > db.max || db.max == null) {
+                        db.max = d[j][1];
+                    }
+                }              
+            }
+        }
+        
+        if (this.groupLabels.length) {
+            this.groups = this.groupLabels.length;
+        }
+    };
+ 
+
+    $.jqplot.CategoryAxisRenderer.prototype.createTicks = function() {
+        // we're are operating on an axis here
+        var ticks = this._ticks;
+        var userTicks = this.ticks;
+        var name = this.name;
+        // databounds were set on axis initialization.
+        var db = this._dataBounds;
+        var dim, interval;
+        var min, max;
+        var pos1, pos2;
+        var tt, i;
+
+        // if we already have ticks, use them.
+        if (userTicks.length) {
+            // adjust with blanks if we have groups
+            if (this.groups > 1 && !this._grouped) {
+                var l = userTicks.length;
+                var skip = parseInt(l/this.groups, 10);
+                var count = 0;
+                for (var i=skip; i<l; i+=skip) {
+                    userTicks.splice(i+count, 0, ' ');
+                    count++;
+                }
+                this._grouped = true;
+            }
+            this.min = 0.5;
+            this.max = userTicks.length + 0.5;
+            var range = this.max - this.min;
+            this.numberTicks = 2*userTicks.length + 1;
+            for (i=0; i<userTicks.length; i++){
+                tt = this.min + 2 * i * range / (this.numberTicks-1);
+                // need a marker before and after the tick
+                var t = new this.tickRenderer(this.tickOptions);
+                t.showLabel = false;
+                // t.showMark = true;
+                t.setTick(tt, this.name);
+                this._ticks.push(t);
+                var t = new this.tickRenderer(this.tickOptions);
+                t.label = userTicks[i];
+                // t.showLabel = true;
+                t.showMark = false;
+                t.showGridline = false;
+                t.setTick(tt+0.5, this.name);
+                this._ticks.push(t);
+            }
+            // now add the last tick at the end
+            var t = new this.tickRenderer(this.tickOptions);
+            t.showLabel = false;
+            // t.showMark = true;
+            t.setTick(tt+1, this.name);
+            this._ticks.push(t);
+        }
+
+        // we don't have any ticks yet, let's make some!
+        else {
+            if (name == 'xaxis' || name == 'x2axis') {
+                dim = this._plotDimensions.width;
+            }
+            else {
+                dim = this._plotDimensions.height;
+            }
+            
+            // if min, max and number of ticks specified, user can't specify interval.
+            if (this.min != null && this.max != null && this.numberTicks != null) {
+                this.tickInterval = null;
+            }
+            
+            // if max, min, and interval specified and interval won't fit, ignore interval.
+            if (this.min != null && this.max != null && this.tickInterval != null) {
+                if (parseInt((this.max-this.min)/this.tickInterval, 10) != (this.max-this.min)/this.tickInterval) {
+                    this.tickInterval = null;
+                }
+            }
+        
+            // find out how many categories are in the lines and collect labels
+            var labels = [];
+            var numcats = 0;
+            var min = 0.5;
+            var max, val;
+            var isMerged = false;
+            for (var i=0; i<this._series.length; i++) {
+                var s = this._series[i];
+                for (var j=0; j<s.data.length; j++) {
+                    if (this.name == 'xaxis' || this.name == 'x2axis') {
+                        val = s.data[j][0];
+                    }
+                    else {
+                        val = s.data[j][1];
+                    }
+                    if ($.inArray(val, labels) == -1) {
+                        isMerged = true;
+                        numcats += 1;      
+                        labels.push(val);
+                    }
+                }
+            }
+            
+            if (isMerged && this.sortMergedLabels) {
+                labels.sort(function(a,b) { return a - b; });
+            }
+            
+            // keep a reference to these tick labels to use for redrawing plot (see bug #57)
+            this.ticks = labels;
+            
+            // now bin the data values to the right lables.
+            for (var i=0; i<this._series.length; i++) {
+                var s = this._series[i];
+                for (var j=0; j<s.data.length; j++) {
+                    if (this.name == 'xaxis' || this.name == 'x2axis') {
+                        val = s.data[j][0];
+                    }
+                    else {
+                        val = s.data[j][1];
+                    }
+                    // for category axis, force the values into category bins.
+                    // we should have the value in the label array now.
+                    var idx = $.inArray(val, labels)+1;
+                    if (this.name == 'xaxis' || this.name == 'x2axis') {
+                        s.data[j][0] = idx;
+                    }
+                    else {
+                        s.data[j][1] = idx;
+                    }
+                }
+            }
+            
+            // adjust with blanks if we have groups
+            if (this.groups > 1 && !this._grouped) {
+                var l = labels.length;
+                var skip = parseInt(l/this.groups, 10);
+                var count = 0;
+                for (var i=skip; i<l; i+=skip+1) {
+                    labels[i] = ' ';
+                }
+                this._grouped = true;
+            }
+        
+            max = numcats + 0.5;
+            if (this.numberTicks == null) {
+                this.numberTicks = 2*numcats + 1;
+            }
+
+            var range = max - min;
+            this.min = min;
+            this.max = max;
+            var track = 0;
+            
+            // todo: adjust this so more ticks displayed.
+            var maxVisibleTicks = parseInt(3+dim/20, 10);
+            var skip = parseInt(numcats/maxVisibleTicks, 10);
+
+            if (this.tickInterval == null) {
+
+                this.tickInterval = range / (this.numberTicks-1);
+
+            }
+            // if tickInterval is specified, we will ignore any computed maximum.
+            for (var i=0; i<this.numberTicks; i++){
+                tt = this.min + i * this.tickInterval;
+                var t = new this.tickRenderer(this.tickOptions);
+                // if even tick, it isn't a category, it's a divider
+                if (i/2 == parseInt(i/2, 10)) {
+                    t.showLabel = false;
+                    t.showMark = true;
+                }
+                else {
+                    if (skip>0 && track<skip) {
+                        t.showLabel = false;
+                        track += 1;
+                    }
+                    else {
+                        t.showLabel = true;
+                        track = 0;
+                    } 
+                    t.label = t.formatter(t.formatString, labels[(i-1)/2]);
+                    t.showMark = false;
+                    t.showGridline = false;
+                }
+                t.setTick(tt, this.name);
+                this._ticks.push(t);
+            }
+        }
+        
+    };
+    
+    // called with scope of axis
+    $.jqplot.CategoryAxisRenderer.prototype.draw = function(ctx, plot) {
+        if (this.show) {
+            // populate the axis label and value properties.
+            // createTicks is a method on the renderer, but
+            // call it within the scope of the axis.
+            this.renderer.createTicks.call(this);
+            // fill a div with axes labels in the right direction.
+            // Need to pregenerate each axis to get it's bounds and
+            // position it and the labels correctly on the plot.
+            var dim=0;
+            var temp;
+            // Added for theming.
+            if (this._elem) {
+                // this._elem.empty();
+                // Memory Leaks patch
+                this._elem.emptyForce();
+            }
+
+            this._elem = this._elem || $('<div class="jqplot-axis jqplot-'+this.name+'" style="position:absolute;"></div>');
+            
+            if (this.name == 'xaxis' || this.name == 'x2axis') {
+                this._elem.width(this._plotDimensions.width);
+            }
+            else {
+                this._elem.height(this._plotDimensions.height);
+            }
+            
+            // create a _label object.
+            this.labelOptions.axis = this.name;
+            this._label = new this.labelRenderer(this.labelOptions);
+            if (this._label.show) {
+                var elem = this._label.draw(ctx, plot);
+                elem.appendTo(this._elem);
+            }
+    
+            var t = this._ticks;
+            for (var i=0; i<t.length; i++) {
+                var tick = t[i];
+                if (tick.showLabel && (!tick.isMinorTick || this.showMinorTicks)) {
+                    var elem = tick.draw(ctx, plot);
+                    elem.appendTo(this._elem);
+                }
+            }
+        
+            this._groupLabels = [];
+            // now make group labels
+            for (var i=0; i<this.groupLabels.length; i++)
+            {
+                var elem = $('<div style="position:absolute;" class="jqplot-'+this.name+'-groupLabel"></div>');
+                elem.html(this.groupLabels[i]);
+                this._groupLabels.push(elem);
+                elem.appendTo(this._elem);
+            }
+        }
+        return this._elem;
+    };
+    
+    // called with scope of axis
+    $.jqplot.CategoryAxisRenderer.prototype.set = function() { 
+        var dim = 0;
+        var temp;
+        var w = 0;
+        var h = 0;
+        var lshow = (this._label == null) ? false : this._label.show;
+        if (this.show) {
+            var t = this._ticks;
+            for (var i=0; i<t.length; i++) {
+                var tick = t[i];
+                if (tick.showLabel && (!tick.isMinorTick || this.showMinorTicks)) {
+                    if (this.name == 'xaxis' || this.name == 'x2axis') {
+                        temp = tick._elem.outerHeight(true);
+                    }
+                    else {
+                        temp = tick._elem.outerWidth(true);
+                    }
+                    if (temp > dim) {
+                        dim = temp;
+                    }
+                }
+            }
+            
+            var dim2 = 0;
+            for (var i=0; i<this._groupLabels.length; i++) {
+                var l = this._groupLabels[i];
+                if (this.name == 'xaxis' || this.name == 'x2axis') {
+                    temp = l.outerHeight(true);
+                }
+                else {
+                    temp = l.outerWidth(true);
+                }
+                if (temp > dim2) {
+                    dim2 = temp;
+                }
+            }
+            
+            if (lshow) {
+                w = this._label._elem.outerWidth(true);
+                h = this._label._elem.outerHeight(true); 
+            }
+            if (this.name == 'xaxis') {
+                dim += dim2 + h;
+                this._elem.css({'height':dim+'px', left:'0px', bottom:'0px'});
+            }
+            else if (this.name == 'x2axis') {
+                dim += dim2 + h;
+                this._elem.css({'height':dim+'px', left:'0px', top:'0px'});
+            }
+            else if (this.name == 'yaxis') {
+                dim += dim2 + w;
+                this._elem.css({'width':dim+'px', left:'0px', top:'0px'});
+                if (lshow && this._label.constructor == $.jqplot.AxisLabelRenderer) {
+                    this._label._elem.css('width', w+'px');
+                }
+            }
+            else {
+                dim += dim2 + w;
+                this._elem.css({'width':dim+'px', right:'0px', top:'0px'});
+                if (lshow && this._label.constructor == $.jqplot.AxisLabelRenderer) {
+                    this._label._elem.css('width', w+'px');
+                }
+            }
+        }  
+    };
+    
+    // called with scope of axis
+    $.jqplot.CategoryAxisRenderer.prototype.pack = function(pos, offsets) {
+        var ticks = this._ticks;
+        var max = this.max;
+        var min = this.min;
+        var offmax = offsets.max;
+        var offmin = offsets.min;
+        var lshow = (this._label == null) ? false : this._label.show;
+        var i;
+		
+        for (var p in pos) {
+            this._elem.css(p, pos[p]);
+        }
+        
+        this._offsets = offsets;
+        // pixellength will be + for x axes and - for y axes becasue pixels always measured from top left.
+        var pixellength = offmax - offmin;
+        var unitlength = max - min;
+        
+        // point to unit and unit to point conversions references to Plot DOM element top left corner.
+        this.p2u = function(p){
+            return (p - offmin) * unitlength / pixellength + min;
+        };
+        
+        this.u2p = function(u){
+            return (u - min) * pixellength / unitlength + offmin;
+        };
+                
+        if (this.name == 'xaxis' || this.name == 'x2axis'){
+            this.series_u2p = function(u){
+                return (u - min) * pixellength / unitlength;
+            };
+            this.series_p2u = function(p){
+                return p * unitlength / pixellength + min;
+            };
+        }
+        
+        else {
+            this.series_u2p = function(u){
+                return (u - max) * pixellength / unitlength;
+            };
+            this.series_p2u = function(p){
+                return p * unitlength / pixellength + max;
+            };
+        }
+        
+        if (this.show) {
+            if (this.name == 'xaxis' || this.name == 'x2axis') {
+                for (i=0; i<ticks.length; i++) {
+                    var t = ticks[i];
+                    if (t.show && t.showLabel) {
+                        var shim;
+                        
+                        if (t.constructor == $.jqplot.CanvasAxisTickRenderer && t.angle) {
+                            // will need to adjust auto positioning based on which axis this is.
+                            var temp = (this.name == 'xaxis') ? 1 : -1;
+                            switch (t.labelPosition) {
+                                case 'auto':
+                                    // position at end
+                                    if (temp * t.angle < 0) {
+                                        shim = -t.getWidth() + t._textRenderer.height * Math.sin(-t._textRenderer.angle) / 2;
+                                    }
+                                    // position at start
+                                    else {
+                                        shim = -t._textRenderer.height * Math.sin(t._textRenderer.angle) / 2;
+                                    }
+                                    break;
+                                case 'end':
+                                    shim = -t.getWidth() + t._textRenderer.height * Math.sin(-t._textRenderer.angle) / 2;
+                                    break;
+                                case 'start':
+                                    shim = -t._textRenderer.height * Math.sin(t._textRenderer.angle) / 2;
+                                    break;
+                                case 'middle':
+                                    shim = -t.getWidth()/2 + t._textRenderer.height * Math.sin(-t._textRenderer.angle) / 2;
+                                    break;
+                                default:
+                                    shim = -t.getWidth()/2 + t._textRenderer.height * Math.sin(-t._textRenderer.angle) / 2;
+                                    break;
+                            }
+                        }
+                        else {
+                            shim = -t.getWidth()/2;
+                        }
+                        var val = this.u2p(t.value) + shim + 'px';
+                        t._elem.css('left', val);
+                        t.pack();
+                    }
+                }
+                
+                var labeledge=['bottom', 0];
+                if (lshow) {
+                    var w = this._label._elem.outerWidth(true);
+                    this._label._elem.css('left', offmin + pixellength/2 - w/2 + 'px');
+                    if (this.name == 'xaxis') {
+                        this._label._elem.css('bottom', '0px');
+                        labeledge = ['bottom', this._label._elem.outerHeight(true)];
+                    }
+                    else {
+                        this._label._elem.css('top', '0px');
+                        labeledge = ['top', this._label._elem.outerHeight(true)];
+                    }
+                    this._label.pack();
+                }
+                
+                // draw the group labels
+                var step = parseInt(this._ticks.length/this.groups, 10);
+                for (i=0; i<this._groupLabels.length; i++) {
+                    var mid = 0;
+                    var count = 0;
+                    for (var j=i*step; j<=(i+1)*step; j++) {
+                        if (this._ticks[j]._elem && this._ticks[j].label != " ") {
+                            var t = this._ticks[j]._elem;
+                            var p = t.position();
+                            mid += p.left + t.outerWidth(true)/2;
+                            count++;
+                        }
+                    }
+                    mid = mid/count;
+                    this._groupLabels[i].css({'left':(mid - this._groupLabels[i].outerWidth(true)/2)});
+                    this._groupLabels[i].css(labeledge[0], labeledge[1]);
+                }
+            }
+            else {
+                for (i=0; i<ticks.length; i++) {
+                    var t = ticks[i];
+                    if (t.show && t.showLabel) {                        
+                        var shim;
+                        if (t.constructor == $.jqplot.CanvasAxisTickRenderer && t.angle) {
+                            // will need to adjust auto positioning based on which axis this is.
+                            var temp = (this.name == 'yaxis') ? 1 : -1;
+                            switch (t.labelPosition) {
+                                case 'auto':
+                                    // position at end
+                                case 'end':
+                                    if (temp * t.angle < 0) {
+                                        shim = -t._textRenderer.height * Math.cos(-t._textRenderer.angle) / 2;
+                                    }
+                                    else {
+                                        shim = -t.getHeight() + t._textRenderer.height * Math.cos(t._textRenderer.angle) / 2;
+                                    }
+                                    break;
+                                case 'start':
+                                    if (t.angle > 0) {
+                                        shim = -t._textRenderer.height * Math.cos(-t._textRenderer.angle) / 2;
+                                    }
+                                    else {
+                                        shim = -t.getHeight() + t._textRenderer.height * Math.cos(t._textRenderer.angle) / 2;
+                                    }
+                                    break;
+                                case 'middle':
+                                    // if (t.angle > 0) {
+                                    //     shim = -t.getHeight()/2 + t._textRenderer.height * Math.sin(-t._textRenderer.angle) / 2;
+                                    // }
+                                    // else {
+                                    //     shim = -t.getHeight()/2 - t._textRenderer.height * Math.sin(t._textRenderer.angle) / 2;
+                                    // }
+                                    shim = -t.getHeight()/2;
+                                    break;
+                                default:
+                                    shim = -t.getHeight()/2;
+                                    break;
+                            }
+                        }
+                        else {
+                            shim = -t.getHeight()/2;
+                        }
+                        
+                        var val = this.u2p(t.value) + shim + 'px';
+                        t._elem.css('top', val);
+                        t.pack();
+                    }
+                }
+                
+                var labeledge=['left', 0];
+                if (lshow) {
+                    var h = this._label._elem.outerHeight(true);
+                    this._label._elem.css('top', offmax - pixellength/2 - h/2 + 'px');
+                    if (this.name == 'yaxis') {
+                        this._label._elem.css('left', '0px');
+                        labeledge = ['left', this._label._elem.outerWidth(true)];
+                    }
+                    else {
+                        this._label._elem.css('right', '0px');
+                        labeledge = ['right', this._label._elem.outerWidth(true)];
+                    }   
+                    this._label.pack();
+                }
+                
+                // draw the group labels, position top here, do left after label position.
+                var step = parseInt(this._ticks.length/this.groups, 10);
+                for (i=0; i<this._groupLabels.length; i++) {
+                    var mid = 0;
+                    var count = 0;
+                    for (var j=i*step; j<=(i+1)*step; j++) {
+                        if (this._ticks[j]._elem && this._ticks[j].label != " ") {
+                            var t = this._ticks[j]._elem;
+                            var p = t.position();
+                            mid += p.top + t.outerHeight()/2;
+                            count++;
+                        }
+                    }
+                    mid = mid/count;
+                    this._groupLabels[i].css({'top':mid - this._groupLabels[i].outerHeight()/2});
+                    this._groupLabels[i].css(labeledge[0], labeledge[1]);
+                    
+                }
+            }
+        }
+    };    
+    
+    
+})(jQuery);

js/plugins/jqplot.ciParser.js

@@ -0,0 +1,115 @@
+/**
+ * jqPlot
+ * Pure JavaScript plotting plugin using jQuery
+ *
+ * Version: 1.0.0b2_r792
+ *
+ * Copyright (c) 2009-2011 Chris Leonello
+ * jqPlot is currently available for use in all personal or commercial projects 
+ * under both the MIT (http://www.opensource.org/licenses/mit-license.php) and GPL 
+ * version 2.0 (http://www.gnu.org/licenses/gpl-2.0.html) licenses. This means that you can 
+ * choose the license that best suits your project and use it accordingly. 
+ *
+ * Although not required, the author would appreciate an email letting him 
+ * know of any substantial use of jqPlot.  You can reach the author at: 
+ * chris at jqplot dot com or see http://www.jqplot.com/info.php .
+ *
+ * If you are feeling kind and generous, consider supporting the project by
+ * making a donation at: http://www.jqplot.com/donate.php .
+ *
+ * sprintf functions contained in jqplot.sprintf.js by Ash Searle:
+ *
+ *     version 2007.04.27
+ *     author Ash Searle
+ *     http://hexmen.com/blog/2007/03/printf-sprintf/
+ *     http://hexmen.com/js/sprintf.js
+ *     The author (Ash Searle) has placed this code in the public domain:
+ *     "This code is unrestricted: you are free to use it however you like."
+ * 
+ */
+(function($) {
+    /**
+     * Class: $.jqplot.ciParser
+     * Data Renderer function which converts a custom JSON data object into jqPlot data format.
+     * Set this as a callable on the jqplot dataRenderer plot option:
+     * 
+     * > plot = $.jqplot('mychart', [data], { dataRenderer: $.jqplot.ciParser, ... });
+     * 
+     * Where data is an object in JSON format or a JSON encoded string conforming to the
+     * City Index API spec.
+     * 
+     * Note that calling the renderer function is handled internally by jqPlot.  The
+     * user does not have to call the function.  The parameters described below will
+     * automatically be passed to the ciParser function.
+     * 
+     * Parameters:
+     * data - JSON encoded string or object.
+     * plot - reference to jqPlot Plot object.
+     * 
+     * Returns:
+     * data array in jqPlot format.
+     * 
+     */
+    $.jqplot.ciParser = function (data, plot) {
+        var ret = [],
+            line,
+			temp,
+            i, j, k, kk;
+    
+         if (typeof(data) == "string") {
+             data =  $.jqplot.JSON.parse(data, handleStrings);
+         }
+ 
+         else if (typeof(data) == "object") {
+             for (k in data) {
+                 for (i=0; i<data[k].length; i++) {
+                     for (kk in data[k][i]) {
+                         data[k][i][kk] = handleStrings(kk, data[k][i][kk]);
+                     }
+                 }
+             }
+         }
+ 
+         else {
+             return null;
+         }
+ 
+         // function handleStrings
+         // Checks any JSON encoded strings to see if they are
+         // encoded dates.  If so, pull out the timestamp.
+         // Expects dates to be represented by js timestamps.
+ 
+         function handleStrings(key, value) {
+            var a;
+            if (value != null) {
+                if (value.toString().indexOf('Date') >= 0) {
+                    //here we will try to extract the ticks from the Date string in the "value" fields of JSON returned data
+                    a = /^\/Date\((-?[0-9]+)\)\/$/.exec(value);
+                    if (a) {
+                        return parseInt(a[1], 10);
+                    }
+                }
+                return value;
+            }
+         }
+ 
+        for (var prop in data) {
+            line = [];
+            temp = data[prop];
+            switch (prop) {
+                case "PriceTicks":
+                    for (i=0; i<temp.length; i++) {
+                        line.push([temp[i]['TickDate'], temp[i]['Price']]);
+                    }
+                    break;
+                case "PriceBars":
+                    for (i=0; i<temp.length; i++) {
+                        line.push([temp[i]['BarDate'], temp[i]['Open'], temp[i]['High'], temp[i]['Low'], temp[i]['Close']]);
+                    }
+                    break;
+            }
+            ret.push(line);
+        }
+        return ret;
+    };
+})(jQuery);