set version to 0.9.30-rc1

Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
add note for apache2 + php-fpm users that they need to change the fastcgi.conf when updating to 0.9.30; minor improvements of Sparkle-Theme (update templates)
2013-10-14 16:12:34 +02:00 · 2013-10-14 15:47:08 +02:00 · 2013-10-14 10:08:15 +02:00 · 2013-10-14 09:50:55 +02:00 · 2013-10-14 09:49:47 +02:00 · 2013-10-13 16:43:46 +02:00
2221 changed files with 124465 additions and 24344 deletions
--- a/.gitignore
+++ b/.gitignore
@@ -0,0 +1,10 @@
+packages/*
+lib/classes/htmlpurifier/library/HTMLPurifier/DefinitionCache/Serializer/*/
+temp/*
+templates/*
+install/update.log
+.buildpath
+.project
+.settings/
+*.diff
+*~
--- a/561
+++ b/561
@@ -1,281 +1,280 @@
-		    GNU GENERAL PUBLIC LICENSE
-		       Version 2, June 1991
-
- Copyright (C) 1989, 1991 Free Software Foundation, Inc.
-                          675 Mass Ave, Cambridge, MA 02139, USA
- Everyone is permitted to copy and distribute verbatim copies
- of this license document, but changing it is not allowed.
-
-			    Preamble
-
-  The licenses for most software are designed to take away your
-freedom to share and change it.  By contrast, the GNU General Public
-License is intended to guarantee your freedom to share and change free
-software--to make sure the software is free for all its users.  This
-General Public License applies to most of the Free Software
-Foundation's software and to any other program whose authors commit to
-using it.  (Some other Free Software Foundation software is covered by
-the GNU Library General Public License instead.)  You can apply it to
-your programs, too.
-
-  When we speak of free software, we are referring to freedom, not
-price.  Our General Public Licenses are designed to make sure that you
-have the freedom to distribute copies of free software (and charge for
-this service if you wish), that you receive source code or can get it
-if you want it, that you can change the software or use pieces of it
-in new free programs; and that you know you can do these things.
-
-  To protect your rights, we need to make restrictions that forbid
-anyone to deny you these rights or to ask you to surrender the rights.
-These restrictions translate to certain responsibilities for you if you
-distribute copies of the software, or if you modify it.
-
-  For example, if you distribute copies of such a program, whether
-gratis or for a fee, you must give the recipients all the rights that
-you have.  You must make sure that they, too, receive or can get the
-source code.  And you must show them these terms so they know their
-rights.
-
-  We protect your rights with two steps: (1) copyright the software, and
-(2) offer you this license which gives you legal permission to copy,
-distribute and/or modify the software.
-
-  Also, for each author's protection and ours, we want to make certain
-that everyone understands that there is no warranty for this free
-software.  If the software is modified by someone else and passed on, we
-want its recipients to know that what they have is not the original, so
-that any problems introduced by others will not reflect on the original
-authors' reputations.
-
-  Finally, any free program is threatened constantly by software
-patents.  We wish to avoid the danger that redistributors of a free
-program will individually obtain patent licenses, in effect making the
-program proprietary.  To prevent this, we have made it clear that any
-patent must be licensed for everyone's free use or not licensed at all.
-
-  The precise terms and conditions for copying, distribution and
-modification follow.
-
-		    GNU GENERAL PUBLIC LICENSE
-   TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
-
-  0. This License applies to any program or other work which contains
-a notice placed by the copyright holder saying it may be distributed
-under the terms of this General Public License.  The "Program", below,
-refers to any such program or work, and a "work based on the Program"
-means either the Program or any derivative work under copyright law:
-that is to say, a work containing the Program or a portion of it,
-either verbatim or with modifications and/or translated into another
-language.  (Hereinafter, translation is included without limitation in
-the term "modification".)  Each licensee is addressed as "you".
-
-Activities other than copying, distribution and modification are not
-covered by this License; they are outside its scope.  The act of
-running the Program is not restricted, and the output from the Program
-is covered only if its contents constitute a work based on the
-Program (independent of having been made by running the Program).
-Whether that is true depends on what the Program does.
-
-  1. You may copy and distribute verbatim copies of the Program's
-source code as you receive it, in any medium, provided that you
-conspicuously and appropriately publish on each copy an appropriate
-copyright notice and disclaimer of warranty; keep intact all the
-notices that refer to this License and to the absence of any warranty;
-and give any other recipients of the Program a copy of this License
-along with the Program.
-
-You may charge a fee for the physical act of transferring a copy, and
-you may at your option offer warranty protection in exchange for a fee.
-
-  2. You may modify your copy or copies of the Program or any portion
-of it, thus forming a work based on the Program, and copy and
-distribute such modifications or work under the terms of Section 1
-above, provided that you also meet all of these conditions:
-
-    a) You must cause the modified files to carry prominent notices
-    stating that you changed the files and the date of any change.
-
-    b) You must cause any work that you distribute or publish, that in
-    whole or in part contains or is derived from the Program or any
-    part thereof, to be licensed as a whole at no charge to all third
-    parties under the terms of this License.
-
-    c) If the modified program normally reads commands interactively
-    when run, you must cause it, when started running for such
-    interactive use in the most ordinary way, to print or display an
-    announcement including an appropriate copyright notice and a
-    notice that there is no warranty (or else, saying that you provide
-    a warranty) and that users may redistribute the program under
-    these conditions, and telling the user how to view a copy of this
-    License.  (Exception: if the Program itself is interactive but
-    does not normally print such an announcement, your work based on
-    the Program is not required to print an announcement.)
-
-These requirements apply to the modified work as a whole.  If
-identifiable sections of that work are not derived from the Program,
-and can be reasonably considered independent and separate works in
-themselves, then this License, and its terms, do not apply to those
-sections when you distribute them as separate works.  But when you
-distribute the same sections as part of a whole which is a work based
-on the Program, the distribution of the whole must be on the terms of
-this License, whose permissions for other licensees extend to the
-entire whole, and thus to each and every part regardless of who wrote it.
-
-Thus, it is not the intent of this section to claim rights or contest
-your rights to work written entirely by you; rather, the intent is to
-exercise the right to control the distribution of derivative or
-collective works based on the Program.
-
-In addition, mere aggregation of another work not based on the Program
-with the Program (or with a work based on the Program) on a volume of
-a storage or distribution medium does not bring the other work under
-the scope of this License.
-
-  3. You may copy and distribute the Program (or a work based on it,
-under Section 2) in object code or executable form under the terms of
-Sections 1 and 2 above provided that you also do one of the following:
-
-    a) Accompany it with the complete corresponding machine-readable
-    source code, which must be distributed under the terms of Sections
-    1 and 2 above on a medium customarily used for software interchange; or,
-
-    b) Accompany it with a written offer, valid for at least three
-    years, to give any third party, for a charge no more than your
-    cost of physically performing source distribution, a complete
-    machine-readable copy of the corresponding source code, to be
-    distributed under the terms of Sections 1 and 2 above on a medium
-    customarily used for software interchange; or,
-
-    c) Accompany it with the information you received as to the offer
-    to distribute corresponding source code.  (This alternative is
-    allowed only for noncommercial distribution and only if you
-    received the program in object code or executable form with such
-    an offer, in accord with Subsection b above.)
-
-The source code for a work means the preferred form of the work for
-making modifications to it.  For an executable work, complete source
-code means all the source code for all modules it contains, plus any
-associated interface definition files, plus the scripts used to
-control compilation and installation of the executable.  However, as a
-special exception, the source code distributed need not include
-anything that is normally distributed (in either source or binary
-form) with the major components (compiler, kernel, and so on) of the
-operating system on which the executable runs, unless that component
-itself accompanies the executable.
-
-If distribution of executable or object code is made by offering
-access to copy from a designated place, then offering equivalent
-access to copy the source code from the same place counts as
-distribution of the source code, even though third parties are not
-compelled to copy the source along with the object code.
-
-  4. You may not copy, modify, sublicense, or distribute the Program
-except as expressly provided under this License.  Any attempt
-otherwise to copy, modify, sublicense or distribute the Program is
-void, and will automatically terminate your rights under this License.
-However, parties who have received copies, or rights, from you under
-this License will not have their licenses terminated so long as such
-parties remain in full compliance.
-
-  5. You are not required to accept this License, since you have not
-signed it.  However, nothing else grants you permission to modify or
-distribute the Program or its derivative works.  These actions are
-prohibited by law if you do not accept this License.  Therefore, by
-modifying or distributing the Program (or any work based on the
-Program), you indicate your acceptance of this License to do so, and
-all its terms and conditions for copying, distributing or modifying
-the Program or works based on it.
-
-  6. Each time you redistribute the Program (or any work based on the
-Program), the recipient automatically receives a license from the
-original licensor to copy, distribute or modify the Program subject to
-these terms and conditions.  You may not impose any further
-restrictions on the recipients' exercise of the rights granted herein.
-You are not responsible for enforcing compliance by third parties to
-this License.
-
-  7. If, as a consequence of a court judgment or allegation of patent
-infringement or for any other reason (not limited to patent issues),
-conditions are imposed on you (whether by court order, agreement or
-otherwise) that contradict the conditions of this License, they do not
-excuse you from the conditions of this License.  If you cannot
-distribute so as to satisfy simultaneously your obligations under this
-License and any other pertinent obligations, then as a consequence you
-may not distribute the Program at all.  For example, if a patent
-license would not permit royalty-free redistribution of the Program by
-all those who receive copies directly or indirectly through you, then
-the only way you could satisfy both it and this License would be to
-refrain entirely from distribution of the Program.
-
-If any portion of this section is held invalid or unenforceable under
-any particular circumstance, the balance of the section is intended to
-apply and the section as a whole is intended to apply in other
-circumstances.
-
-It is not the purpose of this section to induce you to infringe any
-patents or other property right claims or to contest validity of any
-such claims; this section has the sole purpose of protecting the
-integrity of the free software distribution system, which is
-implemented by public license practices.  Many people have made
-generous contributions to the wide range of software distributed
-through that system in reliance on consistent application of that
-system; it is up to the author/donor to decide if he or she is willing
-to distribute software through any other system and a licensee cannot
-impose that choice.
-
-This section is intended to make thoroughly clear what is believed to
-be a consequence of the rest of this License.
-
-  8. If the distribution and/or use of the Program is restricted in
-certain countries either by patents or by copyrighted interfaces, the
-original copyright holder who places the Program under this License
-may add an explicit geographical distribution limitation excluding
-those countries, so that distribution is permitted only in or among
-countries not thus excluded.  In such case, this License incorporates
-the limitation as if written in the body of this License.
-
-  9. The Free Software Foundation may publish revised and/or new versions
-of the General Public License from time to time.  Such new versions will
-be similar in spirit to the present version, but may differ in detail to
-address new problems or concerns.
-
-Each version is given a distinguishing version number.  If the Program
-specifies a version number of this License which applies to it and "any
-later version", you have the option of following the terms and conditions
-either of that version or of any later version published by the Free
-Software Foundation.  If the Program does not specify a version number of
-this License, you may choose any version ever published by the Free Software
-Foundation.
-
-  10. If you wish to incorporate parts of the Program into other free
-programs whose distribution conditions are different, write to the author
-to ask for permission.  For software which is copyrighted by the Free
-Software Foundation, write to the Free Software Foundation; we sometimes
-make exceptions for this.  Our decision will be guided by the two goals
-of preserving the free status of all derivatives of our free software and
-of promoting the sharing and reuse of software generally.
-
-			    NO WARRANTY
-
-  11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY
-FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW.  EXCEPT WHEN
-OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES
-PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED
-OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
-MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE.  THE ENTIRE RISK AS
-TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU.  SHOULD THE
-PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING,
-REPAIR OR CORRECTION.
-
-  12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
-WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR
-REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES,
-INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING
-OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED
-TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY
-YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER
-PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
-POSSIBILITY OF SUCH DAMAGES.
-
-		     END OF TERMS AND CONDITIONS
-
+		    GNU GENERAL PUBLIC LICENSE
+		       Version 2, June 1991
+
+ Copyright (C) 1989, 1991 Free Software Foundation, Inc.
+                       51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+
+			    Preamble
+
+  The licenses for most software are designed to take away your
+freedom to share and change it.  By contrast, the GNU General Public
+License is intended to guarantee your freedom to share and change free
+software--to make sure the software is free for all its users.  This
+General Public License applies to most of the Free Software
+Foundation's software and to any other program whose authors commit to
+using it.  (Some other Free Software Foundation software is covered by
+the GNU Library General Public License instead.)  You can apply it to
+your programs, too.
+
+  When we speak of free software, we are referring to freedom, not
+price.  Our General Public Licenses are designed to make sure that you
+have the freedom to distribute copies of free software (and charge for
+this service if you wish), that you receive source code or can get it
+if you want it, that you can change the software or use pieces of it
+in new free programs; and that you know you can do these things.
+
+  To protect your rights, we need to make restrictions that forbid
+anyone to deny you these rights or to ask you to surrender the rights.
+These restrictions translate to certain responsibilities for you if you
+distribute copies of the software, or if you modify it.
+
+  For example, if you distribute copies of such a program, whether
+gratis or for a fee, you must give the recipients all the rights that
+you have.  You must make sure that they, too, receive or can get the
+source code.  And you must show them these terms so they know their
+rights.
+
+  We protect your rights with two steps: (1) copyright the software, and
+(2) offer you this license which gives you legal permission to copy,
+distribute and/or modify the software.
+
+  Also, for each author's protection and ours, we want to make certain
+that everyone understands that there is no warranty for this free
+software.  If the software is modified by someone else and passed on, we
+want its recipients to know that what they have is not the original, so
+that any problems introduced by others will not reflect on the original
+authors' reputations.
+
+  Finally, any free program is threatened constantly by software
+patents.  We wish to avoid the danger that redistributors of a free
+program will individually obtain patent licenses, in effect making the
+program proprietary.  To prevent this, we have made it clear that any
+patent must be licensed for everyone's free use or not licensed at all.
+
+  The precise terms and conditions for copying, distribution and
+modification follow.
+
+		    GNU GENERAL PUBLIC LICENSE
+   TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
+
+  0. This License applies to any program or other work which contains
+a notice placed by the copyright holder saying it may be distributed
+under the terms of this General Public License.  The "Program", below,
+refers to any such program or work, and a "work based on the Program"
+means either the Program or any derivative work under copyright law:
+that is to say, a work containing the Program or a portion of it,
+either verbatim or with modifications and/or translated into another
+language.  (Hereinafter, translation is included without limitation in
+the term "modification".)  Each licensee is addressed as "you".
+
+Activities other than copying, distribution and modification are not
+covered by this License; they are outside its scope.  The act of
+running the Program is not restricted, and the output from the Program
+is covered only if its contents constitute a work based on the
+Program (independent of having been made by running the Program).
+Whether that is true depends on what the Program does.
+
+  1. You may copy and distribute verbatim copies of the Program's
+source code as you receive it, in any medium, provided that you
+conspicuously and appropriately publish on each copy an appropriate
+copyright notice and disclaimer of warranty; keep intact all the
+notices that refer to this License and to the absence of any warranty;
+and give any other recipients of the Program a copy of this License
+along with the Program.
+
+You may charge a fee for the physical act of transferring a copy, and
+you may at your option offer warranty protection in exchange for a fee.
+
+  2. You may modify your copy or copies of the Program or any portion
+of it, thus forming a work based on the Program, and copy and
+distribute such modifications or work under the terms of Section 1
+above, provided that you also meet all of these conditions:
+
+    a) You must cause the modified files to carry prominent notices
+    stating that you changed the files and the date of any change.
+
+    b) You must cause any work that you distribute or publish, that in
+    whole or in part contains or is derived from the Program or any
+    part thereof, to be licensed as a whole at no charge to all third
+    parties under the terms of this License.
+
+    c) If the modified program normally reads commands interactively
+    when run, you must cause it, when started running for such
+    interactive use in the most ordinary way, to print or display an
+    announcement including an appropriate copyright notice and a
+    notice that there is no warranty (or else, saying that you provide
+    a warranty) and that users may redistribute the program under
+    these conditions, and telling the user how to view a copy of this
+    License.  (Exception: if the Program itself is interactive but
+    does not normally print such an announcement, your work based on
+    the Program is not required to print an announcement.)
+
+These requirements apply to the modified work as a whole.  If
+identifiable sections of that work are not derived from the Program,
+and can be reasonably considered independent and separate works in
+themselves, then this License, and its terms, do not apply to those
+sections when you distribute them as separate works.  But when you
+distribute the same sections as part of a whole which is a work based
+on the Program, the distribution of the whole must be on the terms of
+this License, whose permissions for other licensees extend to the
+entire whole, and thus to each and every part regardless of who wrote it.
+
+Thus, it is not the intent of this section to claim rights or contest
+your rights to work written entirely by you; rather, the intent is to
+exercise the right to control the distribution of derivative or
+collective works based on the Program.
+
+In addition, mere aggregation of another work not based on the Program
+with the Program (or with a work based on the Program) on a volume of
+a storage or distribution medium does not bring the other work under
+the scope of this License.
+
+  3. You may copy and distribute the Program (or a work based on it,
+under Section 2) in object code or executable form under the terms of
+Sections 1 and 2 above provided that you also do one of the following:
+
+    a) Accompany it with the complete corresponding machine-readable
+    source code, which must be distributed under the terms of Sections
+    1 and 2 above on a medium customarily used for software interchange; or,
+
+    b) Accompany it with a written offer, valid for at least three
+    years, to give any third party, for a charge no more than your
+    cost of physically performing source distribution, a complete
+    machine-readable copy of the corresponding source code, to be
+    distributed under the terms of Sections 1 and 2 above on a medium
+    customarily used for software interchange; or,
+
+    c) Accompany it with the information you received as to the offer
+    to distribute corresponding source code.  (This alternative is
+    allowed only for noncommercial distribution and only if you
+    received the program in object code or executable form with such
+    an offer, in accord with Subsection b above.)
+
+The source code for a work means the preferred form of the work for
+making modifications to it.  For an executable work, complete source
+code means all the source code for all modules it contains, plus any
+associated interface definition files, plus the scripts used to
+control compilation and installation of the executable.  However, as a
+special exception, the source code distributed need not include
+anything that is normally distributed (in either source or binary
+form) with the major components (compiler, kernel, and so on) of the
+operating system on which the executable runs, unless that component
+itself accompanies the executable.
+
+If distribution of executable or object code is made by offering
+access to copy from a designated place, then offering equivalent
+access to copy the source code from the same place counts as
+distribution of the source code, even though third parties are not
+compelled to copy the source along with the object code.
+
+  4. You may not copy, modify, sublicense, or distribute the Program
+except as expressly provided under this License.  Any attempt
+otherwise to copy, modify, sublicense or distribute the Program is
+void, and will automatically terminate your rights under this License.
+However, parties who have received copies, or rights, from you under
+this License will not have their licenses terminated so long as such
+parties remain in full compliance.
+
+  5. You are not required to accept this License, since you have not
+signed it.  However, nothing else grants you permission to modify or
+distribute the Program or its derivative works.  These actions are
+prohibited by law if you do not accept this License.  Therefore, by
+modifying or distributing the Program (or any work based on the
+Program), you indicate your acceptance of this License to do so, and
+all its terms and conditions for copying, distributing or modifying
+the Program or works based on it.
+
+  6. Each time you redistribute the Program (or any work based on the
+Program), the recipient automatically receives a license from the
+original licensor to copy, distribute or modify the Program subject to
+these terms and conditions.  You may not impose any further
+restrictions on the recipients' exercise of the rights granted herein.
+You are not responsible for enforcing compliance by third parties to
+this License.
+
+  7. If, as a consequence of a court judgment or allegation of patent
+infringement or for any other reason (not limited to patent issues),
+conditions are imposed on you (whether by court order, agreement or
+otherwise) that contradict the conditions of this License, they do not
+excuse you from the conditions of this License.  If you cannot
+distribute so as to satisfy simultaneously your obligations under this
+License and any other pertinent obligations, then as a consequence you
+may not distribute the Program at all.  For example, if a patent
+license would not permit royalty-free redistribution of the Program by
+all those who receive copies directly or indirectly through you, then
+the only way you could satisfy both it and this License would be to
+refrain entirely from distribution of the Program.
+
+If any portion of this section is held invalid or unenforceable under
+any particular circumstance, the balance of the section is intended to
+apply and the section as a whole is intended to apply in other
+circumstances.
+
+It is not the purpose of this section to induce you to infringe any
+patents or other property right claims or to contest validity of any
+such claims; this section has the sole purpose of protecting the
+integrity of the free software distribution system, which is
+implemented by public license practices.  Many people have made
+generous contributions to the wide range of software distributed
+through that system in reliance on consistent application of that
+system; it is up to the author/donor to decide if he or she is willing
+to distribute software through any other system and a licensee cannot
+impose that choice.
+
+This section is intended to make thoroughly clear what is believed to
+be a consequence of the rest of this License.
+
+  8. If the distribution and/or use of the Program is restricted in
+certain countries either by patents or by copyrighted interfaces, the
+original copyright holder who places the Program under this License
+may add an explicit geographical distribution limitation excluding
+those countries, so that distribution is permitted only in or among
+countries not thus excluded.  In such case, this License incorporates
+the limitation as if written in the body of this License.
+
+  9. The Free Software Foundation may publish revised and/or new versions
+of the General Public License from time to time.  Such new versions will
+be similar in spirit to the present version, but may differ in detail to
+address new problems or concerns.
+
+Each version is given a distinguishing version number.  If the Program
+specifies a version number of this License which applies to it and "any
+later version", you have the option of following the terms and conditions
+either of that version or of any later version published by the Free
+Software Foundation.  If the Program does not specify a version number of
+this License, you may choose any version ever published by the Free Software
+Foundation.
+
+  10. If you wish to incorporate parts of the Program into other free
+programs whose distribution conditions are different, write to the author
+to ask for permission.  For software which is copyrighted by the Free
+Software Foundation, write to the Free Software Foundation; we sometimes
+make exceptions for this.  Our decision will be guided by the two goals
+of preserving the free status of all derivatives of our free software and
+of promoting the sharing and reuse of software generally.
+
+			    NO WARRANTY
+
+  11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY
+FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW.  EXCEPT WHEN
+OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES
+PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED
+OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
+MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE.  THE ENTIRE RISK AS
+TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU.  SHOULD THE
+PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING,
+REPAIR OR CORRECTION.
+
+  12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
+WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR
+REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES,
+INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING
+OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED
+TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY
+YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER
+PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
+POSSIBILITY OF SUCH DAMAGES.
+
+		     END OF TERMS AND CONDITIONS
--- a/actions/admin/settings/000.version.php
+++ b/actions/admin/settings/000.version.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
--- a/actions/admin/settings/100.panel.php
+++ b/actions/admin/settings/100.panel.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Language
- * @version    $Id$
+ *
 */

 return array(
@@ -32,6 +32,32 @@ return array(
 					'option_options_method' => 'getLanguages',
 					'save_method' => 'storeSettingField',
 					),
+				'panel_default_theme' => array(
+					'label' => array('title' => $lng['panel']['theme'], 'description' => $lng['serversettings']['default_theme']),
+					'settinggroup' => 'panel',
+					'varname' => 'default_theme',
+					'type' => 'option',
+					'default' => 'Froxlor',
+					'option_mode' => 'one',
+					'option_options_method' => 'getThemes',
+					'save_method' => 'storeSettingDefaultTheme',
+					),
+				'panel_allow_theme_change_customer' => array(
+					'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
+					'settinggroup' => 'panel',
+					'varname' => 'allow_theme_change_customer',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					),
+				'panel_allow_theme_change_admin' => array(
+					'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
+					'settinggroup' => 'panel',
+					'varname' => 'allow_theme_change_admin',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField'
+					),
 				'panel_natsorting' => array(
 					'label' => $lng['serversettings']['natsorting'],
 					'settinggroup' => 'panel',
@@ -64,7 +90,24 @@ return array(
 					'type' => 'option',
 					'default' => 'Manual',
 					'option_mode' => 'one',
-					'option_options' => array('Manual' => 'Manual', 'Dropdown' => 'Dropdown'),
+					'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']),
+					'save_method' => 'storeSettingField',
+					),
+				'use_webfonts' => array(
+					'label' => $lng['serversettings']['enablewebfonts'],
+					'settinggroup' => 'panel',
+					'varname' => 'use_webfonts',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					),
+				'webfont' => array(
+					'label' => $lng['serversettings']['definewebfont']['title'],
+					'settinggroup' => 'panel',
+					'varname' => 'webfont',
+					'type' => 'string',
+					'default' => 'Numans',
+					'string_emptyallowed' => false,
 					'save_method' => 'storeSettingField',
 					),
 				'panel_adminmail' => array(
@@ -77,6 +120,24 @@ return array(
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					),
+				'panel_adminmail_defname' => array(
+					'label' => $lng['serversettings']['adminmail_defname'],
+					'settinggroup' => 'panel',
+					'varname' => 'adminmail_defname',
+					'type' => 'string',
+					'default' => 'Froxlor Administrator',
+					'save_method' => 'storeSettingField',
+					),
+				'panel_adminmail_return' => array(
+					'label' => $lng['serversettings']['adminmail_return'],
+					'settinggroup' => 'panel',
+					'varname' => 'adminmail_return',
+					'type' => 'string',
+					'string_type' => 'mail',
+					'string_emptyallowed' => true,
+					'default' => '',
+					'save_method' => 'storeSettingField',
+					),
 				'panel_decimal_places' => array(
 					'label' => $lng['serversettings']['decimal_places'],
 					'settinggroup' => 'panel',
@@ -133,14 +194,6 @@ return array(
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
-				'admin_froxlor_graphic' => array(
-					'label' => $lng['admin']['froxlor_graphic'],
-					'settinggroup' => 'admin',
-					'varname' => 'froxlor_graphic',
-					'type' => 'string',
-					'default' => '',
-					'save_method' => 'storeSettingField',
-					),
 				'panel_allow_domain_change_admin' => array(
 					'label' => $lng['serversettings']['panel_allow_domain_change_admin'],
 					'settinggroup' => 'panel',
@@ -157,6 +210,14 @@ return array(
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
+				'panel_phpconfigs_hidestdsubdomain' => array(
+					'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
+					'settinggroup' => 'panel',
+					'varname' => 'phpconfigs_hidestdsubdomain',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					),
 				),
 			),
 		),
--- a/actions/admin/settings/110.accounts.php
+++ b/actions/admin/settings/110.accounts.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -38,6 +38,14 @@ return array(
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
+				'login_domain_login' => array(
+					'label' => $lng['serversettings']['login_domain_login'],
+					'settinggroup' => 'login',
+					'varname' => 'domain_login',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					),
 				'login_maxloginattempts' => array(
 					'label' => $lng['serversettings']['maxloginattempts'],
 					'settinggroup' => 'login',
@@ -54,6 +62,23 @@ return array(
 					'default' => 900,
 					'save_method' => 'storeSettingField',
 					),
+				'panel_password_min_length' => array(
+					'label' => $lng['serversettings']['panel_password_min_length'],
+					'settinggroup' => 'panel',
+					'varname' => 'password_min_length',
+					'type' => 'int',
+					'default' => 0,
+					'save_method' => 'storeSettingField',
+					),
+				'panel_password_regex' => array(
+					'label' => $lng['serversettings']['panel_password_regex'],
+					'settinggroup' => 'panel',
+					'varname' => 'password_regex',
+					'type' => 'string',
+					'default' => '',
+					/* 'plausibility_check_method' => 'checkValidRegEx', */
+					'save_method' => 'storeSettingField',
+					),
 				'customer_accountprefix' => array(
 					'label' => $lng['serversettings']['accountprefix'],
 					'settinggroup' => 'customer',
--- a/actions/admin/settings/120.system.php
+++ b/actions/admin/settings/120.system.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -27,8 +27,18 @@ return array(
 					'settinggroup' => 'system',
 					'varname' => 'documentroot_prefix',
 					'type' => 'string',
+					'string_type' => 'dir',
 					'default' => '/var/customers/webs/',
 					'save_method' => 'storeSettingField',
+					'plausibility_check_method' => 'checkPathConflicts'
+					),
+				'system_documentroot_use_default_value' => array(
+					'label' => $lng['serversettings']['documentroot_use_default_value'],
+					'settinggroup' => 'system',
+					'varname' => 'documentroot_use_default_value',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
 					),
 				'system_ipaddress' => array(
 					'label' => $lng['serversettings']['ipaddress'],
@@ -57,6 +67,31 @@ return array(
 					'type' => 'string',
 					'default' => '',
 					'save_method' => 'storeSettingHostname',
+					'plausibility_check_method' => 'checkHostname',
+					),
+				'system_froxlordirectlyviahostname' => array(
+					'label' => $lng['serversettings']['froxlordirectlyviahostname'],
+					'settinggroup' => 'system',
+					'varname' => 'froxlordirectlyviahostname',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					),
+				'system_validatedomain' => array(
+					'label' => $lng['serversettings']['validate_domain'],
+					'settinggroup' => 'system',
+					'varname' => 'validate_domain',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					),
+				'system_stdsubdomain' => array(
+					'label' => $lng['serversettings']['stdsubdomainhost'],
+					'settinggroup' => 'system',
+					'varname' => 'stdsubdomain',
+					'type' => 'string',
+					'default' => '',
+					'save_method' => 'storeSettingHostname',
 					),
 				'system_mysql_access_host' => array(
 					'label' => $lng['serversettings']['mysql_access_host'],
@@ -67,15 +102,6 @@ return array(
 					'plausibility_check_method' => 'checkMysqlAccessHost',
 					'save_method' => 'storeSettingMysqlAccessHost',
 					),
-				'system_realtime_port' => array(
-					'label' => $lng['serversettings']['system_realtime_port'],
-					'settinggroup' => 'system',
-					'varname' => 'realtime_port',
-					'type' => (function_exists('socket_create') ? 'int' : 'hidden'),
-					'int_max' => 65535,
-					'default' => 0,
-					'save_method' => 'storeSettingField',
-					),
 				'system_index_file_extension' => array(
 					'label' => $lng['serversettings']['index_file_extension'],
 					'settinggroup' => 'system',
@@ -85,6 +111,14 @@ return array(
 					'default' => 'html',
 					'save_method' => 'storeSettingField',
 					),
+				'system_store_index_file_subs' => array(
+					'label' => $lng['serversettings']['system_store_index_file_subs'],
+					'settinggroup' => 'system',
+					'varname' => 'store_index_file_subs',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					),
 				'system_httpuser' => array(
 					'settinggroup' => 'system',
 					'varname' => 'httpuser',
@@ -97,6 +131,35 @@ return array(
 					'type' => 'hidden',
 					'default' => 'www-data',
 					),
+				'system_report_enable' => array(
+					'label' => $lng['serversettings']['report']['report'],
+					'settinggroup' => 'system',
+					'varname' => 'report_enable',
+					'type' => 'bool',
+					'default' => true,
+					'cronmodule' => 'froxlor/reports',
+					'save_method' => 'storeSettingField',
+					),
+				'system_report_webmax' => array(
+					'label' => $lng['serversettings']['report']['webmax'],
+					'settinggroup' => 'system',
+					'varname' => 'report_webmax',
+					'type' => 'int',
+					'int_min' => 1,
+					'int_max' => 150,
+					'default' => 90,
+					'save_method' => 'storeSettingField',
+					),
+				'system_report_trafficmax' => array(
+					'label' => $lng['serversettings']['report']['trafficmax'],
+					'settinggroup' => 'system',
+					'varname' => 'report_trafficmax',
+					'type' => 'int',
+					'int_min' => 1,
+					'int_max' => 150,
+					'default' => 90,
+					'save_method' => 'storeSettingField',
+					),
 				'system_debug_cron' => array(
 					'label' => $lng['serversettings']['cron']['debug'],
 					'settinggroup' => 'system',
@@ -104,10 +167,10 @@ return array(
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
-					),					
+					),
 				),
 			),
 		),
 	);

-?>
+?>
--- a/actions/admin/settings/130.webserver.php
+++ b/actions/admin/settings/130.webserver.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -27,9 +27,35 @@ return array(
 					'settinggroup' => 'system',
 					'varname' => 'webserver',
 					'type' => 'option',
-					'default' => 'Apache2',
+					'default' => 'apache2',
 					'option_mode' => 'one',
-					'option_options' => array('apache2' => 'Apache 2', 'lighttpd' => 'ligHTTPd'),
+					'option_options' => array('apache2' => 'Apache 2', 'lighttpd' => 'ligHTTPd', 'nginx' => 'Nginx'),
+					'save_method' => 'storeSettingField',
+					'overview_option' => true
+					),
+				'system_apache_24' => array(
+					'label' => $lng['serversettings']['apache_24'],
+					'settinggroup' => 'system',
+					'varname' => 'apache24',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'system_httpuser' => array(
+					'label' => $lng['admin']['webserver_user'],
+					'settinggroup' => 'system',
+					'varname' => 'httpuser',
+					'type' => 'string',
+					'default' => 'www-data',
+					'save_method' => 'storeSettingField',
+					),
+				'system_httpgroup' => array(
+					'label' => $lng['admin']['webserver_group'],
+					'settinggroup' => 'system',
+					'varname' => 'httpgroup',
+					'type' => 'string',
+					'default' => 'www-data',
 					'save_method' => 'storeSettingField',
 					),
 				'system_apacheconf_vhost' => array(
@@ -59,22 +85,6 @@ return array(
 					'default' => '/etc/apache2/htpasswd/',
 					'save_method' => 'storeSettingField',
 					),
-				'system_apachereload_command' => array(
-					'label' => $lng['serversettings']['apachereload_command'],
-					'settinggroup' => 'system',
-					'varname' => 'apachereload_command',
-					'type' => 'string',
-					'default' => '/etc/init.d/apache2 reload',
-					'save_method' => 'storeSettingField',
-					),
-				'system_mod_log_sql' => array(
-					'label' => $lng['serversettings']['mod_log_sql'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_log_sql',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					),
 				'system_logfiles_directory' => array(
 					'label' => $lng['serversettings']['logfiles_directory'],
 					'settinggroup' => 'system',
@@ -84,6 +94,15 @@ return array(
 					'default' => '/var/customers/logs/',
 					'save_method' => 'storeSettingField',
 					),
+				'system_customersslpath' => array(
+					'label' => $lng['serversettings']['customerssl_directory'],
+					'settinggroup' => 'system',
+					'varname' => 'customer_ssl_path',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/etc/apache2/ssl/',
+					'save_method' => 'storeSettingField',
+					),
 				'system_phpappendopenbasedir' => array(
 					'label' => $lng['serversettings']['phpappendopenbasedir'],
 					'settinggroup' => 'system',
@@ -111,60 +130,106 @@ return array(
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					),
-				),
-			),
-		'ssl' => array(
-			'title' => $lng['admin']['sslsettings'],
-			'fields' => array(
-				'system_ssl_enabled' => array(
-					'label' => $lng['serversettings']['ssl']['use_ssl'],
+				'system_apachereload_command' => array(
+					'label' => $lng['serversettings']['apachereload_command'],
 					'settinggroup' => 'system',
-					'varname' => 'use_ssl',
+					'varname' => 'apachereload_command',
+					'type' => 'string',
+					'default' => '/etc/init.d/apache2 reload',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpreload_command' => array(
+					'label' => $lng['serversettings']['phpreload_command'],
+					'settinggroup' => 'system',
+					'varname' => 'phpreload_command',
+					'type' => 'string',
+					'default' => '',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('nginx')
+					),
+				'system_nginx_php_backend' => array(
+					'label' => $lng['serversettings']['nginx_php_backend'],
+					'settinggroup' => 'system',
+					'varname' => 'nginx_php_backend',
+					'type' => 'string',
+					'default' => '127.0.0.1:8888',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('nginx')
+					),
+				'nginx_fastcgiparams' => array(
+					'label' => $lng['serversettings']['nginx_fastcgiparams'],
+					'settinggroup' => 'nginx',
+					'varname' => 'fastcgiparams',
+					'type' => 'string',
+					'string_type' => 'file',
+					'default' => '/etc/nginx/fastcgi_params',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('nginx')
+					),
+				'defaultwebsrverrhandler_enabled' => array(
+					'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
+					'settinggroup' => 'defaultwebsrverrhandler',
+					'varname' => 'enabled',
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
-				'system_ssl_cert_file' => array(
-					'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
-					'settinggroup' => 'system',
-					'varname' => 'ssl_cert_file',
+				'defaultwebsrverrhandler_err401' => array(
+					'label' => $lng['serversettings']['defaultwebsrverrhandler_err401'],
+					'settinggroup' => 'defaultwebsrverrhandler',
+					'varname' => 'err401',
 					'type' => 'string',
-					'string_type' => 'file',
-					'string_emptyallowed' => true,
-					'default' => '/etc/apache2/apache2.pem',
+					'default' => '',
 					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2', 'nginx')
 					),
-				'system_ssl_key_file' => array(
-					'label' => $lng['serversettings']['ssl']['ssl_key_file'],
-					'settinggroup' => 'system',
-					'varname' => 'ssl_key_file',
+				'defaultwebsrverrhandler_err403' => array(
+					'label' => $lng['serversettings']['defaultwebsrverrhandler_err403'],
+					'settinggroup' => 'defaultwebsrverrhandler',
+					'varname' => 'err403',
 					'type' => 'string',
-					'string_type' => 'file',
-					'string_emptyallowed' => true,
-					'default' => '/etc/apache2/apache2.key',
+					'default' => '',
 					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2', 'nginx')
 					),
-				'system_ssl_ca_file' => array(
-					'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
-					'settinggroup' => 'system',
-					'varname' => 'ssl_ca_file',
+				'defaultwebsrverrhandler_err404' => array(
+					'label' => $lng['serversettings']['defaultwebsrverrhandler_err404'],
+					'settinggroup' => 'defaultwebsrverrhandler',
+					'varname' => 'err404',
 					'type' => 'string',
-					'string_type' => 'file',
-					'string_emptyallowed' => true,
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					),
-				'system_ssl_openssl_cnf' => array(
-					'label' => $lng['serversettings']['ssl']['openssl_cnf'],
-					'settinggroup' => 'system',
-					'varname' => 'openssl_cnf',
-					'type' => 'text',
+				'defaultwebsrverrhandler_err500' => array(
+					'label' => $lng['serversettings']['defaultwebsrverrhandler_err500'],
+					'settinggroup' => 'defaultwebsrverrhandler',
+					'varname' => 'err500',
+					'type' => 'string',
 					'default' => '',
 					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2', 'nginx')
 					),
-				),
-			),
-		),
+				'customredirect_enabled' => array(
+					'label' => $lng['serversettings']['customredirect_enabled'],
+					'settinggroup' => 'customredirect',
+					'varname' => 'enabled',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2', 'lighttpd')
+					),
+				'customredirect_default' => array(
+					'label' => $lng['serversettings']['customredirect_default'],
+					'settinggroup' => 'customredirect',
+					'varname' => 'default',
+					'type' => 'option',
+					'default' => '1',
+					'option_mode' => 'one',
+					'option_options_method' => 'getRedirectCodes',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2', 'lighttpd')
+					)
+				)
+			)
+		)
 	);
-
-?>
--- a/actions/admin/settings/131.ssl.php
+++ b/actions/admin/settings/131.ssl.php
@@ -0,0 +1,77 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2003-2009 the SysCP Team (see authors).
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Florian Lippert <flo@syscp.org> (2003-2009)
+ * @author     Froxlor team <team@froxlor.org> (2010-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+			'ssl' => array(
+					'title' => $lng['admin']['sslsettings'],
+					'fields' => array(
+							'system_ssl_enabled' => array(
+									'label' => $lng['serversettings']['ssl']['use_ssl'],
+									'settinggroup' => 'system',
+									'varname' => 'use_ssl',
+									'type' => 'bool',
+									'default' => false,
+									'save_method' => 'storeSettingField',
+									'overview_option' => true
+							),
+							'system_ssl_cert_file' => array(
+									'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_cert_file',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '/etc/apache2/apache2.pem',
+									'save_method' => 'storeSettingField',
+							),
+							'system_ssl_key_file' => array(
+									'label' => $lng['serversettings']['ssl']['ssl_key_file'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_key_file',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '/etc/apache2/apache2.key',
+									'save_method' => 'storeSettingField',
+							),
+							'system_ssl_ca_file' => array(
+									'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_ca_file',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '',
+									'save_method' => 'storeSettingField',
+							),
+							'system_ssl_cert_chainfile' => array(
+									'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
+									'settinggroup' => 'system',
+									'varname' => 'ssl_cert_chainfile',
+									'type' => 'string',
+									'string_type' => 'file',
+									'string_emptyallowed' => true,
+									'default' => '',
+									'save_method' => 'storeSettingField',
+							)
+					)
+			)
+		)
+	);
--- a/actions/admin/settings/135.fcgid.php
+++ b/actions/admin/settings/135.fcgid.php
@@ -0,0 +1,151 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Froxlor team <team@froxlor.org> (2010-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+		'fcgid' => array(
+			'title' => $lng['admin']['fcgid_settings'],
+			'websrv_avail' => array('apache2', 'lighttpd'),
+			'fields' => array(
+				'system_mod_fcgid_enabled' => array(
+					'label' => $lng['serversettings']['mod_fcgid'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'plausibility_check_method' => 'checkFcgidPhpFpm',
+					'overview_option' => true
+					),
+				'system_mod_fcgid_configdir' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['configdir'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_configdir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/var/www/php-fcgi-scripts/',
+					'plausibility_check_method' => 'checkPathConflicts',
+					'save_method' => 'storeSettingField',
+					),
+				'system_mod_fcgid_tmpdir' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_tmpdir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/var/customers/tmp/',
+					'save_method' => 'storeSettingField',
+					),
+				'system_mod_fcgid_peardir' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['peardir'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_peardir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'string_delimiter' => ':',
+					'string_emptyallowed' => true,
+					'default' => '/usr/share/php/:/usr/share/php5/',
+					'save_method' => 'storeSettingField',
+					),
+				'system_mod_fcgid_wrapper' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['wrapper'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_wrapper',
+					'type' => 'option',
+					'option_options' => array(0 => 'ScriptAlias', 1=> 'FcgidWrapper'),
+					'default' => 1,
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'system_mod_fcgid_starter' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['starter'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_starter',
+					'type' => 'int',
+					'default' => 0,
+					'save_method' => 'storeSettingField',
+					),
+				'system_mod_fcgid_maxrequests' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['maxrequests'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_maxrequests',
+					'type' => 'int',
+					'default' => 250,
+					'save_method' => 'storeSettingField',
+					),
+				'system_mod_fcgid_defaultini' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_defaultini',
+					'type' => 'option',
+					'default' => '1',
+					'option_mode' => 'one',
+					'option_options_method' => 'getPhpConfigs',
+					'save_method' => 'storeSettingField',
+					),
+				'system_mod_fcgid_enabled_ownvhost' => array(
+					'label' => $lng['serversettings']['mod_fcgid_ownvhost'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_ownvhost',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'system_mod_fcgid_httpuser' => array(
+					'label' => $lng['admin']['mod_fcgid_user'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_httpuser',
+					'type' => 'string',
+					'default' => 'froxlorlocal',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'system_mod_fcgid_httpgroup' => array(
+					'label' => $lng['admin']['mod_fcgid_group'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_httpgroup',
+					'type' => 'string',
+					'default' => 'froxlorlocal',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'system_mod_fcgid_defaultini_ownvhost' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_defaultini_ownvhost',
+					'type' => 'option',
+					'default' => '1',
+					'option_mode' => 'one',
+					'option_options_method' => 'getPhpConfigs',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'system_mod_fcgid_idle_timeout' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
+					'settinggroup' => 'system',
+					'varname' => 'mod_fcgid_idle_timeout',
+					'type' => 'int',
+					'default' => 30,
+					'save_method' => 'storeSettingField'
+					),
+				)
+			)
+		)
+	);
+
+?>
--- a/actions/admin/settings/136.phpfpm.php
+++ b/actions/admin/settings/136.phpfpm.php
@@ -0,0 +1,184 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Froxlor team <team@froxlor.org> (2010-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+		'phpfpm' => array(
+			'title' => $lng['admin']['phpfpm_settings'],
+			'fields' => array(
+				'system_phpfpm_enabled' => array(
+					'label' => $lng['serversettings']['phpfpm'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'enabled',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'plausibility_check_method' => 'checkFcgidPhpFpm',
+					'overview_option' => true
+					),
+				'system_phpfpm_enabled_ownvhost' => array(
+					'label' => $lng['phpfpm']['ownvhost'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'enabled_ownvhost',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField'
+					),
+				'system_phpfpm_httpuser' => array(
+					'label' => $lng['phpfpm']['vhost_httpuser'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'vhost_httpuser',
+					'type' => 'string',
+					'default' => 'froxlorlocal',
+					'save_method' => 'storeSettingField'
+					),
+				'system_phpfpm_httpgroup' => array(
+					'label' => $lng['phpfpm']['vhost_httpgroup'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'vhost_httpgroup',
+					'type' => 'string',
+					'default' => 'froxlorlocal',
+					'save_method' => 'storeSettingField'
+					),
+				'system_phpfpm_defaultini' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'defaultini',
+					'type' => 'option',
+					'default' => '1',
+					'option_mode' => 'one',
+					'option_options_method' => 'getPhpConfigs',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_defaultini_ownvhost' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'vhost_defaultini',
+					'type' => 'option',
+					'default' => '1',
+					'option_mode' => 'one',
+					'option_options_method' => 'getPhpConfigs',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_configdir' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['configdir'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'configdir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/etc/php-fpm.d/',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_aliasconfigdir' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['aliasconfigdir'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'aliasconfigdir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/var/www/php-fpm/',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_tmpdir' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'tmpdir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/var/customers/tmp/',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_peardir' => array(
+					'label' => $lng['serversettings']['mod_fcgid']['peardir'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'peardir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/usr/share/php/:/usr/share/php5/',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_reload' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['reload'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'reload',
+					'type' => 'string',
+					'default' => '/etc/init.d/php-fpm restart',
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_pm' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['pm'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'pm',
+					'type' => 'option',
+					'default' => 'static',
+					'option_mode' => 'one',
+					'option_options' => array('static' => 'static', 'dynamic' => 'dynamic', 'ondemand' => 'ondemand'),
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_max_children' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['max_children'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'max_children',
+					'type' => 'int',
+					'default' => 1,
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_start_servers' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['start_servers'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'start_servers',
+					'type' => 'int',
+					'default' => 20,
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_min_spare_servers' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['min_spare_servers'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'min_spare_servers',
+					'type' => 'int',
+					'default' => 5,
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_max_spare_servers' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['max_spare_servers'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'max_spare_servers',
+					'type' => 'int',
+					'default' => 35,
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_max_requests' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['max_requests'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'max_requests',
+					'type' => 'int',
+					'default' => 0,
+					'save_method' => 'storeSettingField',
+					),
+				'system_phpfpm_idle_timeout' => array(
+					'label' => $lng['serversettings']['phpfpm_settings']['idle_timeout'],
+					'settinggroup' => 'phpfpm',
+					'varname' => 'idle_timeout',
+					'type' => 'int',
+					'default' => 30,
+					'save_method' => 'storeSettingField'
+					),
+				),
+			),
+		),
+	);
+
+?>
--- a/actions/admin/settings/137.perl.php
+++ b/actions/admin/settings/137.perl.php
@@ -0,0 +1,65 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Froxlor team <team@froxlor.org> (2010-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+		'perl' => array(
+			'title' => $lng['admin']['perl_settings'],
+			'fields' => array(
+				'perl_path' => array(
+					'label' => $lng['serversettings']['perl_path'],
+					'settinggroup' => 'system',
+					'varname' => 'perl_path',
+					'type' => 'string',
+					'default' => '/usr/bin/perl',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('lighttpd')
+					),	
+				'system_perl_suexecworkaround' => array(
+					'label' => $lng['serversettings']['perl']['suexecworkaround'],
+					'settinggroup' => 'perl',
+					'varname' => 'suexecworkaround',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'system_perl_suexeccgipath' => array(
+					'label' => $lng['serversettings']['perl']['suexeccgipath'],
+					'settinggroup' => 'perl',
+					'varname' => 'suexecpath',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/var/www/cgi-bin/',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('apache2')
+					),
+				'perl_server' => array(
+					'label' => $lng['serversettings']['perl_server'],
+					'settinggroup' => 'serversettings',
+					'varname' => 'perl_server',
+					'type' => 'string',
+					'default' => 'unix:/var/run/nginx/cgiwrap-dispatch.sock',
+					'save_method' => 'storeSettingField',
+					'websrv_avail' => array('nginx')
+					),
+				),
+			),
+		),
+	);
+
+?>
--- a/actions/admin/settings/140.statistics.php
+++ b/actions/admin/settings/140.statistics.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -40,45 +40,45 @@ return array(
 					'default' => false,
 					'save_method' => 'storeSettingField',
 					),
-				'system_awstats_domain_file' => array(
-					'label' => $lng['serversettings']['awstats_domain_file'],
-					'settinggroup' => 'system',
-					'varname' => 'awstats_domain_file',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/etc/awstats/',
-					'save_method' => 'storeSettingField',
-					),
-				'system_awstats_model_file' => array(
-					'label' => $lng['serversettings']['awstats_model_file'],
-					'settinggroup' => 'system',
-					'varname' => 'awstats_model_file',
-					'type' => 'string',
-					'string_type' => 'file',
-					'default' => '/etc/awstats/awstats.model.conf.syscp',
-					'save_method' => 'storeSettingField',
-					),
 				'system_awstats_path' => array(
 					'label' => $lng['serversettings']['awstats_path'],
 					'settinggroup' => 'system',
 					'varname' => 'awstats_path',
 					'type' => 'string',
 					'string_type' => 'dir',
-					'default' => '/usr/share/awstats/VERSION/webroot/cgi-bin/',
+					'default' => '/usr/bin/',
 					'save_method' => 'storeSettingField',
 					),
-				'system_awstats_updateall_command' => array(
-					'label' => $lng['serversettings']['awstats_updateall_command'],
+				'system_awstats_awstatspath' => array(
+					'label' => $lng['serversettings']['awstats_awstatspath'],
 					'settinggroup' => 'system',
-					'varname' => 'awstats_updateall_command',
+					'varname' => 'awstats_awstatspath',
 					'type' => 'string',
-					'string_type' => 'file',
-					'default' => '/usr/bin/awstats_updateall.pl',
+					'string_type' => 'dir',
+					'default' => '/usr/bin/',
 					'save_method' => 'storeSettingField',
 					),
-				),
-			),
-		),
+				'system_awstats_conf' => array(
+					'label' => $lng['serversettings']['awstats_conf'],
+					'settinggroup' => 'system',
+					'varname' => 'awstats_conf',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/etc/awstats/',
+					'save_method' => 'storeSettingField',
+					),
+				'system_awstats_icons' => array(
+					'label' => $lng['serversettings']['awstats_icons'],
+					'settinggroup' => 'system',
+					'varname' => 'awstats_icons',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/usr/share/awstats/icon/',
+					'save_method' => 'storeSettingField',
+					)
+				)
+			)
+		)
 	);

 ?>
--- a/actions/admin/settings/150.mail.php
+++ b/actions/admin/settings/150.mail.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -51,6 +51,16 @@ return array(
 					'default' => '/var/customers/mail/',
 					'save_method' => 'storeSettingField',
 					),
+				'system_vmail_maildirname' => array(
+					'label' => $lng['serversettings']['vmail_maildirname'],
+					'settinggroup' => 'system',
+					'varname' => 'vmail_maildirname',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => 'Maildir',
+					'string_emptyallowed' => true,
+					'save_method' => 'storeSettingField',
+					),
 				'panel_sendalternativemail' => array(
 					'label' => $lng['serversettings']['sendalternativemail'],
 					'settinggroup' => 'panel',
@@ -75,7 +85,7 @@ return array(
 					'default' => 100,
 					'save_method' => 'storeSettingField',
 					),
-				'systen_autoresponder_enabled' => array(
+				'system_autoresponder_enabled' => array(
 					'label' => $lng['serversettings']['autoresponder_active'],
 					'settinggroup' => 'autoresponder',
 					'varname' => 'autoresponder_active',
@@ -84,15 +94,23 @@ return array(
 					'cronmodule' => 'froxlor/autoresponder',
 					'save_method' => 'storeSettingField',
 					),
-				'systen_last_autoresponder_run' => array(
+				'system_last_autoresponder_run' => array(
 					'settinggroup' => 'autoresponder',
 					'varname' => 'last_autoresponder_run',
 					'type' => 'hidden',
 					'default' => 0,
 					),
+				'system_catchall_enabled' => array(
+					'label' => $lng['serversettings']['catchall_enabled'],
+					'settinggroup' => 'catchall',
+					'varname' => 'catchall_enabled',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingResetCatchall',
+					),
 				),
 			),
 		),
 	);

-?>
+?>
--- a/actions/admin/settings/155.ftpserver.php
+++ b/actions/admin/settings/155.ftpserver.php
@@ -0,0 +1,40 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2003-2009 the SysCP Team (see authors).
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Florian Lippert <flo@syscp.org> (2003-2009)
+ * @author     Froxlor team <team@froxlor.org> (2010-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+	'ftpserver' => array(
+			'title' => $lng['admin']['ftpserversettings'],
+			'fields' => array(
+				'ftpserver' => array(
+					'label' => $lng['admin']['ftpserver'],
+					'settinggroup' => 'system',
+					'varname' => 'ftpserver',
+					'type' => 'option',
+					'default' => 'proftpd',
+					'option_mode' => 'one',
+					'option_options' => array('proftpd' => 'Proftpd', 'pureftpd' => 'Pureftpd'),
+					'save_method' => 'storeSettingField',
+				),
+			),
+		),
+	)
+);
+
+?>
--- a/actions/admin/settings/160.nameserver.php
+++ b/actions/admin/settings/160.nameserver.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -22,6 +22,15 @@ return array(
 		'nameserver' => array(
 			'title' => $lng['admin']['nameserversettings'],
 			'fields' => array(
+				'nameserver_enable' => array(
+					'label' => $lng['serversettings']['bindenable'],
+					'settinggroup' => 'system',
+					'varname' => 'bind_enable',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					'overview_option' => true
+					),
 				'system_bindconf_directory' => array(
 					'label' => $lng['serversettings']['bindconf_directory'],
 					'settinggroup' => 'system',
@@ -59,6 +68,34 @@ return array(
 					'default' => '',
 					'save_method' => 'storeSettingField',
 					),
+				'system_axfrservers' => array(
+					'label' => $lng['serversettings']['axfrservers'],
+					'settinggroup' => 'system',
+					'varname' => 'axfrservers',
+					'type' => 'string',
+					'string_type' => 'validate_ip',
+					'string_emptyallowed' => true,
+					'default' => '',
+					'save_method' => 'storeSettingField',
+				),
+				'system_dns_createmailentry' => array(
+					'label' => $lng['serversettings']['mail_also_with_mxservers'],
+					'settinggroup' => 'system',
+					'varname' => 'dns_createmailentry',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField'
+					),
+				'system_defaultttl' => array(
+					'label' => $lng['serversettings']['defaultttl'],
+					'settinggroup' => 'system',
+					'varname' => 'defaultttl',
+					'type' => 'int',
+					'default' => 604800, /* 1 week */
+					'int_min' => 3600, /* 1 hour */
+					'int_max' => 2147483647, /* integer max */
+					'save_method' => 'storeSettingField',
+					),
 				),
 			),
 		),
--- a/actions/admin/settings/170.logger.php
+++ b/actions/admin/settings/170.logger.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -29,6 +29,7 @@ return array(
 					'type' => 'bool',
 					'default' => false,
 					'save_method' => 'storeSettingField',
+					'overview_option' => true
 					),
 				'logger_severity' => array(
 					'label' => $lng['serversettings']['logger']['severity'],
--- a/actions/admin/settings/180.dkim.php
+++ b/actions/admin/settings/180.dkim.php
@@ -14,9 +14,11 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

+global $settings;
+
 return array(
 	'groups' => array(
 		'dkim' => array(
@@ -28,13 +30,15 @@ return array(
 					'varname' => 'use_dkim',
 					'type' => 'bool',
 					'default' => false,
-					'save_method' => 'storeSettingField',
+					'save_method' => 'storeSettingFieldInsertBindTask',
+					'overview_option' => true
 					),
 				'dkim_prefix' => array(
 					'label' => $lng['dkim']['dkim_prefix'],
 					'settinggroup' => 'dkim',
 					'varname' => 'dkim_prefix',
 					'type' => 'string',
+					'string_type' => 'dir',
 					'default' => '/etc/postfix/dkim/',
 					'save_method' => 'storeSettingField',
 					),
@@ -56,6 +60,66 @@ return array(
 					'default' => 'dkim-keys.conf',
 					'save_method' => 'storeSettingField',
 					),
+				'dkim_algorithm' => array(
+					'label' => $lng['dkim']['dkim_algorithm'],
+					'settinggroup' => 'dkim',
+					'varname' => 'dkim_algorithm',
+					'type' => 'option',
+					'default' => 'all',
+					'option_mode' => 'multiple',
+					'option_options' => array('all' => 'All', 'sha1' => 'SHA1', 'sha256' => 'SHA256'),
+					'save_method' => 'storeSettingFieldInsertBindTask',
+					),
+				'dkim_servicetype' => array(
+					'label' => $lng['dkim']['dkim_servicetype'],
+					'settinggroup' => 'dkim',
+					'varname' => 'dkim_servicetype',
+					'type' => 'option',
+					'default' => '0',
+					'option_mode' => 'one',
+					'option_options' => array('0' => 'All', '1' => 'E-Mail'),
+					'save_method' => 'storeSettingFieldInsertBindTask',
+					),
+				'dkim_keylength' => array(
+					'label' => array(
+						'title' => $lng['dkim']['dkim_keylength']['title'], 
+						'description' => sprintf($lng['dkim']['dkim_keylength']['description'],$settings['dkim']['dkim_prefix'])
+					),
+					'settinggroup' => 'dkim',
+					'varname' => 'dkim_keylength',
+					'type' => 'option',
+					'default' => '1024',
+					'option_mode' => 'one',
+					'option_options' => array('1024' => '1024 Bit', '2048' => '2048 Bit'),
+					'save_method' => 'storeSettingFieldInsertBindTask',
+					),
+				'dkim_notes' => array(
+					'label' => $lng['dkim']['dkim_notes'],
+					'settinggroup' => 'dkim',
+					'varname' => 'dkim_notes',
+					'type' => 'string',
+					'string_regexp' => '/^[a-z0-9\._]+$/i',
+					'default' => '',
+					'save_method' => 'storeSettingFieldInsertBindTask',
+					),
+				'dkim_add_adsp' => array(
+					'label' => $lng['dkim']['dkim_add_adsp'],
+					'settinggroup' => 'dkim',
+					'varname' => 'dkim_add_adsp',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingFieldInsertBindTask',
+					),
+				'dkim_add_adsppolicy' => array(
+					'label' => $lng['dkim']['dkim_add_adsppolicy'],
+					'settinggroup' => 'dkim',
+					'varname' => 'dkim_add_adsppolicy',
+					'type' => 'option',
+					'default' => '1',
+					'option_mode' => 'one',
+					'option_options' => array('0' => 'Unknown', '1' => 'All', '2' => 'Discardable'),
+					'save_method' => 'storeSettingFieldInsertBindTask',
+					),
 				'dkimrestart_command' => array(
 					'label' => $lng['dkim']['dkimrestart_command'],
 					'settinggroup' => 'dkim',
--- a/actions/admin/settings/185.spf.php
+++ b/actions/admin/settings/185.spf.php
@@ -12,7 +12,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -26,7 +26,8 @@ return array(
 					'varname' => 'use_spf',
 					'type' => 'bool',
 					'default' => false,
-					'save_method' => 'storeSettingField'
+					'save_method' => 'storeSettingField',
+					'overview_option' => true
 					),
 				'spf_entry' => array(
 					'label' => $lng['spf']['spf_entry'],
--- a/actions/admin/settings/190.ticket.php
+++ b/actions/admin/settings/190.ticket.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -30,6 +30,7 @@ return array(
 					'default' => false,
 					'cronmodule' => 'froxlor/ticket',
 					'save_method' => 'storeSettingField',
+					'overview_option' => true
 					),
 				'ticket_noreply_email' => array(
 					'label' => $lng['serversettings']['ticket']['noreply_email'],
@@ -57,6 +58,7 @@ return array(
 					'option_mode' => 'one',
 					'option_options' => array(0 => html_entity_decode($lng['admin']['tickets']['daily']), 1 => html_entity_decode($lng['admin']['tickets']['weekly']), 2 => html_entity_decode($lng['admin']['tickets']['monthly']), 3 => html_entity_decode($lng['admin']['tickets']['yearly'])),
 					'save_method' => 'storeSettingField',
+					'plausibility_check_method' => 'setCycleOfCronjob',
 					),
 				'ticket_concurrently_open' => array(
 					'label' => $lng['serversettings']['ticket']['concurrentlyopen'],
@@ -124,9 +126,19 @@ return array(
 					'type' => 'hidden',
 					'default' => '',
 					),
+				'ticket_default_priority' => array(
+					'label' => $lng['serversettings']['ticket']['default_priority'],
+					'settinggroup' => 'ticket',
+					'varname' => 'default_priority',
+					'type' => 'option',
+					'default' => 2,
+					'option_mode' => 'one',
+					'option_options' => array(1 => $lng['ticket']['high'], 2 => $lng['ticket']['normal'], 3 => $lng['ticket']['low']),
+					'save_method' => 'storeSettingField', 
+					),
 				),
 			),
 		)
 	);

-?>
+?>
--- a/actions/admin/settings/200.aps.php
+++ b/actions/admin/settings/200.aps.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -30,6 +30,7 @@ return array(
 					'default' => false,
 					'cronmodule' => 'froxlor/aps',
 					'save_method' => 'storeSettingField',
+					'overview_option' => true
 					),
 				'aps_items_per_page' => array(
 					'label' => $lng['aps']['packages_per_page'],
@@ -58,7 +59,7 @@ return array(
 					'type' => 'option',
 					'default' => '',
 					'option_mode' => 'multiple',
-					'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap'),
+					'option_options' => array('gd' => 'GD Library', 'pcre' => 'PCRE', 'ioncube' => 'ionCube', 'ioncube loader' => 'ionCube Loader', 'curl' => 'curl', 'mcrypt' => 'mcrypt', 'imap' => 'imap', 'json' => 'json', 'ldap' => 'LDAP', 'hash' => 'hash', 'mbstring' => 'mbstring', 'Zend Optimizer' => 'Zend Guard'),
 					'save_method' => 'storeSettingApsPhpExtensions',
 					),
 				'aps_php-function' => array(
--- a/actions/admin/settings/210.security.php
+++ b/actions/admin/settings/210.security.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Settings
- * @version    $Id$
+ *
 */

 return array(
@@ -38,71 +38,17 @@ return array(
 					'default' => true,
 					'save_method' => 'storeSettingField',
 					),
-				'system_mod_fcgid_enabled' => array(
-					'label' => $lng['serversettings']['mod_fcgid'],
+				'system_passwordcryptfunc' => array(
+					'label' => $lng['serversettings']['passwordcryptfunc'],
 					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid',
-					'type' => 'bool',
-					'default' => false,
-					'save_method' => 'storeSettingField',
-					),
-				'system_mod_fcgid_configdir' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['configdir'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid_configdir',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/var/www/php-fcgi-scripts/',
-					'save_method' => 'storeSettingField',
-					),
-				'system_mod_fcgid_tmpdir' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid_tmpdir',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'default' => '/var/customers/tmp/',
-					'save_method' => 'storeSettingField',
-					),
-				'system_mod_fcgid_peardir' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['peardir'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid_peardir',
-					'type' => 'string',
-					'string_type' => 'dir',
-					'string_delimiter' => ':',
-					'string_emptyallowed' => true,
-					'default' => '/usr/share/php/:/usr/share/php5/',
-					'save_method' => 'storeSettingField',
-					),
-				'system_mod_fcgid_wrapper' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['wrapper'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid_wrapper',
+					'varname' => 'passwordcryptfunc',
 					'type' => 'option',
-					'option_options' => array(0 => 'ScriptAlias', 1=> 'FCGIWrapper'),
 					'default' => 0,
+					'option_mode' => 'one',
+					'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
 					'save_method' => 'storeSettingField',
-					),
-				'system_mod_fcgid_starter' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['starter'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid_starter',
-					'type' => 'int',
-					'default' => 0,
-					'save_method' => 'storeSettingField',
-					),
-				'system_mod_fcgid_maxrequests' => array(
-					'label' => $lng['serversettings']['mod_fcgid']['maxrequests'],
-					'settinggroup' => 'system',
-					'varname' => 'mod_fcgid_maxrequests',
-					'type' => 'int',
-					'default' => 250,
-					'save_method' => 'storeSettingField',
-					),
-				),
-			),
-		),
+					)
+				)
+			)
+		)
 	);
-
-?>
--- a/actions/admin/settings/215.backup.php
+++ b/actions/admin/settings/215.backup.php
@@ -0,0 +1,118 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2003-2009 the SysCP Team (see authors).
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Florian Lippert <flo@syscp.org> (2003-2009)
+ * @author     Froxlor team <team@froxlor.org> (2010-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+		'backup' => array(
+			'title' => $lng['backup'],
+			'fields' => array(
+				'backup_enabled' => array(
+					'label' => $lng['serversettings']['backup_enabled'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_enabled',
+					'type' => 'bool',
+					'default' => false,
+					'cronmodule' => 'froxlor/backup',
+					'save_method' => 'storeSettingField',
+					'overview_option' => true
+				),
+				'backup_dir' => array(
+					'label' => $lng['serversettings']['backupdir']['description'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_dir',
+					'type' => 'string',
+					'string_type' => 'dir',
+					'default' => '/var/customers/backups/',
+					'string_regexp' => '#^/.*/$#',
+					'save_method' => 'storeSettingField',
+				),
+				'backup_mysqldump_path' => array(
+					'label' => $lng['serversettings']['mysqldump_path']['description'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_mysqldump_path',
+					'type' => 'string',
+					'default' => '/usr/bin/mysqldump',
+					'save_method' => 'storeSettingField',
+				),
+				'backup_count' => array(
+					'label' => $lng['serversettings']['backup_count'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_count',
+					'type' => 'bool',
+					'default' => 'true',
+					'save_method' => 'storeSettingField',
+					'overview_option' => false
+				),				
+				'backup_bigfile' => array(
+					'label' => $lng['serversettings']['backup_bigfile'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_bigfile',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'overview_option' => false
+				),
+				'backup_ftp_enabled_' => array(
+					'label' => $lng['serversettings']['backup_ftp_enabled'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_ftp_enabled',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'overview_option' => false
+				),
+				'backup_server' => array(
+					'label' => $lng['serversettings']['backup_ftp_server'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_ftp_server',
+					'type' => 'string',
+					'default' => '',
+					'save_method' => 'storeSettingField',
+				),
+				'backup_user' => array(
+					'label' => $lng['serversettings']['backup_ftp_user'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_ftp_user',
+					'type' => 'string',
+					'default' => '',
+					'save_method' => 'storeSettingField',
+				),
+				'backup_pass' => array(
+					'label' => $lng['serversettings']['backup_ftp_pass'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_ftp_pass',
+					'type' => 'hiddenstring',
+					'default' => '',
+					'save_method' => 'storeSettingField',
+				),
+				'backup_passive_mode' => array(
+					'label' => $lng['serversettings']['backup_ftp_passive_mode'],
+					'settinggroup' => 'system',
+					'varname' => 'backup_ftp_passive',
+					'type' => 'bool',
+					'default' => true,
+					'save_method' => 'storeSettingField',
+					'overview_option' => false,
+				),
+				),
+			),
+		),
+	);
+
+?>
--- a/actions/admin/settings/220.quota.php
+++ b/actions/admin/settings/220.quota.php
@@ -0,0 +1,60 @@
+<?php
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2011- the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Froxlor team <team@froxlor.org> (2011-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Settings
+ *
+ */
+
+return array(
+	'groups' => array(
+		'diskquota' => array(
+			'title' => $lng['diskquota'],
+			'fields' => array(
+				'diskquota_enabled' => array(
+					'label' => $lng['serversettings']['diskquota_enabled'],
+					'settinggroup' => 'system',
+					'varname' => 'diskquota_enabled',
+					'type' => 'bool',
+					'default' => false,
+					'save_method' => 'storeSettingField',
+					'overview_option' => true
+				),
+				'diskquota_repquota_path' => array(
+					'label' => $lng['serversettings']['diskquota_repquota_path']['description'],
+					'settinggroup' => 'system',
+					'varname' => 'diskquota_repquota_path',
+					'type' => 'string',
+					'default' => '/usr/sbin/repquota',
+					'save_method' => 'storeSettingField',
+				),
+				'diskquota_quotatool_path' => array(
+					'label' => $lng['serversettings']['diskquota_quotatool_path']['description'],
+					'settinggroup' => 'system',
+					'varname' => 'diskquota_quotatool_path',
+					'type' => 'string',
+					'default' => '/usr/bin/quotatool',
+					'save_method' => 'storeSettingField',
+				),
+				'diskquota_customer_partition' => array(
+					'label' => $lng['serversettings']['diskquota_customer_partition']['description'],
+					'settinggroup' => 'system',
+					'varname' => 'diskquota_customer_partition',
+					'type' => 'string',
+					'default' => '/dev/root',
+					'save_method' => 'storeSettingField',
+				),
+				),
+			),
+		),
+	);
+
+?>
--- a/admin_admins.php
+++ b/admin_admins.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -47,22 +47,6 @@ if($page == 'admins'
 			'diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
 			'traffic' => $lng['customer']['traffic'],
 			'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
-			'mysqls' => $lng['customer']['mysqls'],
-			'mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
-			'ftps' => $lng['customer']['ftps'],
-			'ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
-			'tickets' => $lng['customer']['tickets'],
-			'tickets_used' => $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')',
-			'subdomains' => $lng['customer']['subdomains'],
-			'subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
-			'emails' => $lng['customer']['emails'],
-			'emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
-			'email_accounts' => $lng['customer']['accounts'],
-			'email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
-			'email_forwarders' => $lng['customer']['forwarders'],
-			'email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
-			'email_quota' => $lng['customer']['email_quota'],
-			'email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
 			'deactivated' => $lng['admin']['deactivated']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_ADMINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
@@ -84,7 +68,30 @@ if($page == 'admins'
 				$row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
 				$row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
 				$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
-				$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps subdomains tickets');
+
+				/**
+				 * percent-values for progressbar
+				 */
+                                //For Disk usage
+                                if ($row['diskspace'] > 0) {
+                                        $disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
+                                        $disk_doublepercent = round($disk_percent*2, 2);
+                                } else {
+                                        $disk_percent = 0;
+                                        $disk_doublepercent = 0;
+                                }
+
+				//For Traffic usage
+                                if ($row['traffic'] > 0) {
+                                        $traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
+                                        $traffic_doublepercent = round($traffic_percent*2, 2);
+                                } else {
+                                        $traffic_percent = 0;
+                                        $traffic_doublepercent = 0;
+                                }
+				/* */
+
+				$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps subdomains tickets');
 				$row = htmlentities_array($row);
 				eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";");
 				$count++;
@@ -93,6 +100,7 @@ if($page == 'admins'
 			$i++;
 		}

+		$admincount = $db->num_rows($result);
 		eval("echo \"" . getTemplate("admins/admins") . "\";");
 	}
 	elseif($action == 'su')
@@ -154,6 +162,7 @@ if($page == 'admins'

 			$loginname = validate($_POST['loginname'], 'loginname');
 			$password = validate($_POST['admin_password'], 'password');
+			$password = validatePassword($password);
 			$def_language = validate($_POST['def_language'], 'default language');
 			$customers = intval_ressource($_POST['customers']);

@@ -211,6 +220,20 @@ if($page == 'admins'
 				$email_quota = - 1;
 			}

+			if($settings['autoresponder']['autoresponder_active'] == '1')
+			{
+				$email_autoresponder = intval_ressource($_POST['email_autoresponder']);
+
+				if(isset($_POST['email_autoresponder_ul']))
+				{
+					$email_autoresponder = - 1;
+				}
+			}
+			else
+			{
+				$email_autoresponder = 0;
+			}
+
 			$ftps = intval_ressource($_POST['ftps']);

 			if(isset($_POST['ftps_ul']))
@@ -218,12 +241,18 @@ if($page == 'admins'
 				$ftps = - 1;
 			}

-			$tickets = intval_ressource($_POST['tickets']);
-
-			if(isset($_POST['tickets_ul'])
-			   && $settings['ticket']['enabled'] == '1')
+			if($settings['ticket']['enabled'] == 1)
 			{
-				$tickets = - 1;
+				$tickets = intval_ressource($_POST['tickets']);
+
+				if(isset($_POST['tickets_ul']))
+				{
+					$tickets = - 1;
+				}
+			}
+			else
+			{
+				$tickets = 0;
 			}

 			$mysqls = intval_ressource($_POST['mysqls']);
@@ -242,7 +271,7 @@ if($page == 'admins'
 					$number_of_aps_packages = - 1;
 				}

-				$can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
+				$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
 			}
 			else
 			{
@@ -250,10 +279,21 @@ if($page == 'admins'
 				$can_manage_aps_packages = 0;
 			}

-			$customers_see_all = intval($_POST['customers_see_all']);
-			$domains_see_all = intval($_POST['domains_see_all']);
-			$caneditphpsettings = intval($_POST['caneditphpsettings']);
-			$change_serversettings = intval($_POST['change_serversettings']);
+			$customers_see_all = 0;
+			if(isset($_POST['customers_see_all']))
+				$customers_see_all = intval($_POST['customers_see_all']);
+			
+			$domains_see_all = 0;
+			if(isset($_POST['domains_see_all']))
+				$domains_see_all = intval($_POST['domains_see_all']);
+			
+			$caneditphpsettings = 0;
+			if(isset($_POST['caneditphpsettings']))
+				$caneditphpsettings = intval($_POST['caneditphpsettings']);
+			
+			$change_serversettings = 0;
+			if(isset($_POST['change_serversettings']))
+				$change_serversettings = intval($_POST['change_serversettings']);

 			$diskspace = intval_ressource($_POST['diskspace']);

@@ -269,6 +309,10 @@ if($page == 'admins'
 				$traffic = - 1;
 			}

+			$tickets_see_all = 0;
+			if(isset($_POST['tickets_see_all']))
+				$tickets_see_all = intval($_POST['tickets_see_all']);
+
 			$diskspace = $diskspace * 1024;
 			$traffic = $traffic * 1024 * 1024;
 			$ipaddress = intval_ressource($_POST['ipaddress']);
@@ -336,8 +380,43 @@ if($page == 'admins'
 					$change_serversettings = '0';
 				}

-				$result = $db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` (`loginname`, `password`, `name`, `email`, `def_language`, `change_serversettings`, `customers`, `customers_see_all`, `domains`, `domains_see_all`, `caneditphpsettings`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `ip`, `can_manage_aps_packages`, `aps_packages`)
-					                   VALUES ('" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($email) . "','" . $db->escape($def_language) . "', '" . $db->escape($change_serversettings) . "', '" . $db->escape($customers) . "', '" . $db->escape($customers_see_all) . "', '" . $db->escape($domains) . "', '" . $db->escape($domains_see_all) . "', '" . (int)$caneditphpsettings . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '" . (int)$ipaddress . "', " . (int)$can_manage_aps_packages . ", " . (int)$number_of_aps_packages . ")");
+				if ($tickets_see_all != '1') {
+					$tickets_see_all  = '0';
+				}
+
+				$_theme = $settings['panel']['default_theme'];
+
+				$result = $db->query("INSERT INTO 
+					`" . TABLE_PANEL_ADMINS . "`
+				SET 
+					`loginname` = '" . $db->escape($loginname) . "', 
+					`password` = '" . md5($password) . "', 
+					`name` = '" . $db->escape($name) . "', 
+					`email` = '" . $db->escape($email) . "', 
+					`def_language` = '" . $db->escape($def_language) . "', 
+					`change_serversettings` = '" . $db->escape($change_serversettings) . "', 
+					`customers` = '" . $db->escape($customers) . "', 
+					`customers_see_all` = '" . $db->escape($customers_see_all) . "', 
+					`domains` = '" . $db->escape($domains) . "', 
+					`domains_see_all` = '" . $db->escape($domains_see_all) . "', 
+					`caneditphpsettings` = '" . (int)$caneditphpsettings . "', 
+					`diskspace` = '" . $db->escape($diskspace) . "', 
+					`traffic` = '" . $db->escape($traffic) . "', 
+					`subdomains` = '" . $db->escape($subdomains) . "', 
+					`emails` = '" . $db->escape($emails) . "', 
+					`email_accounts` = '" . $db->escape($email_accounts) . "', 
+					`email_forwarders` = '" . $db->escape($email_forwarders) . "', 
+					`email_quota` = '" . $db->escape($email_quota) . "', 
+					`ftps` = '" . $db->escape($ftps) . "', 
+					`tickets` = '" . $db->escape($tickets) . "', 
+					`tickets_see_all` = '" . $db->escape($tickets_see_all) . "',
+					`mysqls` = '" . $db->escape($mysqls) . "', 
+					`ip` = '" . (int)$ipaddress . "', 
+					`can_manage_aps_packages` = '" . (int)$can_manage_aps_packages . "', 
+					`aps_packages` = '" . (int)$number_of_aps_packages . "', 
+					`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
+					`theme` = '".$db->escape($_theme)."';
+				");
 				$adminid = $db->insert_id();
 				$log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -379,16 +458,25 @@ if($page == 'admins'
 			$email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
+			$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 			$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
+			/*
 			$change_serversettings = makeyesno('change_serversettings', '1', '0', '0');
 			$customers_see_all = makeyesno('customers_see_all', '1', '0', '0');
 			$domains_see_all = makeyesno('domains_see_all', '1', '0', '0');
 			$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', '0');
 			$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', '0');
+			*/
 			$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);

+			$admin_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_add.php';
+			$admin_add_form = htmlform::genHTMLForm($admin_add_data);
+
+			$title = $admin_add_data['admin_add']['title'];
+			$image = $admin_add_data['admin_add']['image'];
+
 			eval("echo \"" . getTemplate("admins/admins_add") . "\";");
 		}
 	}
@@ -417,9 +505,11 @@ if($page == 'admins'
 					$email_accounts = $result['email_accounts'];
 					$email_forwarders = $result['email_forwarders'];
 					$email_quota = $result['email_quota'];
+					$email_autoresponder = $result['email_autoresponder'];
 					$ftps = $result['ftps'];
 					$tickets = $result['tickets'];
 					$mysqls = $result['mysqls'];
+					$tickets_see_all = $result['tickets_see_all'];
 					$customers_see_all = $result['customers_see_all'];
 					$domains_see_all = $result['domains_see_all'];
 					$caneditphpsettings = $result['caneditphpsettings'];
@@ -434,109 +524,113 @@ if($page == 'admins'
 				{
 					$password = validate($_POST['admin_password'], 'new password');
 					$def_language = validate($_POST['def_language'], 'default language');
-					$deactivated = intval($_POST['deactivated']);
-					$customers = intval_ressource($_POST['customers']);
+					$deactivated = isset($_POST['deactivated']) ? 1 : 0;

-					if(isset($_POST['customers_ul']))
-					{
-						$customers = - 1;
+					$customers = intval_ressource($_POST['customers']);
+					if (isset($_POST['customers_ul'])) {
+						$customers = -1;
 					}

 					$domains = intval_ressource($_POST['domains']);
-
-					if(isset($_POST['domains_ul']))
-					{
-						$domains = - 1;
+					if (isset($_POST['domains_ul'])) {
+						$domains = -1;
 					}

 					$subdomains = intval_ressource($_POST['subdomains']);
-
-					if(isset($_POST['subdomains_ul']))
-					{
-						$subdomains = - 1;
+					if (isset($_POST['subdomains_ul'])) {
+						$subdomains = -1;
 					}

 					$emails = intval_ressource($_POST['emails']);
-
-					if(isset($_POST['emails_ul']))
-					{
-						$emails = - 1;
+					if (isset($_POST['emails_ul'])) {
+						$emails = -1;
 					}

 					$email_accounts = intval_ressource($_POST['email_accounts']);
-
-					if(isset($_POST['email_accounts_ul']))
-					{
-						$email_accounts = - 1;
+					if (isset($_POST['email_accounts_ul'])) {
+						$email_accounts = -1;
 					}

 					$email_forwarders = intval_ressource($_POST['email_forwarders']);
-
-					if(isset($_POST['email_forwarders_ul']))
-					{
-						$email_forwarders = - 1;
+					if (isset($_POST['email_forwarders_ul'])) {
+						$email_forwarders = -1;
 					}

-					if($settings['system']['mail_quota_enabled'] == '1')
-					{
+					if ($settings['system']['mail_quota_enabled'] == '1') {
 						$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
-
-						if(isset($_POST['email_quota_ul']))
-						{
-							$email_quota = - 1;
+						if (isset($_POST['email_quota_ul'])) {
+							$email_quota = -1;
 						}
+					} else {
+						$email_quota = -1;
 					}
-					else
-					{
-						$email_quota = - 1;
+
+					if ($settings['autoresponder']['autoresponder_active'] == '1') {
+						$email_autoresponder = intval_ressource($_POST['email_autoresponder']);
+						if (isset($_POST['email_autoresponder_ul'])) {
+							$email_autoresponder = -1;
+						}
+					} else {
+						$email_autoresponder = 0;
 					}

 					$ftps = intval_ressource($_POST['ftps']);
-
-					if(isset($_POST['ftps_ul']))
-					{
-						$ftps = - 1;
+					if (isset($_POST['ftps_ul'])) {
+						$ftps = -1;
 					}
-
-					$tickets = intval_ressource($_POST['tickets']);
-
-					if(isset($_POST['tickets_ul']))
-					{
-						$tickets = - 1;
+					
+					if ($settings['ticket']['enabled'] == 1) {
+						$tickets = intval_ressource($_POST['tickets']);
+						if (isset($_POST['tickets_ul'])) {
+							$tickets = -1;
+						}
+					} else {
+						$tickets = 0;
 					}

 					$mysqls = intval_ressource($_POST['mysqls']);
-
-					if(isset($_POST['mysqls_ul']))
-					{
+					if (isset($_POST['mysqls_ul'])) {
 						$mysqls = - 1;
 					}

-					$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
-
-					if(isset($_POST['number_of_aps_packages_ul']))
-					{
-						$number_of_aps_packages = - 1;
+					if ($settings['aps']['aps_active'] == '1') {
+						$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);
+						if (isset($_POST['number_of_aps_packages_ul'])) {
+							$number_of_aps_packages = -1;
+						}
+						$can_manage_aps_packages = isset($_POST['can_manage_aps_packages']) ? 1 : 0;
+					} else {
+						$number_of_aps_packages = 0;
 					}

-					$customers_see_all = intval($_POST['customers_see_all']);
-					$domains_see_all = intval($_POST['domains_see_all']);
-					$caneditphpsettings = intval($_POST['caneditphpsettings']);
-					$change_serversettings = intval($_POST['change_serversettings']);
-					$can_manage_aps_packages = intval($_POST['can_manage_aps_packages']);
+					$customers_see_all = 0;
+					if(isset($_POST['customers_see_all']))
+						$customers_see_all = intval($_POST['customers_see_all']);
+					
+					$domains_see_all = 0;
+					if(isset($_POST['domains_see_all']))
+						$domains_see_all = intval($_POST['domains_see_all']);
+					
+					$caneditphpsettings = 0;
+					if(isset($_POST['caneditphpsettings']))
+						$caneditphpsettings = intval($_POST['caneditphpsettings']);
+
+					$change_serversettings = 0;
+					if(isset($_POST['change_serversettings']))
+						$change_serversettings = isset($_POST['change_serversettings']) ? 1 : 0;
+
+					$tickets_see_all = 0;
+					if (isset($_POST['tickets_see_all']))
+						$tickets_see_all = intval($_POST['tickets_see_all']);

 					$diskspace = intval($_POST['diskspace']);
-
-					if(isset($_POST['diskspace_ul']))
-					{
-						$diskspace = - 1;
+					if (isset($_POST['diskspace_ul'])) {
+						$diskspace = -1;
 					}

 					$traffic = doubleval_ressource($_POST['traffic']);
-
-					if(isset($_POST['traffic_ul']))
-					{
-						$traffic = - 1;
+					if (isset($_POST['traffic_ul'])) {
+						$traffic = -1;
 					}

 					$diskspace = $diskspace * 1024;
@@ -560,6 +654,7 @@ if($page == 'admins'
 				{
 					if($password != '')
 					{
+						$password = validatePassword($password);
 						$password = md5($password);
 					}
 					else
@@ -592,7 +687,88 @@ if($page == 'admins'
 						$change_serversettings = '0';
 					}

-					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `name`='" . $db->escape($name) . "', `email`='" . $db->escape($email) . "', `def_language`='" . $db->escape($def_language) . "', `change_serversettings` = '" . $db->escape($change_serversettings) . "', `customers` = '" . $db->escape($customers) . "', `customers_see_all` = '" . $db->escape($customers_see_all) . "', `domains` = '" . $db->escape($domains) . "', `domains_see_all` = '" . $db->escape($domains_see_all) . "', `caneditphpsettings` = '" . (int)$caneditphpsettings . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `email_quota`='" . $db->escape($email_quota) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `ip`='" . (int)$ipaddress . "', `deactivated`='" . $db->escape($deactivated) . "', `can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ", `aps_packages`=" . (int)$number_of_aps_packages . " WHERE `adminid`='" . $db->escape($id) . "'");
+					if ($tickets_see_all != '1') {
+						$tickets_see_all = '0';
+					}
+
+					// check if a resource was set to something lower
+					// than actually used by the admin/reseller
+					$res_warning = "";
+					if ($customers != $result['customers'] && $customers < $result['customers_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'customers');
+					}
+					if ($domains != $result['domains'] && $domains < $result['domains_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'domains');
+					}
+					if ($diskspace != $result['diskspace'] && ($diskspace / 1024) != -1 && $diskspace < $result['diskspace_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'diskspace');
+					}
+					if ($traffic != $result['traffic'] && ($traffic / 1024 / 1024) != -1 && $traffic < $result['traffic_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'traffic');
+					}
+					if ($emails != $result['emails'] && $emails < $result['emails_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'emails');
+					}
+					if ($email_accounts != $result['email_accounts'] && $email_accounts < $result['email_accounts_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email accounts');
+					}
+					if ($email_forwarders != $result['email_forwarders'] && $email_forwarders < $result['email_forwarders_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email forwarders');
+					}
+					if ($email_quota != $result['email_quota'] && $email_quota < $result['email_quota_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email quota');
+					}
+					if ($email_autoresponder != $result['email_autoresponder'] && $email_autoresponder < $result['email_autoresponder_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email autoresponder');
+					}
+					if ($ftps != $result['ftps'] && $ftps < $result['ftps_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'ftps');
+					}
+					if ($tickets != $result['tickets'] && $tickets < $result['tickets_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'tickets');
+					}
+					if ($mysqls != $result['mysqls'] && $mysqls < $result['mysqls_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'mysqls');
+					}
+					if ($number_of_aps_packages != $result['aps_packages'] && $number_of_aps_packages < $result['aps_packages_used']) {
+						$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'aps packages');
+					}
+
+					if ($res_warning != "") {
+						$link = '';
+						$error = $res_warning;
+						eval("echo \"" . getTemplate('misc/error', '1') . "\";");
+						exit;
+					}
+
+					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET
+						`name`='" . $db->escape($name) . "',
+						`email`='" . $db->escape($email) . "',
+						`def_language`='" . $db->escape($def_language) . "',
+						`change_serversettings` = '" . $db->escape($change_serversettings) . "',
+						`customers` = '" . $db->escape($customers) . "',
+						`customers_see_all` = '" . $db->escape($customers_see_all) . "',
+						`domains` = '" . $db->escape($domains) . "',
+						`domains_see_all` = '" . $db->escape($domains_see_all) . "',
+						`caneditphpsettings` = '" . (int)$caneditphpsettings . "',
+						`password` = '" . $password . "',
+						`diskspace`='" . $db->escape($diskspace) . "',
+						`traffic`='" . $db->escape($traffic) . "',
+						`subdomains`='" . $db->escape($subdomains) . "',
+						`emails`='" . $db->escape($emails) . "',
+						`email_accounts` = '" . $db->escape($email_accounts) . "',
+						`email_forwarders`='" . $db->escape($email_forwarders) . "',
+						`email_quota`='" . $db->escape($email_quota) . "',
+						`email_autoresponder`='" . $db->escape($email_autoresponder) . "',
+						`ftps`='" . $db->escape($ftps) . "',
+						`tickets`='" . $db->escape($tickets) . "',
+						`tickets_see_all`='".$db->escape($tickets_see_all) . "',
+						`mysqls`='" . $db->escape($mysqls) . "',
+						`ip`='" . (int)$ipaddress . "',
+						`deactivated`='" . $db->escape($deactivated) . "',
+						`can_manage_aps_packages`=" . (int)$can_manage_aps_packages . ",
+						`aps_packages`=" . (int)$number_of_aps_packages . "
+						 WHERE `adminid`='" . $db->escape($id) . "'");
 					$log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'");
 					$redirect_props = Array(
 						'page' => $page,
@@ -670,6 +846,13 @@ if($page == 'admins'
 					$result['email_quota'] = '';
 				}

+				$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, $result['email_autoresponder'], true, true);
+
+				if($result['email_autoresponder'] == '-1')
+				{
+					$result['email_autoresponder'] = '';
+				}
+
 				$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true);

 				if($result['ftps'] == '-1')
@@ -723,14 +906,22 @@ if($page == 'admins'
 					}
 				}

+				/*
 				$change_serversettings = makeyesno('change_serversettings', '1', '0', $result['change_serversettings']);
 				$customers_see_all = makeyesno('customers_see_all', '1', '0', $result['customers_see_all']);
 				$domains_see_all = makeyesno('domains_see_all', '1', '0', $result['domains_see_all']);
 				$caneditphpsettings = makeyesno('caneditphpsettings', '1', '0', $result['caneditphpsettings']);
 				$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
 				$can_manage_aps_packages = makeyesno('can_manage_aps_packages', '1', '0', $result['can_manage_aps_packages']);
-
+				*/
 				$result = htmlentities_array($result);
+
+				$admin_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/admin/formfield.admin_edit.php';
+				$admin_edit_form = htmlform::genHTMLForm($admin_edit_data);
+
+				$title = $admin_edit_data['admin_edit']['title'];
+				$image = $admin_edit_data['admin_edit']['image'];
+
 				eval("echo \"" . getTemplate("admins/admins_edit") . "\";");
 			}
 		}
--- a/admin_aps.php
+++ b/admin_aps.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 // Required code
--- a/admin_configfiles.php
+++ b/admin_configfiles.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -95,10 +95,12 @@ if($userinfo['change_serversettings'] == '1')
 			'<VIRTUAL_MAILBOX_BASE>' => $settings['system']['vmail_homedir'],
 			'<VIRTUAL_UID_MAPS>' => $settings['system']['vmail_uid'],
 			'<VIRTUAL_GID_MAPS>' => $settings['system']['vmail_gid'],
-			'<AWSTATS_PATH>' => $settings['system']['awstats_path'],
 			'<SSLPROTOCOLS>' => ($settings['system']['use_ssl'] == '1') ? 'imaps pop3s' : '',
-			'<REALTIME_PORT>' => $settings['system']['realtime_port'],
-			'<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? $settings['system']['mod_fcgid_tmpdir'] : '/tmp/'
+			'<CUSTOMER_TMP>' => ($settings['system']['mod_fcgid_tmpdir'] != '') ? makeCorrectDir($settings['system']['mod_fcgid_tmpdir']) : '/tmp/',
+			'<BASE_PATH>' => makeCorrectDir(dirname(__FILE__)),
+			'<BIND_CONFIG_PATH>' => makeCorrectDir($settings['system']['bindconf_directory']),
+			'<WEBSERVER_RELOAD_CMD>' => $settings['system']['apachereload_command'],
+			'<CUSTOMER_LOGS>' => makeCorrectDir($settings['system']['logfiles_directory'])
 		);
 		$files = '';
 		$configpage = '';
@@ -111,6 +113,7 @@ if($userinfo['change_serversettings'] == '1')
 				if(is_array($value))
 				{
 					$commands = implode("\n", $value);
+					$commands = str_replace("\n\n", "\n", $commands);

 					if($commands != '')
 					{
--- a/admin_cronjobs.php
+++ b/admin_cronjobs.php
@@ -12,28 +12,21 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
+require_once('./lib/init.php');

-require_once("./lib/init.php");
-
-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif(isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }

-if($page == 'cronjobs'
-  || $page == 'overview')
-{
-	if($action == '')
-	{
-		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_cronjobs");
+if ($page == 'cronjobs' || $page == 'overview') {
+	if ($action == '') {
+		$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs');

 		$fields = array(
 			'c.lastrun' => $lng['cron']['lastrun'],
@@ -56,61 +49,81 @@ if($page == 'cronjobs'
 		$i = 0;
 		$count = 0;

-		while($row = $db->fetch_array($result))
-		{
-			if($paging->checkDisplay($i))
-			{
+		while ($row = $db->fetch_array($result)) {
+			if ($paging->checkDisplay($i)) {
 				$row = htmlentities_array($row);
-				
+
 				$row['lastrun'] = date('d.m.Y H:i', $row['lastrun']);
-				
-				if((int)$row['isactive'] == 1)
-				{
-					$row['isactive'] = $lng['panel']['yes'];
-				}
-				else
-				{
-					$row['isactive'] = $lng['panel']['no'];
-				}
-				
+				$row['isactive'] = ((int)$row['isactive'] == 1) ? $lng['panel']['yes'] : $lng['panel']['no'];
+
 				$description = $lng['crondesc'][$row['desc_lng_key']];
-				
-				/*
-				 * don't allow deletion of 'froxlor' cronjobs
-				 */
-				$vendor_a = explode('/', $row['module']);
-				$vendor = $vendor_a[0];
-				
-				eval("\$crons.=\"" . getTemplate("cronjobs/cronjobs_cronjob") . "\";");
+
+				eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjob') . "\";");
 				$count++;
 			}

 			$i++;
 		}

-		eval("echo \"" . getTemplate("cronjobs/cronjobs") . "\";");
+		eval("echo \"" . getTemplate('cronjobs/cronjobs') . "\";");

-	}
-	elseif($action == 'new')
-	{
+	} elseif ($action == 'new') {
 		/*
-		 * @TODO Finish me
+		 * @TODO later
 		 */
+	} elseif ($action == 'edit' && $id != 0) {
+		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`='" . (int)$id . "'");
+		if ($result['cronfile'] != '') {
+			if (isset($_POST['send']) && $_POST['send'] == 'send') {
+				$isactive = isset($_POST['isactive']) ? 1 : 0;
+				$interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty');
+				$interval_interval = validate($_POST['interval_interval'], 'interval_interval');
+
+				if ($isactive != 1) {
+					$isactive = 0;
+				}
+
+				$interval = $interval_value . ' ' . strtoupper($interval_interval);
+
+				$db->query("UPDATE `" . TABLE_PANEL_CRONRUNS . "` 
+							SET `isactive` = '".(int)$isactive."',
+							`interval` = '".$interval."'
+							WHERE `id` = '" . (int)$id . "'");
+
+				redirectTo($filename, Array('page' => $page, 's' => $s));
+			} else {
+				//$isactive = makeyesno('isactive', '1', '0', $result['isactive']);
+				// interval
+				$interval_nfo = explode(' ', $result['interval']);
+				$interval_value = $interval_nfo[0];
+
+				$interval_interval = '';
+				$interval_interval .= makeoption($lng['cronmgmt']['seconds'], 'SECOND', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
+				$interval_interval .= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
+				// end of interval
+
+				$change_cronfile = false;
+				if (substr($result['module'], 0, strpos($result['module'], '/')) != 'froxlor') {
+					$change_cronfile = true;
+				}
+
+				$cronjobs_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/cronjobs/formfield.cronjobs_edit.php';
+				$cronjobs_edit_form = htmlform::genHTMLForm($cronjobs_edit_data);
+
+				$title = $cronjobs_edit_data['cronjobs_edit']['title'];
+				$image = $cronjobs_edit_data['cronjobs_edit']['image'];
+
+				eval("echo \"" . getTemplate('cronjobs/cronjob_edit') . "\";");
+			}
+		}
 	}
-	elseif($action == 'edit'
-	&& $id != 0)
-	{
+	elseif ($action == 'delete' && $id != 0) {
 		/*
-		 * @TODO Finish me
-		 */
-	}
-	elseif($action == 'delete'
-	&& $id != 0)
-	{
-		/*
-		 * @TODO Finish me
+		 * @TODO later
 		 */
 	}
 }
-
-?>
--- a/admin_customers.php
+++ b/admin_customers.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -40,44 +40,30 @@ if($page == 'customers'
 {
 	if($action == '')
 	{
+		// clear request data
+		unset($_SESSION['requestData']);
+
 		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_customers");
 		$fields = array(
 			'c.loginname' => $lng['login']['username'],
 			'a.loginname' => $lng['admin']['admin'],
 			'c.name' => $lng['customer']['name'],
+			'c.email' => $lng['customer']['email'],
 			'c.firstname' => $lng['customer']['firstname'],
 			'c.company' => $lng['customer']['company'],
 			'c.diskspace' => $lng['customer']['diskspace'],
 			'c.diskspace_used' => $lng['customer']['diskspace'] . ' (' . $lng['panel']['used'] . ')',
 			'c.traffic' => $lng['customer']['traffic'],
-			'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
-			'c.mysqls' => $lng['customer']['mysqls'],
-			'c.mysqls_used' => $lng['customer']['mysqls'] . ' (' . $lng['panel']['used'] . ')',
-			'c.ftps' => $lng['customer']['ftps'],
-			'c.ftps_used' => $lng['customer']['ftps'] . ' (' . $lng['panel']['used'] . ')',
-			'c.subdomains' => $lng['customer']['subdomains'],
-			'c.subdomains_used' => $lng['customer']['subdomains'] . ' (' . $lng['panel']['used'] . ')',
-			'c.emails' => $lng['customer']['emails'],
-			'c.emails_used' => $lng['customer']['emails'] . ' (' . $lng['panel']['used'] . ')',
-			'c.email_accounts' => $lng['customer']['accounts'],
-			'c.email_accounts_used' => $lng['customer']['accounts'] . ' (' . $lng['panel']['used'] . ')',
-			'c.email_forwarders' => $lng['customer']['forwarders'],
-			'c.email_forwarders_used' => $lng['customer']['forwarders'] . ' (' . $lng['panel']['used'] . ')',
-			'c.email_quota' => $lng['customer']['email_quota'],
-			'c.email_quota_used' => $lng['customer']['email_quota'] . ' (' . $lng['panel']['used'] . ')',
-			'c.deactivated' => $lng['admin']['deactivated'],
-			'c.phpenabled' => $lng['admin']['phpenabled']
+			'c.traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')'
 		);

-		if($settings['ticket']['enabled'] == 1)
-		{
-			$fields['c.tickets'] = $lng['customer']['tickets'];
-			$fields['c.tickets_used'] = $lng['customer']['tickets'] . ' (' . $lng['panel']['used'] . ')';
+		if ($settings['system']['backup_enabled'] == '1') {
+			$field['c.backup_allowed'] = $lng['backup_allowed'];
 		}

 		$paging = new paging($userinfo, $db, TABLE_PANEL_CUSTOMERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$customers = '';
-		$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT `c`.*, `a`.`loginname` AS `adminname` " . "FROM `" . TABLE_PANEL_CUSTOMERS . "` `c`, `" . TABLE_PANEL_ADMINS . "` `a` " . "WHERE " . ($userinfo['customers_see_all'] ? '' : " `c`.`adminid` = '" . (int)$userinfo['adminid'] . "' AND ") . "`c`.`adminid`=`a`.`adminid` " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy($settings['panel']['natsorting']) . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng, true);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -96,7 +82,36 @@ if($page == 'customers'
 				$row['traffic'] = round($row['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
 				$row['diskspace_used'] = round($row['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
 				$row['diskspace'] = round($row['diskspace'] / 1024, $settings['panel']['decimal_places']);
-				$row = str_replace_array('-1', 'UL', $row, 'diskspace traffic mysqls emails email_accounts email_forwarders ftps tickets subdomains');
+				$last_login = ((int)$row['lastlogin_succ'] == 0) ? $lng['panel']['neverloggedin'] : date('d.m.Y', $row['lastlogin_succ']);
+
+				/**
+				 * percent-values for progressbar
+				 */
+				//For Disk usage
+				if ($row['diskspace'] > 0) {
+					$disk_percent = round(($row['diskspace_used']*100)/$row['diskspace'], 2);
+					$disk_doublepercent = round($disk_percent*2, 2);
+				} else {
+					$disk_percent = 0;
+					$disk_doublepercent = 0;
+				}
+
+				if ($row['traffic'] > 0) {
+					$traffic_percent = round(($row['traffic_used']*100)/$row['traffic'], 2);
+					$traffic_doublepercent = round($traffic_percent*2, 2);
+				} else {
+					$traffic_percent = 0;
+					$traffic_doublepercent = 0;
+				}
+
+				$islocked = 0;
+				if($row['loginfail_count'] >= $settings['login']['maxloginattempts']
+					&& $row['lastlogin_fail'] > (time() - $settings['login']['deactivatetime'])
+				) {
+					$islocked = 1;
+				}
+
+				$row = str_replace_array('-1', 'UL', $row, 'diskspace traffic mysqls emails email_accounts email_forwarders ftps tickets subdomains email_autoresponder');
 				$row = htmlentities_array($row);
 				eval("\$customers.=\"" . getTemplate("customers/customers_customer") . "\";");
 				$count++;
@@ -105,6 +120,7 @@ if($page == 'customers'
 			$i++;
 		}

+		$customercount = $db->num_rows($result);
 		eval("echo \"" . getTemplate("customers/customers") . "\";");
 	}
 	elseif($action == 'su'
@@ -115,17 +131,45 @@ if($page == 'customers'

 		if($destination_user != '')
 		{
+			if ($result['deactivated'] == '1') {
+				standard_error("usercurrentlydeactivated", $destination_user);
+			}
 			$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "' AND `hash`='" . $db->escape($s) . "'");
 			$s = md5(uniqid(microtime(), 1));
 			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
 			$log->logAction(ADM_ACTION, LOG_INFO, "switched user and is now '" . $destination_user . "'");
-			redirectTo('customer_index.php', Array('s' => $s));
+			redirectTo('customer_index.php', Array('s' => $s), true);
 		}
 		else
 		{
 			redirectTo('index.php', Array('action' => 'login'));
 		}
 	}
+	elseif($action == 'unlock'
+	       && $id != 0)
+	{
+		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$id . "' " . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . $db->escape($userinfo['adminid']) . "' "));
+
+		if($result['loginname'] != '')
+		{
+			if(isset($_POST['send'])
+			   && $_POST['send'] == 'send')
+			{
+				$result = $db->query("UPDATE
+					`" . TABLE_PANEL_CUSTOMERS . "`
+				SET
+					`loginfail_count` = '0'
+				WHERE
+					`customerid`= '" . (int)$id . "'"
+				);
+				redirectTo($filename, Array('page' => $page, 's' => $s));
+			}
+			else
+			{
+				ask_yesno('customer_reallyunlock', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['loginname']);
+			}
+		}
+	}
 	elseif($action == 'delete'
 	       && $id != 0)
 	{
@@ -138,7 +182,6 @@ if($page == 'customers'
 			{
 				$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
 				$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
-				unset($db_root->password);
 				$last_dbserver = 0;

 				while($row_database = $db->fetch_array($databases))
@@ -148,16 +191,20 @@ if($page == 'customers'
 						$db_root->query('FLUSH PRIVILEGES;');
 						$db_root->close();
 						$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
-						unset($db_root->password);
 						$last_dbserver = $row_database['dbserver'];
 					}

-					foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
+					if(mysql_get_server_info() < '5.0.2') {
+						// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
+						$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
+					}
+
+					$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($row_database['databasename']) . "'");
+					while($host = $db_root->fetch_array($host_res))
 					{
-						$mysql_access_host = trim($mysql_access_host);
-						$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-						$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * FROM `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-						$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($row_database['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
+						// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+)
+						$db_root->query('DROP USER \'' . $db_root->escape($row_database['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true);
+						
 					}

 					$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($row_database['databasename']) . '`');
@@ -170,13 +217,39 @@ if($page == 'customers'
 				$db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$id . "'");
 				$domains_deleted = $db->affected_rows();
 				$db->query("DELETE FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$id . "'");
+				$db->query("DELETE FROM `" . TABLE_PANEL_HTACCESS . "` WHERE `customerid`='" . (int)$id . "'");
 				$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$id . "' AND `adminsession` = '0'");
 				$db->query("DELETE FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid`='" . (int)$id . "'");
 				$db->query("DELETE FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid`='" . (int)$id . "'");
 				$db->query("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$id . "'");
+				$result2 = $db->query("SELECT `username` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$id . "'");
+				while($row = $db->fetch_array($result2))
+				{
+					$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name`='" . $row['username'] . "'");
+				}
 				$db->query("DELETE FROM `" . TABLE_FTP_GROUPS . "` WHERE `customerid`='" . (int)$id . "'");
 				$db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$id . "'");
 				$db->query("DELETE FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid`='" . (int)$id . "'");
+
+				// Delete all waiting "create user" -tasks for this user, #276
+				// Note: the WHERE selects part of a serialized array, but it should be safe this way
+				$db->query("DELETE FROM `" . TABLE_PANEL_TASKS . "` WHERE `type` = '2' AND `data` LIKE '%:\"" . $db->escape($result['loginname']) . "\";%';");
+
+				// remove everything APS-related, #216
+				$apsresult = $db->query("SELECT `ID` FROM `".TABLE_APS_INSTANCES."` WHERE `CustomerID`='".(int)$id."'");
+				while($apsrow = $db->fetch_array($apsresult))
+				{
+					// remove all package related settings
+					$db->query("DELETE FROM `".TABLE_APS_SETTINGS."` WHERE `InstanceID` = '".(int)$apsrow['ID']."'");
+					// maybe some leftovers in the tasks
+					$db->query("DELETE FROM `".TABLE_APS_TASKS."` WHERE `InstanceID` = '".(int)$apsrow['ID']."'");
+				}
+				// now remove all user instances
+				$db->query("DELETE FROM `".TABLE_APS_INSTANCES."` WHERE `CustomerID`='".(int)$id."'");
+				// eventually some temp-setting-leftovers
+				$db->query("DELETE FROM `".TABLE_APS_TEMP_SETTINGS."` WHERE `CustomerID`='".(int)$id."'");
+				// eof APS-related removings, #216
+
 				$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` - 1 ";
 				$admin_update_query.= ", `domains_used` = `domains_used` - 0" . (int)($domains_deleted - $result['subdomains_used']);

@@ -205,6 +278,11 @@ if($page == 'customers'
 					$admin_update_query.= ", `email_quota_used` = `email_quota_used` - 0" . (int)$result['email_quota'];
 				}

+				if($result['email_autoresponder'] != '-1')
+				{
+					$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` - 0" . (int)$result['email_autoresponder'];
+				}
+
 				if($result['subdomains'] != '-1')
 				{
 					$admin_update_query.= ", `subdomains_used` = `subdomains_used` - 0" . (int)$result['subdomains'];
@@ -220,6 +298,11 @@ if($page == 'customers'
 					$admin_update_query.= ", `tickets_used` = `tickets_used` - 0" . (int)$result['tickets'];
 				}

+				if($result['aps_packages'] != '-1')
+				{
+					$admin_update_query.= ", `aps_packages_used` = `aps_packages_used` - 0" . (int)$result['aps_packages'];
+				}
+
 				if(($result['diskspace'] / 1024) != '-1')
 				{
 					$admin_update_query.= ", `diskspace_used` = `diskspace_used` - 0" . (int)$result['diskspace'];
@@ -229,14 +312,19 @@ if($page == 'customers'
 				$db->query($admin_update_query);
 				$log->logAction(ADM_ACTION, LOG_INFO, "deleted user '" . $result['loginname'] . "'");
 				inserttask('1');
+
+				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
-				
-				if(isset($_POST['delete_userfiles'])
-				  && (int)$_POST['delete_userfiles'] == 1)
-				{
+
+				if (isset($_POST['delete_userfiles'])
+						&& (int)$_POST['delete_userfiles'] == 1
+				) {
 					inserttask('6', $result['loginname']);
 				}
-				
+
+				// Using filesystem - quota, insert a task which cleans the filesystem - quota
+				inserttask('10');
+
 				/*
 				 * move old tickets to archive
 				 */
@@ -254,8 +342,8 @@ if($page == 'customers'
 						$mainticket->Archive();
 						$log->logAction(ADM_ACTION, LOG_NOTICE, "archived ticket '" . $mainticket->Get('subject') . "'");
 					}
-				}				
-				
+				}
+
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 			else
@@ -284,6 +372,7 @@ if($page == 'customers'
 				$customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di');
 				$def_language = validate($_POST['def_language'], 'default language');
 				$diskspace = intval_ressource($_POST['diskspace']);
+				$gender = intval_ressource($_POST['gender']);

 				if(isset($_POST['diskspace_ul']))
 				{
@@ -339,9 +428,31 @@ if($page == 'customers'
 					$email_quota = - 1;
 				}

-				$email_imap = intval_ressource($_POST['email_imap']);
-				$email_pop3 = intval_ressource($_POST['email_pop3']);
-				$ftps = intval_ressource($_POST['ftps']);
+				if($settings['autoresponder']['autoresponder_active'] == '1')
+				{
+					$email_autoresponder = intval_ressource($_POST['email_autoresponder']);
+
+					if(isset($_POST['email_autoresponder_ul']))
+					{
+						$email_autoresponder = - 1;
+					}
+				}
+				else
+				{
+					$email_autoresponder = 0;
+				}
+
+				$email_imap = 0;
+				if(isset($_POST['email_imap']))
+					$email_imap = intval_ressource($_POST['email_imap']);
+
+				$email_pop3 = 0;
+				if(isset($_POST['email_pop3']))
+					$email_pop3 = intval_ressource($_POST['email_pop3']);
+
+				$ftps = 0;
+				if(isset($_POST['ftps']))
+					$ftps = intval_ressource($_POST['ftps']);

 				if(isset($_POST['ftps_ul']))
 				{
@@ -377,10 +488,47 @@ if($page == 'customers'
 					$number_of_aps_packages = 0;
 				}

-				$createstdsubdomain = intval($_POST['createstdsubdomain']);
-				$password = validate($_POST['customer_password'], 'password');
-				$sendpassword = intval($_POST['sendpassword']);
-				$phpenabled = intval($_POST['phpenabled']);
+				$createstdsubdomain = 0;
+				if(isset($_POST['createstdsubdomain']))
+					$createstdsubdomain = intval($_POST['createstdsubdomain']);
+				$password = validate($_POST['new_customer_password'], 'password');
+				// only check if not empty,
+				// cause empty == generate password automatically
+				if($password != '')
+				{
+					$password = validatePassword($password);
+				}
+
+				$backup_allowed = 0;
+				if(isset($_POST['backup_allowed']))
+					$backup_allowed = intval($_POST['backup_allowed']);
+
+				if ($backup_allowed != 0)
+				{
+					$backup_allowed = 1;
+				}
+
+				// gender out of range? [0,2]
+				if ($gender < 0 || $gender > 2) {
+					$gender = 0;
+				}
+
+				$sendpassword = 0;
+				if(isset($_POST['sendpassword']))
+					$sendpassword = intval($_POST['sendpassword']);
+
+				$phpenabled = 0;
+				if(isset($_POST['phpenabled']))
+					$phpenabled = intval($_POST['phpenabled']);
+
+				$perlenabled = 0;
+				if(isset($_POST['perlenabled']))
+					$perlenabled = intval($_POST['perlenabled']);
+
+				$store_defaultindex = 0;
+				if(isset($_POST['store_defaultindex']))
+					$store_defaultindex = intval($_POST['store_defaultindex']);
+
 				$diskspace = $diskspace * 1024;
 				$traffic = $traffic * 1024 * 1024;

@@ -390,6 +538,7 @@ if($page == 'customers'
 				   || ((($userinfo['email_accounts_used'] + $email_accounts) > $userinfo['email_accounts']) && $userinfo['email_accounts'] != '-1')
 				   || ((($userinfo['email_forwarders_used'] + $email_forwarders) > $userinfo['email_forwarders']) && $userinfo['email_forwarders'] != '-1')
 				   || ((($userinfo['email_quota_used'] + $email_quota) > $userinfo['email_quota']) && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
+				   || ((($userinfo['email_autoresponder_used'] + $email_autoresponder) > $userinfo['email_autoresponder']) && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
 				   || ((($userinfo['ftps_used'] + $ftps) > $userinfo['ftps']) && $userinfo['ftps'] != '-1')
 				   || ((($userinfo['tickets_used'] + $tickets) > $userinfo['tickets']) && $userinfo['tickets'] != '-1')
 				   || ((($userinfo['subdomains_used'] + $subdomains) > $userinfo['subdomains']) && $userinfo['subdomains'] != '-1')
@@ -400,6 +549,7 @@ if($page == 'customers'
 				   || ($email_accounts == '-1' && $userinfo['email_accounts'] != '-1')
 				   || ($email_forwarders == '-1' && $userinfo['email_forwarders'] != '-1')
 				   || ($email_quota == '-1' && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
+				   || ($email_autoresponder == '-1' && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
 				   || ($ftps == '-1' && $userinfo['ftps'] != '-1')
 				   || ($tickets == '-1' && $userinfo['tickets'] != '-1')
 				   || ($subdomains == '-1' && $userinfo['subdomains'] != '-1')
@@ -431,11 +581,11 @@ if($page == 'customers'
 				}
 				else
 				{
-					if(isset($_POST['loginname'])
-					   && $_POST['loginname'] != '')
+					if(isset($_POST['new_loginname'])
+					   && $_POST['new_loginname'] != '')
 					{
 						$accountnumber = intval($settings['system']['lastaccountnumber']);
-						$loginname = validate($_POST['loginname'], 'loginname', '/^[a-z0-9\-_]+$/i');
+						$loginname = validate($_POST['new_loginname'], 'loginname', '/^[a-z0-9\-_]+$/i');

 						// Accounts which match systemaccounts are not allowed, filtering them

@@ -443,6 +593,11 @@ if($page == 'customers'
 						{
 							standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
 						}
+						
+						//Additional filtering for Bug #962
+						if(function_exists('posix_getpwnam') && !in_array("posix_getpwnam",explode(",",ini_get('disable_functions'))) && posix_getpwnam($loginname)) {
+							standard_error('loginnameissystemaccount', $settings['customer']['accountprefix']);
+						}
 					}
 					else
 					{
@@ -483,12 +638,57 @@ if($page == 'customers'
 						$phpenabled = '1';
 					}

+					if($perlenabled != '0')
+					{
+						$perlenabled = '1';
+					}
+
 					if($password == '')
 					{
 						$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
 					}

-					$result = $db->query("INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` (`adminid`, `loginname`, `password`, `name`, `firstname`, `company`, `street`, `zipcode`, `city`, `phone`, `fax`, `email`, `customernumber`, `def_language`, `documentroot`, `guid`, `diskspace`, `traffic`, `subdomains`, `emails`, `email_accounts`, `email_forwarders`, `email_quota`, `ftps`, `tickets`, `mysqls`, `standardsubdomain`, `phpenabled`, `imap`, `pop3`, `aps_packages`)  VALUES ('" . (int)$userinfo['adminid'] . "', '" . $db->escape($loginname) . "', '" . md5($password) . "', '" . $db->escape($name) . "', '" . $db->escape($firstname) . "', '" . $db->escape($company) . "', '" . $db->escape($street) . "', '" . $db->escape($zipcode) . "', '" . $db->escape($city) . "', '" . $db->escape($phone) . "', '" . $db->escape($fax) . "', '" . $db->escape($email) . "', '" . $db->escape($customernumber) . "','" . $db->escape($def_language) . "', '" . $db->escape($documentroot) . "', '" . $db->escape($guid) . "', '" . $db->escape($diskspace) . "', '" . $db->escape($traffic) . "', '" . $db->escape($subdomains) . "', '" . $db->escape($emails) . "', '" . $db->escape($email_accounts) . "', '" . $db->escape($email_forwarders) . "', '" . $db->escape($email_quota) . "', '" . $db->escape($ftps) . "', '" . $db->escape($tickets) . "', '" . $db->escape($mysqls) . "', '0', '" . $db->escape($phpenabled) . "', '" . $db->escape($email_imap) . "', '" . $db->escape($email_pop3) . "', '" . (int)$number_of_aps_packages . "')");
+					$_theme = $settings['panel']['default_theme'];
+
+					$result = $db->query(
+						"INSERT INTO `" . TABLE_PANEL_CUSTOMERS . "` SET
+						`adminid` = '" . (int)$userinfo['adminid'] . "',
+						`loginname` = '" . $db->escape($loginname) . "',
+						`password` = '" . md5($password) . "',
+						`name` = '" . $db->escape($name) . "',
+						`firstname` = '" . $db->escape($firstname) . "',
+						`gender` = '" . (int)$gender . "',
+						`company` = '" . $db->escape($company) . "',
+						`street` = '" . $db->escape($street) . "',
+						`zipcode` = '" . $db->escape($zipcode) . "',
+						`city` = '" . $db->escape($city) . "',
+						`phone` = '" . $db->escape($phone) . "',
+						`fax` = '" . $db->escape($fax) . "',
+						`email` = '" . $db->escape($email) . "',
+						`customernumber` = '" . $db->escape($customernumber) . "',
+						`def_language` = '" . $db->escape($def_language) . "',
+						`documentroot` = '" . $db->escape($documentroot) . "',
+						`guid` = '" . $db->escape($guid) . "',
+						`diskspace` = '" . $db->escape($diskspace) . "',
+						`traffic` = '" . $db->escape($traffic) . "',
+						`subdomains` = '" . $db->escape($subdomains) . "',
+						`emails` = '" . $db->escape($emails) . "',
+						`email_accounts` = '" . $db->escape($email_accounts) . "',
+						`email_forwarders` = '" . $db->escape($email_forwarders) . "',
+						`email_quota` = '" . $db->escape($email_quota) . "',
+						`ftps` = '" . $db->escape($ftps) . "',
+						`tickets` = '" . $db->escape($tickets) . "',
+						`mysqls` = '" . $db->escape($mysqls) . "',
+						`standardsubdomain` = '0',
+						`phpenabled` = '" . $db->escape($phpenabled) . "',
+						`imap` = '" . $db->escape($email_imap) . "',
+						`pop3` = '" . $db->escape($email_pop3) . "',
+						`aps_packages` = '" . (int)$number_of_aps_packages . "',
+						`perlenabled` = '" . $db->escape($perlenabled) . "',
+						`email_autoresponder` = '" . $db->escape($email_autoresponder) . "',
+						`backup_allowed` = '" . $db->escape($backup_allowed) . "',
+						`theme` = '" . $db->escape($_theme) . "'"
+					);
 					$customerid = $db->insert_id();
 					$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` + 1";

@@ -517,6 +717,12 @@ if($page == 'customers'
 						$admin_update_query.= ", `email_quota_used` = `email_quota_used` + 0" . (int)$email_quota;
 					}

+					if($email_autoresponder != '-1'
+						&& $settings['autoresponder']['autoresponder_active'] == 1)
+					{
+						$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` + 0" . (int)$email_autoresponder;
+					}
+
 					if($subdomains != '-1')
 					{
 						$admin_update_query.= ", `subdomains_used` = `subdomains_used` + 0" . (int)$subdomains;
@@ -553,10 +759,12 @@ if($page == 'customers'
 					}

 					$log->logAction(ADM_ACTION, LOG_INFO, "added user '" . $loginname . "'");
-					inserttask('2', $loginname, $guid, $guid);
+					inserttask('2', $loginname, $guid, $guid, $store_defaultindex);
+
+					// Using filesystem - quota, insert a task which cleans the filesystem - quota
+					inserttask('10');

 					// Add htpasswd for the webalizer stats
-
 					if(CRYPT_STD_DES == 1)
 					{
 						$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
@@ -567,37 +775,56 @@ if($page == 'customers'
 						$htpasswdPassword = crypt($password);
 					}

-					$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` " . "(`customerid`, `username`, `password`, `path`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($htpasswdPassword) . "', '" . $db->escape(makeCorrectDir($documentroot . '/webalizer/')) . "')");
-					$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added webalizer htpasswd for user '" . $loginname . "'");
-
 					if($settings['system']['awstats_enabled'] == '1')
 					{
 						$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` " . "(`customerid`, `username`, `password`, `path`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($htpasswdPassword) . "', '" . $db->escape(makeCorrectDir($documentroot . '/awstats/')) . "')");
 						$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added awstats htpasswd for user '" . $loginname . "'");
 					}
+					else
+					{
+						$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` " . "(`customerid`, `username`, `password`, `path`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($htpasswdPassword) . "', '" . $db->escape(makeCorrectDir($documentroot . '/webalizer/')) . "')");
+						$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added webalizer htpasswd for user '" . $loginname . "'");
+					}

 					inserttask('1');
-					$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
+					$cryptPassword = makeCryptPassword($password);
+					$result = $db->query("INSERT INTO `" . TABLE_FTP_USERS . "` " . "(`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($documentroot) . "', 'y', '" . (int)$guid . "', '" . (int)$guid . "')");
 					$result = $db->query("INSERT INTO `" . TABLE_FTP_GROUPS . "` " . "(`customerid`, `groupname`, `gid`, `members`) " . "VALUES ('" . (int)$customerid . "', '" . $db->escape($loginname) . "', '" . $db->escape($guid) . "', '" . $db->escape($loginname) . "')");
+					$result = $db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($loginname) . "', 'user', '0', '0', '0', '0', '0', '0')");
 					$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added ftp-account for user '" . $loginname . "'");

 					if($createstdsubdomain == '1')
 					{
-						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET " . 
-							"`domain` = '". $db->escape($loginname . '.' . $settings['system']['hostname']) . "', " .
+						if (isset($settings['system']['stdsubdomain'])
+							&& $settings['system']['stdsubdomain'] != ''
+						) {
+							$_stdsubdomain = $loginname . '.' . $settings['system']['stdsubdomain'];
+						}
+						else
+						{
+							$_stdsubdomain = $loginname . '.' . $settings['system']['hostname'];
+						}
+
+						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET " .
+							"`domain` = '". $db->escape($_stdsubdomain) . "', " .
 							"`customerid` = '" . (int)$customerid . "', " .
-							"`adminid` = '" . (int)$userinfo['adminid'] . "', " . 
+							"`adminid` = '" . (int)$userinfo['adminid'] . "', " .
 							"`parentdomainid` = '-1', " .
-							"`ipandport` = '" . $db->escape($settings['system']['defaultip']) . "', " . 
-							"`documentroot` = '" . $db->escape($documentroot) . "', " . 
+							"`documentroot` = '" . $db->escape($documentroot) . "', " .
 							"`zonefile` = '', " .
 							"`isemaildomain` = '0', " .
-							"`caneditdomain` = '0', " . 
+							"`caneditdomain` = '0', " .
 							"`openbasedir` = '1', " .
-							"`safemode` = '1', " .
 							"`speciallogfile` = '0', " .
-							"`specialsettings` = ''");
+							"`specialsettings` = '', " .
+							"`add_date` = '".date('Y-m-d')."'");
 						$domainid = $db->insert_id();
+						// set ip <-> domain connection
+						$db->query("INSERT INTO `".TABLE_DOMAINTOIP."` SET
+							`id_domain` = '".$domainid."',
+							`id_ipandports` = '".(int)$settings['system']['defaultip']."'"
+						);
+
 						$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$customerid . '\'');
 						$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $loginname . "'");
 						inserttask('1');
@@ -608,7 +835,6 @@ if($page == 'customers'
 						$replace_arr = array(
 							'FIRSTNAME' => $firstname,
 							'NAME' => $name,
-							'TITLE' => $title,
 							'COMPANY' => $company,
 							'SALUTATION' => getCorrectUserSalutation(array('firstname' => $firstname, 'name' => $name, 'company' => $company)),
 							'USERNAME' => $loginname,
@@ -655,7 +881,7 @@ if($page == 'customers'

 				while(list($language_file, $language_name) = each($languages))
 				{
-					$language_options.= makeoption($language_name, $language_file, $userinfo['def_language'], true);
+					$language_options.= makeoption($language_name, $language_file, $settings['panel']['standardlanguage'], true);
 				}

 				$diskspace_ul = makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
@@ -665,15 +891,22 @@ if($page == 'customers'
 				$email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
+				$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
 				$number_of_aps_packages_ul = makecheckbox('number_of_aps_packages_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
-				$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', '1');
-				$email_imap = makeyesno('email_imap', '1', '0', '1');
-				$email_pop3 = makeyesno('email_pop3', '1', '0', '1');
-				$sendpassword = makeyesno('sendpassword', '1', '0', '1');
-				$phpenabled = makeyesno('phpenabled', '1', '0', '1');
+
+				$gender_options = makeoption($lng['gender']['undef'], 0, true, true, true);
+				$gender_options .= makeoption($lng['gender']['male'], 1, null, true, true);
+				$gender_options .= makeoption($lng['gender']['female'], 2, null, true, true);
+
+				$customer_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_add.php';
+				$customer_add_form = htmlform::genHTMLForm($customer_add_data);
+
+				$title = $customer_add_data['customer_add']['title'];
+				$image = $customer_add_data['customer_add']['image'];
+
 				eval("echo \"" . getTemplate("customers/customers_add") . "\";");
 			}
 		}
@@ -699,8 +932,9 @@ if($page == 'customers'
 				$email = $idna_convert->encode(validate($_POST['email'], 'email'));
 				$customernumber = validate($_POST['customernumber'], 'customer number', '/^[A-Za-z0-9 \-]*$/Di');
 				$def_language = validate($_POST['def_language'], 'default language');
-				$password = validate($_POST['customer_password'], 'new password');
+				$password = validate($_POST['new_customer_password'], 'new password');
 				$diskspace = intval_ressource($_POST['diskspace']);
+				$gender = intval_ressource($_POST['gender']);

 				if(isset($_POST['diskspace_ul']))
 				{
@@ -756,9 +990,31 @@ if($page == 'customers'
 					$email_quota = - 1;
 				}

-				$email_imap = intval_ressource($_POST['email_imap']);
-				$email_pop3 = intval_ressource($_POST['email_pop3']);
-				$ftps = intval_ressource($_POST['ftps']);
+				if($settings['autoresponder']['autoresponder_active'] == '1')
+				{
+					$email_autoresponder = intval_ressource($_POST['email_autoresponder']);
+
+					if(isset($_POST['email_autoresponder_ul']))
+					{
+						$email_autoresponder = - 1;
+					}
+				}
+				else
+				{
+					$email_autoresponder = 0;
+				}
+
+				$email_imap = 0;
+				if(isset($_POST['email_imap']))
+					$email_imap = intval_ressource($_POST['email_imap']);
+
+				$email_pop3 = 0;
+				if(isset($_POST['email_pop3']))
+					$email_pop3 = intval_ressource($_POST['email_pop3']);
+
+				$ftps = 0;
+				if(isset($_POST['ftps']))
+					$ftps = intval_ressource($_POST['ftps']);

 				if(isset($_POST['ftps_ul']))
 				{
@@ -773,7 +1029,22 @@ if($page == 'customers'
 					$tickets = - 1;
 				}

-				$mysqls = intval_ressource($_POST['mysqls']);
+				$backup_allowed = 0;
+				if (isset($_POST['backup_allowed']))
+					$backup_allowed = intval($_POST['backup_allowed']);
+
+				if($backup_allowed != '0'){
+					$backup_allowed = 1;
+				}
+
+				// gender out of range? [0,2]
+				if ($gender < 0 || $gender > 2) {
+					$gender = 0;
+				}
+
+				$mysqls = 0;
+				if(isset($_POST['mysqls']))
+					$mysqls = intval_ressource($_POST['mysqls']);

 				if(isset($_POST['mysqls_ul']))
 				{
@@ -781,7 +1052,7 @@ if($page == 'customers'
 				}

 				if($settings['aps']['aps_active'] == '1')
-				{				
+				{
 					$number_of_aps_packages = intval_ressource($_POST['number_of_aps_packages']);

 					if(isset($_POST['number_of_aps_packages_ul']))
@@ -794,9 +1065,21 @@ if($page == 'customers'
 					$number_of_aps_packages = 0;
 				}

-				$createstdsubdomain = intval($_POST['createstdsubdomain']);
-				$deactivated = intval($_POST['deactivated']);
-				$phpenabled = intval($_POST['phpenabled']);
+				$createstdsubdomain = 0;
+				if(isset($_POST['createstdsubdomain']))
+					$createstdsubdomain = intval($_POST['createstdsubdomain']);
+
+				$deactivated = 0;
+				if(isset($_POST['deactivated']))
+					$deactivated = intval($_POST['deactivated']);
+
+				$phpenabled = 0;
+				if(isset($_POST['phpenabled']))
+					$phpenabled = intval($_POST['phpenabled']);
+
+				$perlenabled = 0;
+				if(isset($_POST['perlenabled']))
+					$perlenabled = intval($_POST['perlenabled']);
 				$diskspace = $diskspace * 1024;
 				$traffic = $traffic * 1024 * 1024;

@@ -806,6 +1089,7 @@ if($page == 'customers'
 				   || ((($userinfo['email_accounts_used'] + $email_accounts - $result['email_accounts']) > $userinfo['email_accounts']) && $userinfo['email_accounts'] != '-1')
 				   || ((($userinfo['email_forwarders_used'] + $email_forwarders - $result['email_forwarders']) > $userinfo['email_forwarders']) && $userinfo['email_forwarders'] != '-1')
 				   || ((($userinfo['email_quota_used'] + $email_quota - $result['email_quota']) > $userinfo['email_quota']) && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
+				   || ((($userinfo['email_autoresponder_used'] + $email_autoresponder - $result['email_autoresponder']) > $userinfo['email_autoresponder']) && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
 				   || ((($userinfo['ftps_used'] + $ftps - $result['ftps']) > $userinfo['ftps']) && $userinfo['ftps'] != '-1')
 				   || ((($userinfo['tickets_used'] + $tickets - $result['tickets']) > $userinfo['tickets']) && $userinfo['tickets'] != '-1')
 				   || ((($userinfo['subdomains_used'] + $subdomains - $result['subdomains']) > $userinfo['subdomains']) && $userinfo['subdomains'] != '-1')
@@ -816,6 +1100,7 @@ if($page == 'customers'
 				   || ($email_accounts == '-1' && $userinfo['email_accounts'] != '-1')
 				   || ($email_forwarders == '-1' && $userinfo['email_forwarders'] != '-1')
 				   || ($email_quota == '-1' && $userinfo['email_quota'] != '-1' && $settings['system']['mail_quota_enabled'] == '1')
+				   || ($email_autoresponder == '-1' && $userinfo['email_autoresponder'] != '-1' && $settings['autoresponder']['autoresponder_active'] == '1')
 				   || ($ftps == '-1' && $userinfo['ftps'] != '-1')
 				   || ($tickets == '-1' && $userinfo['tickets'] != '-1')
 				   || ($subdomains == '-1' && $userinfo['subdomains'] != '-1')
@@ -849,6 +1134,7 @@ if($page == 'customers'
 				{
 					if($password != '')
 					{
+						$password = validatePassword($password);
 						$password = md5($password);
 					}
 					else
@@ -864,9 +1150,40 @@ if($page == 'customers'
 					if($createstdsubdomain == '1'
 					   && $result['standardsubdomain'] == '0')
 					{
-						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` " . "(`domain`, `customerid`, `adminid`, `parentdomainid`, `ipandport`, `documentroot`, `zonefile`, `isemaildomain`, `caneditdomain`, `openbasedir`, `safemode`, `speciallogfile`, `specialsettings`) " . "VALUES ('" . $db->escape($result['loginname'] . '.' . $settings['system']['hostname']) . "', '" . (int)$result['customerid'] . "', '" . (int)$userinfo['adminid'] . "', '-1', '" . $db->escape($settings['system']['defaultip']) . "', '" . $db->escape($result['documentroot']) . "', '', '0', '0', '1', '1', '0', '')");
+						if (isset($settings['system']['stdsubdomain'])
+							&& $settings['system']['stdsubdomain'] != ''
+						) {
+							$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['stdsubdomain'];
+						}
+						else
+						{
+							$_stdsubdomain = $result['loginname'] . '.' . $settings['system']['hostname'];
+						}
+
+						$db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET
+							`domain` = '" . $db->escape($_stdsubdomain) . "',
+							`customerid` = '" . (int)$result['customerid'] . "',
+							`adminid` = '" . (int)$userinfo['adminid'] . "',
+							`parentdomainid` = '-1',
+							`documentroot` = '" . $db->escape($result['documentroot']) . "',
+							`zonefile` = '',
+							`isemaildomain` = '0',
+							`caneditdomain` = '0',
+							`openbasedir` = '1',
+							`speciallogfile` = '0',
+							`specialsettings` = '',
+							`add_date` = '".date('Y-m-d')."'"
+						);
 						$domainid = $db->insert_id();
-						$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'' . (int)$domainid . '\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
+						// set ip <-> domain connection
+						$db->query("INSERT INTO `".TABLE_DOMAINTOIP."` SET
+							`id_domain` = '".$domainid."',
+							`id_ipandports` = '".(int)$settings['system']['defaultip']."'"
+						);
+						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET
+							`standardsubdomain`='" . (int)$domainid . "'
+							 WHERE `customerid`='" . (int)$result['customerid'] . "'"
+						);
 						$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically added standardsubdomain for user '" . $result['loginname'] . "'");
 						inserttask('1');
 					}
@@ -874,8 +1191,12 @@ if($page == 'customers'
 					if($createstdsubdomain == '0'
 					   && $result['standardsubdomain'] != '0')
 					{
-						$db->query('DELETE FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `id`=\'' . (int)$result['standardsubdomain'] . '\'');
-						$db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `standardsubdomain`=\'0\' WHERE `customerid`=\'' . (int)$result['customerid'] . '\'');
+						$db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "`
+							WHERE `id`='" . (int)$result['standardsubdomain'] . "'");
+						$db->query("DELETE FROM `" . TABLE_DOMAINTOIP . "`
+							WHERE `id_domain`='" . (int)$result['standardsubdomain'] . "'");
+						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET
+							`standardsubdomain`= '0' WHERE `customerid`= '" . (int)$result['customerid'] . "'");
 						$log->logAction(ADM_ACTION, LOG_NOTICE, "automatically deleted standardsubdomain for user '" . $result['loginname'] . "'");
 						inserttask('1');
 					}
@@ -890,16 +1211,61 @@ if($page == 'customers'
 						$phpenabled = '1';
 					}

-					if($phpenabled != $result['phpenabled'])
+					if($perlenabled != '0')
+					{
+						$perlenabled = '1';
+					}
+
+					if($phpenabled != $result['phpenabled']
+						|| $perlenabled != $result['perlenabled'])
 					{
 						inserttask('1');
 					}

 					if($deactivated != $result['deactivated'])
 					{
-						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : '1') . "', `imap`='" . (($deactivated) ? '0' : '1') . "' WHERE `customerid`='" . (int)$id . "'");
+						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `postfix`='" . (($deactivated) ? 'N' : 'Y') . "', `pop3`='" . (($deactivated) ? '0' : (int)$result['pop3']) . "', `imap`='" . (($deactivated) ? '0' : (int)$result['imap']) . "' WHERE `customerid`='" . (int)$id . "'");
 						$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `login_enabled`='" . (($deactivated) ? 'N' : 'Y') . "' WHERE `customerid`='" . (int)$id . "'");
 						$db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `deactivated`='" . (int)$deactivated . "' WHERE `customerid`='" . (int)$id . "'");
+
+						/* Retrieve customer's databases */
+						$databases = $db->query("SELECT * FROM " . TABLE_PANEL_DATABASES . " WHERE customerid='" . (int)$id . "' ORDER BY `dbserver`");
+						$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
+						$last_dbserver = 0;
+
+						/* For each of them */
+						while($row_database = $db->fetch_array($databases))
+						{
+							if($last_dbserver != $row_database['dbserver'])
+							{
+								$db_root->query('FLUSH PRIVILEGES;');
+								$db_root->close();
+								$db_root = new db($sql_root[$row_database['dbserver']]['host'], $sql_root[$row_database['dbserver']]['user'], $sql_root[$row_database['dbserver']]['password'], '');
+								$last_dbserver = $row_database['dbserver'];
+							}
+
+							foreach(array_unique(explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
+							{
+								$mysql_access_host = trim($mysql_access_host);
+
+								/* Prevent access, if deactivated */
+								if($deactivated)
+								{
+									// failsafe if user has been deleted manually (requires MySQL 4.1.2+)
+									$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($row_database['databasename']) .'\'',false,true);
+								}
+								else /* Otherwise grant access */
+								{
+									$db_root->query('GRANT ALL PRIVILEGES ON `' . $db_root->escape($row_database['databasename']) .'`.* TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
+									$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($row_database['databasename'])) . '` . * TO `' . $db_root->escape($row_database['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
+								}
+							}
+						}
+
+						/* At last flush the new privileges */
+						$db_root->query('FLUSH PRIVILEGES;');
+						$db_root->close();
+
 						$log->logAction(ADM_ACTION, LOG_INFO, "deactivated user '" . $result['loginname'] . "'");
 						inserttask('1');
 					}
@@ -918,9 +1284,13 @@ if($page == 'customers'
 						$db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET `imap`='" . (int)$email_imap . "' WHERE `customerid`='" . (int)$id . "'");
 					}

-					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "' WHERE `customerid`='" . (int)$id . "'");
+					// $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "' WHERE `customerid`='" . (int)$id . "'");
+					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `name`='" . $db->escape($name) . "', `firstname`='" . $db->escape($firstname) . "', `gender`='" . $db->escape($gender) . "', `company`='" . $db->escape($company) . "', `street`='" . $db->escape($street) . "', `zipcode`='" . $db->escape($zipcode) . "', `city`='" . $db->escape($city) . "', `phone`='" . $db->escape($phone) . "', `fax`='" . $db->escape($fax) . "', `email`='" . $db->escape($email) . "', `customernumber`='" . $db->escape($customernumber) . "', `def_language`='" . $db->escape($def_language) . "', `password` = '" . $password . "', `diskspace`='" . $db->escape($diskspace) . "', `traffic`='" . $db->escape($traffic) . "', `subdomains`='" . $db->escape($subdomains) . "', `emails`='" . $db->escape($emails) . "', `email_accounts` = '" . $db->escape($email_accounts) . "', `email_forwarders`='" . $db->escape($email_forwarders) . "', `ftps`='" . $db->escape($ftps) . "', `tickets`='" . $db->escape($tickets) . "', `mysqls`='" . $db->escape($mysqls) . "', `deactivated`='" . $db->escape($deactivated) . "', `phpenabled`='" . $db->escape($phpenabled) . "', `email_quota`='" . $db->escape($email_quota) . "', `imap`='" . $db->escape($email_imap) . "', `pop3`='" . $db->escape($email_pop3) . "', `aps_packages`='" . (int)$number_of_aps_packages . "', `perlenabled`='" . $db->escape($perlenabled) . "', `email_autoresponder`='" . $db->escape($email_autoresponder) . "', `backup_allowed`='" . $db->escape($backup_allowed) . "' WHERE `customerid`='" . (int)$id . "'");
 					$admin_update_query = "UPDATE `" . TABLE_PANEL_ADMINS . "` SET `customers_used` = `customers_used` ";

+					// Using filesystem - quota, insert a task which cleans the filesystem - quota
+					inserttask('10');
+
 					if($mysqls != '-1'
 					   || $result['mysqls'] != '-1')
 					{
@@ -1001,6 +1371,22 @@ if($page == 'customers'
 						}
 					}

+					if($email_autoresponder != '-1'
+					   || $result['email_autoresponder'] != '-1')
+					{
+						$admin_update_query.= ", `email_autoresponder_used` = `email_autoresponder_used` ";
+
+						if($email_autoresponder != '-1')
+						{
+							$admin_update_query.= " + 0" . (int)$email_autoresponder . " ";
+						}
+
+						if($result['email_autoresponder'] != '-1')
+						{
+							$admin_update_query.= " - 0" . (int)$result['email_autoresponder'] . " ";
+						}
+					}
+
 					if($subdomains != '-1'
 					   || $result['subdomains'] != '-1')
 					{
@@ -1153,6 +1539,13 @@ if($page == 'customers'
 					$result['email_quota'] = '';
 				}

+				$email_autoresponder_ul = makecheckbox('email_autoresponder_ul', $lng['customer']['unlimited'], '-1', false, $result['email_autoresponder'], true, true);
+
+				if($result['email_autoresponder'] == '-1')
+				{
+					$result['email_autoresponder'] = '';
+				}
+
 				$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true);

 				if($result['ftps'] == '-1')
@@ -1181,13 +1574,18 @@ if($page == 'customers'
 					$result['aps_packages'] = '';
 				}

-				$createstdsubdomain = makeyesno('createstdsubdomain', '1', '0', (($result['standardsubdomain'] != '0') ? '1' : '0'));
-				$phpenabled = makeyesno('phpenabled', '1', '0', $result['phpenabled']);
-				$deactivated = makeyesno('deactivated', '1', '0', $result['deactivated']);
-				$email_imap = makeyesno('email_imap', '1', '0', $result['imap']);
-				$email_pop3 = makeyesno('email_pop3', '1', '0', $result['pop3']);
-
 				$result = htmlentities_array($result);
+
+				$gender_options = makeoption($lng['gender']['undef'], 0, ($result['gender'] == '0' ? true : false), true, true);
+				$gender_options .= makeoption($lng['gender']['male'], 1, ($result['gender'] == '1' ? true : false), true, true);
+				$gender_options .= makeoption($lng['gender']['female'], 2, ($result['gender'] == '2' ? true : false), true, true);
+
+				$customer_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/customer/formfield.customer_edit.php';
+				$customer_edit_form = htmlform::genHTMLForm($customer_edit_data);
+
+				$title = $customer_edit_data['customer_edit']['title'];
+				$image = $customer_edit_data['customer_edit']['image'];
+
 				eval("echo \"" . getTemplate("customers/customers_edit") . "\";");
 			}
 		}
--- a/admin_domains.php
+++ b/admin_domains.php
--- a/admin_index.php
+++ b/admin_index.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -61,6 +61,7 @@ if($page == 'overview')
 				SUM(`email_accounts_used`) AS `email_accounts_used`,
 				SUM(`email_forwarders_used`) AS `email_forwarders_used`,
 				SUM(`email_quota_used`) AS `email_quota_used`,
+				SUM(`email_autoresponder_used`) AS `email_autoresponder_used`,
 				SUM(`ftps_used`) AS `ftps_used`,
 				SUM(`tickets_used`) AS `tickets_used`,
 				SUM(`subdomains_used`) AS `subdomains_used`,
@@ -100,14 +101,16 @@ if($page == 'overview')
 				&& count($latestversion) >= 1)
 				{
 					$_version = $latestversion[0];
-					$_message = $latestversion[1];
+					$_message = isset($latestversion[1]) ? $latestversion[1] : '';
 					$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');

-					$lookfornewversion_lable = $_version;
+					// add the branding so debian guys are not gettings confused
+					// about their version-number
+					$lookfornewversion_lable = $_version.$branding;
 					$lookfornewversion_link = $_link;
 					$lookfornewversion_addinfo = $_message;
-					
-					if (version_compare($version, $_version) == -1) {
+
+					if (version_compare2($version, $_version) == -1) {
 						$isnewerversion = 1;
 					} else {
 						$isnewerversion = 0;
@@ -140,7 +143,7 @@ if($page == 'overview')
 	$userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
 	$userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
 	$userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']);
-	$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps tickets subdomains aps_packages');
+	$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps tickets subdomains aps_packages');

 	$cron_last_runs = getCronjobsLastRun();
 	$outstanding_tasks = getOutstandingTasks();
@@ -185,7 +188,7 @@ if($page == 'overview')
 	}

 	// Try to get the uptime
-	// First: With exec (let's hope it's enabled for the SysCP - vHost)
+	// First: With exec (let's hope it's enabled for the Froxlor - vHost)

 	$uptime_array = explode(" ", @file_get_contents("/proc/uptime"));

@@ -281,13 +284,47 @@ elseif($page == 'change_language')
 	{
 		$language_options = '';

+		$default_lang = $settings['panel']['standardlanguage'];
+		if($userinfo['def_language'] != '') {
+			$default_lang = $userinfo['def_language'];
+		}
+
 		while(list($language_file, $language_name) = each($languages))
 		{
-			$language_options.= makeoption($language_name, $language_file, $userinfo['def_language'], true);
+			$language_options.= makeoption($language_name, $language_file, $default_lang, true);
 		}

 		eval("echo \"" . getTemplate("index/change_language") . "\";");
 	}
 }
+elseif($page == 'change_theme')
+{
+	if(isset($_POST['send'])
+		&& $_POST['send'] == 'send'
+	) {
+		$theme = validate($_POST['theme'], 'theme');

-?>
+		$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `adminid`='" . (int)$userinfo['adminid'] . "'");
+		$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
+
+		$log->logAction(ADM_ACTION, LOG_NOTICE, "changed his/her theme to '" . $theme . "'");
+		redirectTo($filename, Array('s' => $s));
+	}
+	else
+	{
+		$theme_options = '';
+
+		$default_theme = $settings['panel']['default_theme'];
+		if($userinfo['theme'] != '') {
+			$default_theme = $userinfo['theme'];
+		}
+
+		$themes_avail = getThemes();
+		foreach($themes_avail as $t)
+		{
+			$theme_options.= makeoption($t, $t, $default_theme, true);
+		}
+
+		eval("echo \"" . getTemplate("index/change_theme") . "\";");
+	}
+}
--- a/admin_ipsandports.php
+++ b/admin_ipsandports.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -83,7 +83,7 @@ if($page == 'ipsandports'
 		if(isset($result['id'])
 		   && $result['id'] == $id)
 		{
-			$result_checkdomain = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `ipandport`='" . (int)$id . "'");
+			$result_checkdomain = $db->query_first("SELECT `id_domain` as `id` FROM `" . TABLE_DOMAINTOIP . "` WHERE `id_ipandports`='" . (int)$id . "'");

 			if($result_checkdomain['id'] == '')
 			{
@@ -102,9 +102,16 @@ if($page == 'ipsandports'
 							   && $_POST['send'] == 'send')
 							{
 								$db->query("DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id`='" . (int)$id . "'");
+
+								// also, remove connections to domains (multi-stack)
+								$db->query("DELETE FROM `".TABLE_DOMAINTOIP."` WHERE `id_ipandports`='".(int)$id."'");
+
 								$log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'");
 								inserttask('1');
+
+								// Using nameserver, insert a task which rebuilds the server config
 								inserttask('4');
+
 								redirectTo($filename, Array('page' => $page, 's' => $s));
 							}
 							else
@@ -136,16 +143,27 @@ if($page == 'ipsandports'
 		{
 			$ip = validate_ip($_POST['ip']);
 			$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
-			$listen_statement = intval($_POST['listen_statement']);
-			$namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
-			$vhostcontainer = intval($_POST['vhostcontainer']);
+			$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
+			$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
+			$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
 			$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
-			$vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
-			$ssl = intval($_POST['ssl']);
-			$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
-			$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
-			$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
+			$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
 			$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
+			$docroot = validate($_POST['docroot'], 'docroot');
+			if((int)$settings['system']['use_ssl'] == 1)
+			{
+				$ssl = intval($_POST['ssl']);
+				$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
+				$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
+				$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
+				$ssl_cert_chainfile = validate($_POST['ssl_cert_chainfile'], 'ssl_cert_chainfile');
+			} else {
+				$ssl = 0;
+				$ssl_cert_file = '';
+				$ssl_key_file = '';
+				$ssl_ca_file = '';
+				$ssl_cert_chainfile = '';
+			}
 			
 			if($listen_statement != '1')
 			{
@@ -187,6 +205,20 @@ if($page == 'ipsandports'
 				$ssl_ca_file = makeCorrectFile($ssl_ca_file);
 			}

+			if($ssl_cert_chainfile != '')
+			{
+				$ssl_cert_chainfile = makeCorrectFile($ssl_cert_chainfile);
+			}
+
+			if(strlen(trim($docroot)) > 0)
+			{
+				$docroot = makeCorrectDir($docroot);
+			}
+			else
+			{
+				$docroot = '';
+			}
+
 			$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");

 			if($result_checkfordouble['id'] != '')
@@ -195,7 +227,23 @@ if($page == 'ipsandports'
 			}
 			else
 			{
-				$db->query("INSERT INTO `" . TABLE_PANEL_IPSANDPORTS . "` (`ip`, `port`, `listen_statement`, `namevirtualhost_statement`, `vhostcontainer`, `vhostcontainer_servername_statement`, `specialsettings`, `ssl`, `ssl_cert_file`, `ssl_key_file`, `ssl_ca_file`, `default_vhostconf_domain`) VALUES ('" . $db->escape($ip) . "', '" . (int)$port . "', '" . (int)$listen_statement . "', '" . (int)$namevirtualhost_statement . "', '" . (int)$vhostcontainer . "', '" . (int)$vhostcontainer_servername_statement . "', '" . $db->escape($specialsettings) . "', '" . (int)$ssl . "', '" . $db->escape($ssl_cert_file) . "', '" . $db->escape($ssl_key_file) . "', '" . $db->escape($ssl_ca_file) . "', '" . $db->escape($default_vhostconf_domain) . "')");
+				$db->query("INSERT INTO `" . TABLE_PANEL_IPSANDPORTS . "`
+					SET 
+						`ip` = '" . $db->escape($ip) . "', 
+						`port` = '" . (int)$port . "', 
+						`listen_statement` = '" . (int)$listen_statement . "', 
+						`namevirtualhost_statement` = '" . (int)$namevirtualhost_statement . "', 
+						`vhostcontainer` = '" . (int)$vhostcontainer . "', 
+						`vhostcontainer_servername_statement` = '" . (int)$vhostcontainer_servername_statement . "', 
+						`specialsettings` = '" . $db->escape($specialsettings) . "', 
+						`ssl` = '" . (int)$ssl . "', 
+						`ssl_cert_file` = '" . $db->escape($ssl_cert_file) . "', 
+						`ssl_key_file` = '" . $db->escape($ssl_key_file) . "', 
+						`ssl_ca_file` = '" . $db->escape($ssl_ca_file) . "',
+						`ssl_cert_chainfile` = '" . $db->escape($ssl_cert_chainfile) . "', 
+						`default_vhostconf_domain` = '" . $db->escape($default_vhostconf_domain) . "',
+						`docroot` = '" . $db->escape($docroot) . "';
+					");

 				if(filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6))
 				{
@@ -204,17 +252,29 @@ if($page == 'ipsandports'

 				$log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'");
 				inserttask('1');
+
+				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
+
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 		}
 		else
 		{
+			/*
 			$enable_ssl = makeyesno('ssl', '1', '0', '0');
 			$listen_statement = makeyesno('listen_statement', '1', '0', '1');
 			$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', '1');
 			$vhostcontainer = makeyesno('vhostcontainer', '1', '0', '1');
 			$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', '1');
+			*/
+
+			$ipsandports_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_add.php';
+			$ipsandports_add_form = htmlform::genHTMLForm($ipsandports_add_data);
+
+			$title = $ipsandports_add_data['ipsandports_add']['title'];
+			$image = $ipsandports_add_data['ipsandports_add']['image'];
+
 			eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";");
 		}
 	}
@@ -232,16 +292,34 @@ if($page == 'ipsandports'
 				$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
 				$result_checkfordouble = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($ip) . "' AND `port`='" . (int)$port . "'");
 				$result_sameipotherport = $db->query_first("SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `ip`='" . $db->escape($result['ip']) . "' AND `id`!='" . (int)$id . "'");
-				$listen_statement = intval($_POST['listen_statement']);
-				$namevirtualhost_statement = intval($_POST['namevirtualhost_statement']);
-				$vhostcontainer = intval($_POST['vhostcontainer']);
+				$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
+				$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
+				$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
 				$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
-				$vhostcontainer_servername_statement = intval($_POST['vhostcontainer_servername_statement']);
-				$ssl = intval($_POST['ssl']);
-				$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
-				$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
-				$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
+				$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
 				$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
+				$docroot =  validate($_POST['docroot'], 'docroot');
+
+				if((int)$settings['system']['use_ssl'] == 1
+					/* 
+					 * check here if ssl is even checked, cause if not, we don't need
+					 * to validate and set all the $ssl_*_file vars
+					 */
+					&& isset($_POST['ssl'])
+					&& $_POST['ssl'] != 0
+				) {
+					$ssl = 1;
+					$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
+					$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
+					$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
+					$ssl_cert_chainfile = validate($_POST['ssl_cert_chainfile'], 'ssl_cert_chainfile');
+				} else {
+					$ssl = 0;
+					$ssl_cert_file = '';
+					$ssl_key_file = '';
+					$ssl_ca_file = '';
+					$ssl_cert_chainfile = '';
+				}
 				
 				if($listen_statement != '1')
 				{
@@ -283,6 +361,20 @@ if($page == 'ipsandports'
 					$ssl_ca_file = makeCorrectFile($ssl_ca_file);
 				}

+				if($ssl_cert_chainfile != '')
+				{
+					$ssl_cert_chainfile = makeCorrectFile($ssl_cert_chainfile);
+				}
+
+				if(strlen(trim($docroot)) > 0)
+				{
+					$docroot = makeCorrectDir($docroot);
+				}
+				else
+				{
+					$docroot = '';
+				}
+
 				if($result['ip'] != $ip
 				   && $result['ip'] == $settings['system']['ipaddress']
 				   && $result_sameipotherport['id'] == '')
@@ -296,21 +388,52 @@ if($page == 'ipsandports'
 				}
 				else
 				{
-					$db->query("UPDATE `" . TABLE_PANEL_IPSANDPORTS . "` SET `ip`='" . $db->escape($ip) . "', `port`='" . (int)$port . "', `listen_statement`='" . (int)$listen_statement . "', `namevirtualhost_statement`='" . (int)$namevirtualhost_statement . "', `vhostcontainer`='" . (int)$vhostcontainer . "', `vhostcontainer_servername_statement`='" . (int)$vhostcontainer_servername_statement . "', `specialsettings`='" . $db->escape($specialsettings) . "', `ssl`='" . (int)$ssl . "', `ssl_cert_file`='" . $db->escape($ssl_cert_file) . "', `ssl_key_file`='" . $db->escape($ssl_key_file) . "', `ssl_ca_file`='" . $db->escape($ssl_ca_file) . "', `default_vhostconf_domain`='" . $db->escape($default_vhostconf_domain) . "' WHERE `id`='" . (int)$id . "'");
+
+					$db->query("UPDATE `" . TABLE_PANEL_IPSANDPORTS . "`
+					SET 
+						`ip` = '" . $db->escape($ip) . "', 
+						`port` = '" . (int)$port . "', 
+						`listen_statement` = '" . (int)$listen_statement . "', 
+						`namevirtualhost_statement` = '" . (int)$namevirtualhost_statement . "', 
+						`vhostcontainer` = '" . (int)$vhostcontainer . "', 
+						`vhostcontainer_servername_statement` = '" . (int)$vhostcontainer_servername_statement . "', 
+						`specialsettings` = '" . $db->escape($specialsettings) . "', 
+						`ssl` = '" . (int)$ssl . "', 
+						`ssl_cert_file` = '" . $db->escape($ssl_cert_file) . "', 
+						`ssl_key_file` = '" . $db->escape($ssl_key_file) . "', 
+						`ssl_ca_file` = '" . $db->escape($ssl_ca_file) . "',
+						`ssl_cert_chainfile` = '" . $db->escape($ssl_cert_chainfile) . "', 
+						`default_vhostconf_domain` = '" . $db->escape($default_vhostconf_domain) . "',
+						`docroot` = '" . $db->escape($docroot) . "' 
+					WHERE `id`='" . (int)$id . "'
+					");
+
 					$log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'");
 					inserttask('1');
+
+					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
+
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
 			else
 			{
-				$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
 				$result = htmlentities_array($result);
+				/*
+				$enable_ssl = makeyesno('ssl', '1', '0', $result['ssl']);
 				$listen_statement = makeyesno('listen_statement', '1', '0', $result['listen_statement']);
 				$namevirtualhost_statement = makeyesno('namevirtualhost_statement', '1', '0', $result['namevirtualhost_statement']);
 				$vhostcontainer = makeyesno('vhostcontainer', '1', '0', $result['vhostcontainer']);
 				$vhostcontainer_servername_statement = makeyesno('vhostcontainer_servername_statement', '1', '0', $result['vhostcontainer_servername_statement']);
+				*/
+
+				$ipsandports_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/ipsandports/formfield.ipsandports_edit.php';
+				$ipsandports_edit_form = htmlform::genHTMLForm($ipsandports_edit_data);
+	
+				$title = $ipsandports_edit_data['ipsandports_edit']['title'];
+				$image = $ipsandports_edit_data['ipsandports_edit']['image'];
+
 				eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";");
 			}
 		}
--- a/admin_logger.php
+++ b/admin_logger.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -22,19 +22,17 @@ define('AREA', 'admin');
 /**
 * Include our init.php, which manages Sessions, Language etc.
 */
+require('./lib/init.php');

-require ("./lib/init.php");
-
-if($page == 'log'
-   && $userinfo['change_serversettings'] == '1')
-{
-	if($action == '')
-	{
+if ($page == 'log'
+   && $userinfo['change_serversettings'] == '1'
+) {
+	if ($action == '') {
 		$fields = array(
-			'action' => $lng['logger']['action'],
 			'date' => $lng['logger']['date'],
 			'type' => $lng['logger']['type'],
-			'user' => $lng['logger']['user']
+			'user' => $lng['logger']['user'],
+			'text' => $lng['logger']['action']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_LOG, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$paging->sortfield = 'date';
@@ -47,24 +45,21 @@ if($page == 'log'
 		$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
 		$clog = array();

-		while($row = $db->fetch_array($result))
-		{
-			if(!isset($clog[$row['action']])
-			   || !is_array($clog[$row['action']]))
-			{
+		while ($row = $db->fetch_array($result)) {
+			if (!isset($clog[$row['action']])
+			   || !is_array($clog[$row['action']])
+			) {
 				$clog[$row['action']] = array();
 			}

 			$clog[$row['action']][$row['logid']] = $row;
 		}

-		if($paging->sortfield == 'date'
-		   && $paging->sortorder == 'desc')
-		{
+		if ($paging->sortfield == 'date'
+		   && $paging->sortorder == 'desc'
+		) {
 			krsort($clog);
-		}
-		else
-		{
+		} else {
 			ksort($clog);
 		}

@@ -72,20 +67,15 @@ if($page == 'log'
 		$count = 0;
 		$log_count = 0;
 		$log = '';
-		foreach($clog as $action => $logrows)
-		{
+		foreach ($clog as $action => $logrows) {
 			$_action = 0;
-			foreach($logrows as $row)
-			{
-				if($paging->checkDisplay($i))
-				{
+			foreach ($logrows as $row) {
+				if ($paging->checkDisplay($i)) {
 					$row = htmlentities_array($row);
 					$row['date'] = date("d.m.y H:i:s", $row['date']);

-					if($_action != $action)
-					{
-						switch($action)
-						{
+					if ($_action != $action) {
+						switch ($action) {
 							case USR_ACTION:
 								$_action = $lng['admin']['customer'];
 								break;
@@ -107,15 +97,14 @@ if($page == 'log'
 						}

 						$row['action'] = $_action;
-						eval("\$log.=\"" . getTemplate("logger/logger_action") . "\";");
+						eval("\$log.=\"" . getTemplate('logger/logger_action') . "\";");
 					}

 					$log_count++;
 					$type = $row['type'];
 					$_type = 'unknown';

-					switch($type)
-					{
+					switch ($type) {
 						case LOG_INFO:
 							$_type = 'Information';
 							break;
@@ -137,35 +126,28 @@ if($page == 'log'
 					}

 					$row['type'] = $_type;
-					eval("\$log.=\"" . getTemplate("logger/logger_log") . "\";");
+					eval("\$log.=\"" . getTemplate('logger/logger_log') . "\";");
 					$count++;
 					$_action = $action;
 				}
 			}
-
 			$i++;
 		}

-		eval("echo \"" . getTemplate("logger/logger") . "\";");
-	}
-	elseif($action == 'truncate')
-	{
-		if(isset($_POST['send'])
-		   && $_POST['send'] == 'send')
-		{
+		eval("echo \"" . getTemplate('logger/logger') . "\";");
+	} elseif ($action == 'truncate') {
+		if (isset($_POST['send'])
+		   && $_POST['send'] == 'send'
+		) {
 			$yesterday = time() - (60 * 10);

 			/* (60*60*24); */

 			$db->query("DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < '" . $yesterday . "'");
-			$log->logAction(ADM_ACTION, LOG_WARNING, "truncated the system-log (mysql)");
+			$log->logAction(ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)');
 			redirectTo($filename, Array('page' => $page, 's' => $s));
-		}
-		else
-		{
+		} else {
 			ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG);
 		}
 	}
 }
-
-?>
--- a/admin_message.php
+++ b/admin_message.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -22,79 +22,60 @@ define('AREA', 'admin');
 /**
 * Include our init.php, which manages Sessions, Language etc.
 */
+require('./lib/init.php');

-require ("./lib/init.php");
-
-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif (isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }

-if($page == 'message')
-{
-	if($action == '')
-	{
-		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed panel_message");
+if ($page == 'message') {
+	if ($action == '') {
+		$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed panel_message');

-		if(isset($_POST['send'])
-		   && $_POST['send'] == 'send')
-		{
-			if($_POST['receipient'] == 0
-			   && $userinfo['customers_see_all'] == '1')
-			{
-				$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to admins");
+		if (isset($_POST['send'])
+		   && $_POST['send'] == 'send'
+		) {
+			if ($_POST['receipient'] == 0
+			   && $userinfo['customers_see_all'] == '1'
+			) {
+				$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to admins');
 				$result = $db->query('SELECT `name`, `email`  FROM `' . TABLE_PANEL_ADMINS . "`");
-			}
-			elseif($_POST['receipient'] == 1)
-			{
-				if($userinfo['customers_see_all'] == "1")
-				{
-					$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to ALL customers");
+			} elseif ($_POST['receipient'] == 1) {
+				if ($userinfo['customers_see_all'] == '1') {
+					$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers');
 					$result = $db->query('SELECT `firstname`, `name`, `email`  FROM `' . TABLE_PANEL_CUSTOMERS . "`");
-				}
-				else
-				{
-					$log->logAction(ADM_ACTION, LOG_NOTICE, "sending messages to customers");
+				} else {
+					$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to customers');
 					$result = $db->query('SELECT `firstname`, `name`, `email`  FROM `' . TABLE_PANEL_CUSTOMERS . "` WHERE `adminid`='" . $userinfo['adminid'] . "'");
 				}
-			}
-			else
-			{
+			} else {
 				standard_error('noreceipientsgiven');
 			}

 			$subject = $_POST['subject'];
 			$message = wordwrap($_POST['message'], 70);

-			if(!empty($message))
-			{
+			if (!empty($message)) {
 				$mailcounter = 0;
 				$mail->Body = $message;
 				$mail->Subject = $subject;

-				while($row = $db->fetch_array($result))
-				{
+				while ($row = $db->fetch_array($result)) {
 					$mail->AddAddress($row['email'], (isset($row['firstname']) ? $row['firstname'] . ' ' : '') . $row['name']);
 					$mail->From = $userinfo['email'];
 					$mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name'];

-					if(!$mail->Send())
-					{
-						if($mail->ErrorInfo != '')
-						{
+					if (!$mail->Send()) {
+						if ($mail->ErrorInfo != '') {
 							$mailerr_msg = $mail->ErrorInfo;
-						}
-						else
-						{
-							$mailerr_msg = $row["email"];
+						} else {
+							$mailerr_msg = $row['email'];
 						}

-						$log->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
-						standard_error('errorsendingmail', $row["email"]);
+						$log->logAction(ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg);
+						standard_error('errorsendingmail', $row['email']);
 					}

 					$mailcounter++;
@@ -102,47 +83,34 @@ if($page == 'message')
 				}

 				redirectTo($filename, Array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter));
-			}
-			else
-			{
+			} else {
 				standard_error('nomessagetosend');
 			}
 		}
 	}

-	if($action == 'showsuccess')
-	{
+	if ($action == 'showsuccess') {
 		$success = 1;
 		$sentitems = isset($_GET['sentitems']) ? (int)$_GET['sentitems'] : 0;

-		if($sentitems == 0)
-		{
+		if ($sentitems == 0) {
 			$successmessage = $lng['message']['noreceipients'];
-		}
-		else
-		{
+		} else {
 			$successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
 		}
-
-		$action = '';
-	}
-	else
-	{
+	} else {
 		$success = 0;
 		$sentitems = 0;
 		$successmessage = '';
-		$action = '';
 	}
+	$action = '';

 	$receipients = '';

-	if($userinfo['customers_see_all'] == "1")
-	{
+	if ($userinfo['customers_see_all'] == '1') {
 		$receipients.= makeoption($lng['panel']['reseller'], 0);
 	}

-	$receipients.= makeoption($lng['panel']['customer'], 1);
-	eval("echo \"" . getTemplate("message/message") . "\";");
+	$receipients .= makeoption($lng['panel']['customer'], 1);
+	eval("echo \"" . getTemplate('message/message') . "\";");
 }
-
-?>
--- a/admin_phpsettings.php
+++ b/admin_phpsettings.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -25,49 +25,58 @@ define('AREA', 'admin');

 require ("./lib/init.php");

-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif (isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }

-if($page == 'overview')
-{
-	if($action == '')
-	{
+if ($page == 'overview') {
+
+	if ($action == '') {
+
 		$tablecontent = '';
+		$count = 0;
 		$result = $db->query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`");

-		while($row = $db->fetch_array($result))
-		{
+		while ($row = $db->fetch_array($result)) {
+
 			$domainresult = false;

-			if((int)$userinfo['domains_see_all'] == 0)
-			{
-				$domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `adminid` = " . (int)$userinfo['userid'] . " AND `phpsettingid` = " . (int)$row['id']);
-			}
-			else
-			{
-				$domainresult = $db->query("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `phpsettingid` = " . (int)$row['id']);
+			$query = "SELECT * FROM `".TABLE_PANEL_DOMAINS."`
+					WHERE `phpsettingid` = '".(int)$row['id']."'
+					AND `parentdomainid` = '0'";
+
+			if ((int)$userinfo['domains_see_all'] == 0) {
+				$query .= " AND `adminid` = '".(int)$userinfo['userid']."'";
 			}

-			$domains = '';
-
-			if($db->num_rows($domainresult) > 0)
-			{
-				while($row2 = $db->fetch_array($domainresult))
-				{
-					$domains.= $row2['domain'] . '<br/>';
+			if ((int)$settings['panel']['phpconfigs_hidestdsubdomain'] == 1) {
+				$query2 = "SELECT DISTINCT `standardsubdomain`
+						FROM `".TABLE_PANEL_CUSTOMERS."`
+						WHERE `standardsubdomain` > 0 ORDER BY `standardsubdomain` ASC;";
+				$ssdids_res = $db->query($query2);
+				$ssdids = array();
+				while ($ssd = $db->fetch_array($ssdids_res)) {
+					$ssdids[] = $ssd['standardsubdomain'];
+				}
+				if (count($ssdids) > 0) {
+					$query .= " AND `id` NOT IN (".implode(', ', $ssdids).")";
 				}
 			}
-			else
-			{
+
+			$domainresult = $db->query($query);
+
+			$domains = '';
+			if ($db->num_rows($domainresult) > 0) {
+				while ($row2 = $db->fetch_array($domainresult)) {
+					$domains.= $row2['domain'] . '<br/>';
+				}
+			} else {
 				$domains = $lng['admin']['phpsettings']['notused'];
 			}

+			$count ++;
 			eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";");
 		}

@@ -97,12 +106,19 @@ if($page == 'overview')

 				$db->query("INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` SET `description` = '" . $db->escape($description) . "', `binary` = '" . $db->escape($binary) . "', `file_extensions` = '" . $db->escape($file_extensions) . "', `mod_fcgid_starter` = '" . $db->escape($mod_fcgid_starter) . "', `mod_fcgid_maxrequests` = '" . $db->escape($mod_fcgid_maxrequests) . "', `phpsettings` = '" . $db->escape($phpsettings) . "'");
 				inserttask('1');
-				$log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting with description '" . $value . "' has been created by '" . $userinfo['loginname'] . "'");
+				$log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting with description '" . $description . "' has been created by '" . $userinfo['loginname'] . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 			else
 			{
 				$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1");
+
+				$phpconfig_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_add.php';
+				$phpconfig_add_form = htmlform::genHTMLForm($phpconfig_add_data);
+
+				$title = $phpconfig_add_data['phpconfig_add']['title'];
+				$image = $phpconfig_add_data['phpconfig_add']['image'];
+
 				eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";");
 			}
 		}
@@ -172,6 +188,12 @@ if($page == 'overview')
 			}
 			else
 			{
+				$phpconfig_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/phpconfig/formfield.phpconfig_edit.php';
+				$phpconfig_edit_form = htmlform::genHTMLForm($phpconfig_edit_data);
+
+				$title = $phpconfig_edit_data['phpconfig_edit']['title'];
+				$image = $phpconfig_edit_data['phpconfig_edit']['image'];
+
 				eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";");
 			}
 		}
--- a/admin_settings.php
+++ b/admin_settings.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -31,22 +31,134 @@ if(($page == 'settings' || $page == 'overview')
   && $userinfo['change_serversettings'] == '1')
 {
 	$settings_data = loadConfigArrayDir('./actions/admin/settings/');
-	$settings = loadSettings(&$settings_data, &$db);
-	
+	$settings = loadSettings($settings_data, $db);
+
 	if(isset($_POST['send'])
 	   && $_POST['send'] == 'send')
 	{
-		if(processForm(&$settings_data, &$_POST, array('filename' => $filename, 'action' => $action, 'page' => $page)))
+		$_part = isset($_GET['part']) ? $_GET['part'] : '';
+
+		if($_part == '')
 		{
+			$_part = isset($_POST['part']) ? $_POST['part'] : '';
+		}
+
+		if($_part != '')
+		{
+			if($_part == 'all')
+			{
+				$settings_all = true;
+				$settings_part = false;
+			}
+			else
+			{
+				$settings_all = false;
+				$settings_part = true;
+			}
+
+			$only_enabledisable = false;
+		}
+		else
+		{
+			$settings_all = false;
+			$settings_part = false;
+			$only_enabledisable = true;
+		}
+		
+		// check if the session timeout is too low #815
+		if (isset($_POST['session_sessiontimeout']) && $_POST['session_sessiontimeout'] <= 60) {
+			standard_error($lng['error']['session_timeout'], $lng['error']['session_timeout_desc']);
+		}
+
+		if(processFormEx(
+			$settings_data,
+			$_POST,
+			array('filename' => $filename, 'action' => $action, 'page' => $page),
+			$_part,
+			$settings_all,
+			$settings_part,
+			$only_enabledisable
+			)
+		) {
+			$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
+			inserttask('1');
+			// Using nameserver, insert a task which rebuilds the server config
+			inserttask('4');
+
 			standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page));
 		}
 	}
 	else
 	{
-		$fields = buildForm(&$settings_data);
-		eval("echo \"" . getTemplate("settings/settings") . "\";");
+		$_part = isset($_GET['part']) ? $_GET['part'] : '';
+
+		if($_part == '')
+		{
+			$_part = isset($_POST['part']) ? $_POST['part'] : '';
+		}
+
+		$fields = buildFormEx($settings_data, $_part);
+
+		$settings_page = '';
+		if($_part == '')
+		{
+			eval("\$settings_page .= \"" . getTemplate("settings/settings_overview") . "\";");
+		}
+		else
+		{
+			eval("\$settings_page .= \"" . getTemplate("settings/settings") . "\";");
+		}
+
+		eval("echo \"" . getTemplate("settings/settings_form_begin") . "\";");
+		eval("echo \$settings_page;");
+		eval("echo \"" . getTemplate("settings/settings_form_end") . "\";");
+
 	}
 }
+elseif($page == 'phpinfo'
+	&& $userinfo['change_serversettings'] == '1'
+) {
+		ob_start();
+		phpinfo();
+		$phpinfo = array('phpinfo' => array());
+		if (preg_match_all(
+				'#(?:<h2>(?:<a name=".*?">)?(.*?)(?:</a>)?</h2>)|(?:<tr(?: class=".*?")?><t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>)?)?</tr>)#s',
+				ob_get_clean(), $matches, PREG_SET_ORDER
+			)
+		) {
+		foreach ($matches as $match) {
+			$end = array_keys($phpinfo);
+			$end = end($end);
+			if (strlen($match[1])) {
+				$phpinfo[$match[1]] = array();
+			} elseif (isset($match[3])) {
+				$phpinfo[$end][$match[2]] = isset($match[4]) ? array($match[3], $match[4]) : $match[3];
+			} else {
+				$phpinfo[$end][] = $match[2];
+			}
+		}
+		$phpinfohtml = '';
+		foreach ($phpinfo as $name => $section) {
+			$phpinfoentries = "";
+			foreach ($section as $key => $val) {
+				if (is_array($val)) {
+					eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_3") . "\";");
+				} elseif (is_string($key)) {
+					eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_2") . "\";");
+				} else {
+					eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_1") . "\";");
+				}
+			}
+			// first header -> show actual php version
+			if (strtolower($name) == "phpinfo") {
+				$name = "PHP ".PHP_VERSION;
+			}
+			eval("\$phpinfohtml .= \"" . getTemplate("settings/phpinfo/phpinfo_table") . "\";");
+		}
+		$phpinfo = $phpinfohtml;
+	}
+	eval("echo \"" . getTemplate("settings/phpinfo") . "\";");
+}
 elseif($page == 'rebuildconfigs'
       && $userinfo['change_serversettings'] == '1')
 {
@@ -55,9 +167,11 @@ elseif($page == 'rebuildconfigs'
 	{
 		$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles");
 		inserttask('1');
+		inserttask('10');
+		// Using nameserver, insert a task which rebuilds the server config
 		inserttask('4');
-		inserttask('5');
-		redirectTo('admin_index.php', array('s' => $s));
+
+		standard_success('rebuildingconfigs', '', array('filename' => 'admin_index.php'));
 	}
 	else
 	{
@@ -157,5 +271,3 @@ elseif($page == 'enforcequotas'
 		ask_yesno('admin_quotas_reallyenforce', $filename, array('page' => $page));
 	}
 }
-
-?>
--- a/admin_templates.php
+++ b/admin_templates.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -48,13 +48,28 @@ elseif(isset($_GET['id']))
 $available_templates = array(
 	'createcustomer',
 	'pop_success',
-	'trafficninetypercent',
-	'new_ticket_by_customer',
-	'new_ticket_for_customer',
-	'new_ticket_by_staff',
-	'new_reply_ticket_by_customer',
-	'new_reply_ticket_by_staff'
+	'new_database_by_customer',
+	'new_ftpaccount_by_customer',
+	'password_reset'
 );
+
+// only show templates of features that are enabled #1191
+if ((int)$settings['system']['report_enable'] == 1) {
+	array_push($available_templates,
+		'trafficmaxpercent',
+		'diskmaxpercent'
+	);
+}
+if ((int)$settings['ticket']['enabled'] == 1) {
+	array_push($available_templates,
+		'new_ticket_by_customer',
+		'new_ticket_for_customer',
+		'new_ticket_by_staff',
+		'new_reply_ticket_by_customer',
+		'new_reply_ticket_by_staff'
+	);
+}
+
 $file_templates = array(
 	'index_html'
 );
@@ -148,7 +163,7 @@ elseif($action == 'delete'
 		}
 	}
 }
-elseif($action == 'delete'
+elseif($action == 'deletef'
       && $id != 0)
 {
 	//file templates
@@ -205,6 +220,12 @@ elseif($action == 'add')
 			$template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true);
 		}

+		$template_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_add.php';
+		$template_add_form = htmlform::genHTMLForm($template_add_data);
+
+		$title = $template_add_data['template_add']['title'];
+		$image = $template_add_data['template_add']['image'];
+
 		eval("echo \"" . getTemplate("templates/templates_add_2") . "\";");
 	}
 	elseif(isset($_POST['send'])
@@ -308,6 +329,12 @@ elseif($action == 'add')
 				$free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true);
 			}

+			$filetemplate_add_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_add.php';
+			$filetemplate_add_form = htmlform::genHTMLForm($filetemplate_add_data);
+
+			$title = $filetemplate_add_data['filetemplate_add']['title'];
+			$image = $filetemplate_add_data['filetemplate_add']['image'];
+
 			eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";");
 		}
 	}
@@ -340,11 +367,18 @@ elseif($action == 'edit'
 			$result = $db->query_first("SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "` WHERE `id`='$mailbodyid'");
 			$result = htmlentities_array($result);
 			$mailbody = $result['value'];
+
+			$template_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.template_edit.php';
+			$template_edit_form = htmlform::genHTMLForm($template_edit_data);
+
+			$title = $template_edit_data['template_edit']['title'];
+			$image = $template_edit_data['template_edit']['image'];
+
 			eval("echo \"" . getTemplate("templates/templates_edit") . "\";");
 		}
 	}
 }
-elseif($action == 'edit'
+elseif($action == 'editf'
       && $id != 0)
 {
 	//file templates
@@ -368,6 +402,13 @@ elseif($action == 'edit'
 		else
 		{
 			$row = htmlentities_array($row);
+
+			$filetemplate_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/templates/formfield.filetemplate_edit.php';
+			$filetemplate_edit_form = htmlform::genHTMLForm($filetemplate_edit_data);
+
+			$title = $filetemplate_edit_data['filetemplate_edit']['title'];
+			$image = $filetemplate_edit_data['filetemplate_edit']['image'];
+
 			eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";");
 		}
 	}
@@ -377,5 +418,3 @@ elseif($action == 'edit'
 		exit;
 	}
 }
-
-?>
--- a/admin_tickets.php
+++ b/admin_tickets.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
@@ -32,6 +32,22 @@ if(isset($_POST['id']))
 elseif(isset($_GET['id']))
 {
 	$id = intval($_GET['id']);
+
+	// only check if this is not a category-id
+	if (!isset($_GET['page']) || (isset($_GET['page']) && $_GET['page'] != 'categories')) {
+		if (!$userinfo['customers_see_all']) {
+			/*
+			 * Check if the current user is allowed to see the current ticket.
+			 */
+			$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `adminid` = '".$userinfo['admindid']."'";
+
+			$result = $db->query_first($sql);
+			if ($result == null) {
+				// no rights to see the requested ticket
+				standard_error(array('ticketnotaccessible'));
+			}
+		}
+	}
 }

 if($page == 'tickets'
@@ -41,7 +57,7 @@ if($page == 'tickets'

 	$countcustomers = $db->query_first("SELECT COUNT(`customerid`) as `countcustomers` FROM `" . TABLE_PANEL_CUSTOMERS . "` " . ($userinfo['customers_see_all'] ? '' : " WHERE `adminid` = '" . (int)$userinfo['adminid'] . "' ") . "");
 	$countcustomers = (int)$countcustomers['countcustomers'];
-	
+
 	if($action == '')
 	{
 		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_tickets");
@@ -56,7 +72,7 @@ if($page == 'tickets'
 		$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$paging->sortfield = 'lastchange';
 		$paging->sortorder = 'desc';
-		$result = $db->query('SELECT `main`.`id`, `main`.`customerid`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0"  AND `archived` = "0" AND `adminid` = "' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query('SELECT `main`.`id`, `main`.`customerid`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0"  AND `archived` = "0" ' . ($userinfo['customers_see_all'] ? '' : ' AND  `adminid` = "' . (int)$userinfo['adminid'] . '"') . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -102,15 +118,20 @@ if($page == 'tickets'
 					if($_cid != $row['customerid'])
 					{
 						$cid = $row['customerid'];
-						$usr = $db->query_first('SELECT `firstname`, `name`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
                                     WHERE `customerid` = "' . (int)$cid . '"');
-						
-						if(isset($usr['loginname'])) {
-							$customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
-						} else {
+
+						if(isset($usr['loginname']))
+						{
+							$customer = getCorrectFullUserDetails($usr);
+							$customerloginname =  $usr['loginname'];
+							$customerid = $usr['customerid'];
+						}
+						else
+						{
 							$customer = $lng['ticket']['nonexistingcustomer'];
 						}
-						eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
+						eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
 					}

 					$tickets_count++;
@@ -139,12 +160,13 @@ if($page == 'tickets'
 						$cananswer = 1;
 					}

+					$row['subject'] = html_entity_decode($row['subject']);
 					if(strlen($row['subject']) > 20)
 					{
 						$row['subject'] = substr($row['subject'], 0, 17) . '...';
 					}

-					eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
+					eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";");
 					$count++;
 					$_cid = $row['customerid'];
 				}
@@ -153,7 +175,7 @@ if($page == 'tickets'
 			$i++;
 		}

-		eval("echo \"" . getTemplate("ticket/tickets") . "\";");
+		eval("echo \"" . getTemplate("tickets/tickets") . "\";");
 	}
 	elseif($action == 'new')
 	{
@@ -167,8 +189,8 @@ if($page == 'tickets'
 				$newticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
 				$newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
 				$newticket->Set('category', validate($_POST['category'], 'category'), true, false);
-				$newticket->Set('customer', validate($_POST['customer'], 'customer'), true, false);
-				$newticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
+				$newticket->Set('customer', (int)$_POST['customer'], true, false);
+				$newticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false);

 				if($newticket->Get('subject') == null)
 				{
@@ -197,12 +219,16 @@ if($page == 'tickets'
 			else
 			{
 				$categories = '';
-				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `name` ASC');
+				$where = '';
+				if ($userinfo['tickets_see_all'] != '1') {
+					$where = 'WHERE `adminid` = "' . $userinfo['adminid'] . '"';
+				}
+				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');

 				if(isset($result['name'])
 				   && $result['name'] != '')
 				{
-					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `name` ASC');
+					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` '.$where.' ORDER BY `logicalorder`, `name` ASC');

 					while($row = $db->fetch_array($result2))
 					{
@@ -219,28 +245,20 @@ if($page == 'tickets'

 				while($row_customer = $db->fetch_array($result_customers))
 				{
-					if($row_customer['company'] == '')
-					{
-						$customers.= makeoption($row_customer['name'] . ', ' . $row_customer['firstname'] . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
-					}
-					else
-					{
-						if($row_customer['name'] != ''
-						   && $row_customer['firstname'] != '')
-						{
-							$customers.= makeoption($row_customer['name'] . ', ' . $row_customer['firstname'] . ' | ' . $row_customer['company'] . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
-						}
-						else
-						{
-							$customers.= makeoption($row_customer['company'] . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
-						}
-					}
+					$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
 				}

-				$priorities = makeoption($lng['ticket']['unf_high'], '1');
-				$priorities.= makeoption($lng['ticket']['unf_normal'], '2');
-				$priorities.= makeoption($lng['ticket']['unf_low'], '3');
-				eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
+				$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']);
+
+				$ticket_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_new.php';
+				$ticket_new_form = htmlform::genHTMLForm($ticket_new_data);
+
+				$title = $ticket_new_data['ticket_new']['title'];
+				$image = $ticket_new_data['ticket_new']['image'];
+
+				eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
 			}
 		}
 		else
@@ -257,7 +275,7 @@ if($page == 'tickets'
 			$replyticket = ticket::getInstanceOf($userinfo, $db, $settings, -1);
 			$replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
 			$replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
-			$replyticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
+			$replyticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false);

 			if($replyticket->Get('message') == null)
 			{
@@ -308,18 +326,25 @@ if($page == 'tickets'
 				$isclosed = 1;
 			}

-			if($mainticket->Get('by') == '1')
+			if ($mainticket->Get('by') == '1')
 			{
 				$by = $lng['ticket']['staff'];
 			}
 			else
 			{
-				$by = $lng['ticket']['customer'];
+				$cid = $mainticket->Get('customer');
+				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+				);
+				$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+				$by .= getCorrectFullUserDetails($usr).'</a>';
+				//$by = $lng['ticket']['customer'];
 			}

 			$subject = $mainticket->Get('subject');
 			$message = $mainticket->Get('message');
-			eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
+			eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
 			$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
                                WHERE `id`="' . (int)$mainticket->Get('category') . '"');
 			$row = $db->fetch_array($result);
@@ -336,12 +361,19 @@ if($page == 'tickets'
 				}
 				else
 				{
-					$by = $lng['ticket']['customer'];
+					$cid = $subticket->Get('customer');
+					$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+					);
+					$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+					$by .= getCorrectFullUserDetails($usr).'</a>';
+					//$by = $lng['ticket']['customer'];
 				}

 				$subject = $subticket->Get('subject');
 				$message = $subticket->Get('message');
-				eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
+				eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
 			}

 			$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -351,8 +383,13 @@ if($page == 'tickets'
 			$ticket_replies_count = $db->num_rows($andere) + 1;

 			// don't forget the main-ticket!
+			$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_reply.php';
+			$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);

-			eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
+			$title = $ticket_reply_data['ticket_reply']['title'];
+			$image = $ticket_reply_data['ticket_reply']['image'];
+
+			eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
 		}
 	}
 	elseif($action == 'close'
@@ -435,13 +472,19 @@ elseif($page == 'categories'
 	{
 		$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_tickets::categories");
 		$fields = array(
-			'name' => $lng['ticket']['category']
+			'name' => $lng['ticket']['category'],
+			'logicalorder' => $lng['ticket']['logicalorder']
 		);
+
+		$where = '1'; // WHERE 1 is like no 'where-clause'
+		if ($userinfo['tickets_see_all'] != '1') {
+			$where = " `main`.`adminid` = '" . (int)$userinfo['adminid'] . "'";
+		}
 		$paging = new paging($userinfo, $db, TABLE_PANEL_TICKET_CATS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `main`.`id`, `main`.`name`, (
+		$result = $db->query("SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, (
                              SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub`
                              WHERE `sub`.`category` = `main`.`id`
-                              AND `sub`.`answerto` = '0' AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
+                              AND `sub`.`answerto` = '0'  AND `sub`.`adminid` = '" . $userinfo['adminid'] . "')
                              as `ticketcount`, (
                              SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2`
                              WHERE `sub2`.`category` = `main`.`id`
@@ -449,7 +492,7 @@ elseif($page == 'categories'
                              AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2')
                              AND `sub2`.`adminid` = '" . $userinfo['adminid'] . "'
                              ) as `ticketcountnotclosed`
-                              FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE `main`.`adminid` = '" . (int)$userinfo['adminid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+                              FROM `" . TABLE_PANEL_TICKET_CATS . "` `main` WHERE " . $where . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -466,14 +509,14 @@ elseif($page == 'categories'
 			{
 				$row = htmlentities_array($row);
 				$closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']);
-				eval("\$ticketcategories.=\"" . getTemplate("ticket/tickets_categories") . "\";");
+				eval("\$ticketcategories.=\"" . getTemplate("tickets/tickets_categories") . "\";");
 				$count++;
 			}

 			$i++;
 		}

-		eval("echo \"" . getTemplate("ticket/categories") . "\";");
+		eval("echo \"" . getTemplate("tickets/categories") . "\";");
 	}
 	elseif($action == 'addcategory')
 	{
@@ -481,6 +524,13 @@ elseif($page == 'categories'
 		   && $_POST['send'] == 'send')
 		{
 			$category = validate($_POST['category'], 'category');
+			$order = validate($_POST['logicalorder'], 'logicalorder');
+
+			if($order < 1 || $order >= 1000)
+			{
+				// use the latest available
+				$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1;
+			}

 			if($category == '')
 			{
@@ -488,14 +538,22 @@ elseif($page == 'categories'
 			}
 			else
 			{
-				ticket::addCategory($db, $category, $userinfo['adminid']);
+				ticket::addCategory($db, $category, $userinfo['adminid'], $order);
 				$log->logAction(ADM_ACTION, LOG_INFO, "added ticket-category '" . $category . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 		}
 		else
 		{
-			eval("echo \"" . getTemplate("ticket/tickets_newcategory") . "\";");
+			$order = ticket::getHighestOrderNumber($db, $userinfo['adminid']) + 1;
+
+			$category_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_new.php';
+			$category_new_form = htmlform::genHTMLForm($category_new_data);
+
+			$title = $category_new_data['category_new']['title'];
+			$image = $category_new_data['category_new']['image'];
+
+			eval("echo \"" . getTemplate("tickets/tickets_newcategory") . "\";");
 		}
 	}
 	elseif($action == 'editcategory'
@@ -505,6 +563,12 @@ elseif($page == 'categories'
 		   && $_POST['send'] == 'send')
 		{
 			$category = validate($_POST['category'], 'category');
+			$order = validate($_POST['logicalorder'], 'logicalorder');
+
+			if($order < 1 || $order >= 1000)
+			{
+				$order = 1;
+			}

 			if($category == '')
 			{
@@ -512,7 +576,7 @@ elseif($page == 'categories'
 			}
 			else
 			{
-				ticket::editCategory($db, $category, $id);
+				ticket::editCategory($db, $category, $id, $order);
 				$log->logAction(ADM_ACTION, LOG_INFO, "edited ticket-category '" . $category . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
@@ -520,7 +584,14 @@ elseif($page == 'categories'
 		else
 		{
 			$row = $db->query_first('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = "' . (int)$id . '"');
-			eval("echo \"" . getTemplate("ticket/tickets_editcategory") . "\";");
+
+			$category_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_edit.php';
+			$category_edit_form = htmlform::genHTMLForm($category_edit_data);
+
+			$title = $category_edit_data['category_edit']['title'];
+			$image = $category_edit_data['category_edit']['image'];
+
+			eval("echo \"" . getTemplate("tickets/tickets_editcategory") . "\";");
 		}
 	}
 	elseif($action == 'deletecategory'
@@ -569,8 +640,7 @@ elseif($page == 'archive'
 			{
 				$categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : '';
 			}
-
-			$query = ticket::getArchiveSearchStatement($subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
+			$query = ticket::getArchiveSearchStatement($db, $subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
 			$fields = array(
 				'lastchange' => $lng['ticket']['lastchange'],
 				'ticket_answers' => $lng['ticket']['ticket_answers'],
@@ -628,24 +698,39 @@ elseif($page == 'archive'
 				{
 					if($paging->checkDisplay($i))
 					{
-						$ticket = htmlentities_array($ticket);
 						$ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']);

 						if($_cid != $ticket['customerid'])
 						{
 							$cid = $ticket['customerid'];
-							$usr = $db->query_first('SELECT `firstname`, `name`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
+							$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname` FROM `' . TABLE_PANEL_CUSTOMERS . '`
                                       WHERE `customerid` = "' . (int)$cid . '"');
-							
-							if(isset($usr['loginname'])) {
-								$customer = $usr['firstname'] . " " . $usr['name'] . " (" . $usr['loginname'] . ")";
-							} else {
+
+							if(isset($usr['loginname']))
+							{
+								$customer = getCorrectFullUserDetails($usr);
+								$customerloginname =  $usr['loginname'];
+								$customerid = $usr['customerid'];
+							}
+							else
+							{
 								$customer = $lng['ticket']['nonexistingcustomer'];
 							}
-							eval("\$tickets.=\"" . getTemplate("ticket/tickets_customer") . "\";");
+
+							eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
 						}

 						$tickets_count++;
+						switch ($ticket['priority'])
+						{
+							case 1: $ticket['display'] = 'high';
+							break;
+							case 2: $ticket['display'] = 'normal';
+							break;
+							case 3: $ticket['display'] = 'low';
+							break;
+							default: $ticket['display'] = 'unknown';
+						}
 						$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);

 						if($ticket['lastreplier'] == '1')
@@ -661,8 +746,8 @@ elseif($page == 'archive'
 						{
 							$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
 						}
-
-						eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
+						$ticket = htmlentities_array($ticket);
+						eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";");
 						$count++;
 						$_cid = $ticket['customerid'];
 					}
@@ -671,7 +756,7 @@ elseif($page == 'archive'
 				$i++;
 			}

-			eval("echo \"" . getTemplate("ticket/archivesearch") . "\";");
+			eval("echo \"" . getTemplate("tickets/archivesearch") . "\";");
 		}
 		else
 		{
@@ -700,13 +785,13 @@ elseif($page == 'archive'
 						$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
 					}

-					eval("\$tickets.=\"" . getTemplate("ticket/archived_tickets") . "\";");
+					eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";");
 				}
 			}

-			$priorities_options = makecheckbox('priority1', $lng['ticket']['unf_high'], '1');
-			$priorities_options.= makecheckbox('priority2', $lng['ticket']['unf_normal'], '2');
-			$priorities_options.= makecheckbox('priority3', $lng['ticket']['unf_low'], '3');
+			$priorities_options = makecheckbox('priority1', $lng['ticket']['high'], '1');
+			$priorities_options.= makecheckbox('priority2', $lng['ticket']['normal'], '2');
+			$priorities_options.= makecheckbox('priority3', $lng['ticket']['low'], '3');
 			$category_options = '';
 			$ccount = 0;
 			$result = $db->query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
@@ -718,21 +803,14 @@ elseif($page == 'archive'
 			}

 			$customers = makeoption($lng['ticket']['nocustomer'], '-1', '-1');
-			$result = $db->query_first('SELECT `customerid` FROM `' . TABLE_PANEL_CUSTOMERS . '` ' . ($userinfo['customers_see_all'] ? '' : ' WHERE `adminid` = "' . (int)$userinfo['adminid'] . '" ') . 'ORDER BY `name` ASC');
+			$result_customers = $db->query("SELECT `customerid`, `loginname`, `name`, `firstname`, `company` FROM `" . TABLE_PANEL_CUSTOMERS . "` " . ($userinfo['customers_see_all'] ? '' : " WHERE `adminid` = '" . (int)$userinfo['adminid'] . "' ") . " ORDER BY `name` ASC");

-			if(isset($result['customerid'])
-			   && $result['customerid'] != '')
+			while($row_customer = $db->fetch_array($result_customers))
 			{
-				$result2 = $db->query('SELECT `customerid`, `loginname`, `firstname`, `name`
-  									          FROM `' . TABLE_PANEL_CUSTOMERS . '` ' . ($userinfo['customers_see_all'] ? '' : ' WHERE `adminid` = "' . (int)$userinfo['adminid'] . '" ') . ' ORDER BY `name` ASC');
-
-				while($row = $db->fetch_array($result2))
-				{
-					$customers.= makeoption($row['name'] . ', ' . $row['firstname'] . ' (' . $row['loginname'] . ')', $row['customerid']);
-				}
+				$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
 			}

-			eval("echo \"" . getTemplate("ticket/archive") . "\";");
+			eval("echo \"" . getTemplate("tickets/archive") . "\";");
 		}
 	}
 	elseif($action == 'view'
@@ -752,12 +830,19 @@ elseif($page == 'archive'
 		}
 		else
 		{
-			$by = $lng['ticket']['customer'];
+			$cid = $mainticket->Get('customer');
+			$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+			);
+			$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+			$by .= getCorrectFullUserDetails($usr).'</a>';
+			//$by = $lng['ticket']['customer'];
 		}

 		$subject = $mainticket->Get('subject');
 		$message = $mainticket->Get('message');
-		eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
+		eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
 		$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
                              WHERE `id`="' . (int)$mainticket->Get('category') . '"');
 		$row = $db->fetch_array($result);
@@ -774,23 +859,29 @@ elseif($page == 'archive'
 			}
 			else
 			{
-				$by = $lng['ticket']['customer'];
+				$cid = $subticket->Get('customer');
+				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+				);
+				$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
+				$by .= getCorrectFullUserDetails($usr).'</a>';
+				//$by = $lng['ticket']['customer'];
 			}

 			$subject = $subticket->Get('subject');
 			$message = $subticket->Get('message');
-			eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
+			eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
 		}

-		$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
-		$priorities.= makeoption($lng['ticket']['normal'], '2', $mainticket->Get('priority'), true, true);
-		$priorities.= makeoption($lng['ticket']['low'], '3', $mainticket->Get('priority'), true, true);
+		$priorities = makeoption($lng['ticket']['high'], '1', htmlentities($mainticket->Get('priority')), true, true);
+		$priorities.= makeoption($lng['ticket']['normal'], '2', htmlentities($mainticket->Get('priority')), true, true);
+		$priorities.= makeoption($lng['ticket']['low'], '3', htmlentities($mainticket->Get('priority')), true, true);
 		$subject = $mainticket->Get('subject');
 		$ticket_replies_count = $db->num_rows($andere) + 1;

 		// don't forget the main-ticket!
-
-		eval("echo \"" . getTemplate("ticket/tickets_view") . "\";");
+		eval("echo \"" . getTemplate("tickets/tickets_view") . "\";");
 	}
 	elseif($action == 'delete'
 	       && $id != 0)
@@ -809,6 +900,6 @@ elseif($page == 'archive'
 			ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
 		}
 	}
+} else {
+	standard_error('nocustomerforticket');
 }
-
-?>
--- a/admin_traffic.php
+++ b/admin_traffic.php
@@ -0,0 +1,148 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2003-2009 the SysCP Team (see authors).
+ * Copyright (c) 2010 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Morton Jonuschat <m.jonuschat@chrome-it.de>
+ * @license    GPLv2 http://files.syscp.org/misc/COPYING.txt
+ * @package    Panel
+ *
+ */
+
+define('AREA', 'admin');
+
+/**
+ * Include our init.php, which manages Sessions, Language etc.
+ */
+
+require ("./lib/init.php");
+
+if($action == 'logout')
+{
+	$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['adminid'] . "' AND `adminsession` = '1'");
+	redirectTo('index.php');
+	exit;
+}
+
+if(isset($_POST['id']))
+{
+	$id = intval($_POST['id']);
+}
+elseif(isset($_GET['id']))
+{
+	$id = intval($_GET['id']);
+}
+
+$months = array(
+	'0' => 'empty',
+	'1' => 'jan',
+	'2' => 'feb',
+	'3' => 'mar',
+	'4' => 'apr',
+	'5' => 'may',
+	'6' => 'jun',
+	'7' => 'jul',
+	'8' => 'aug',
+	'9' => 'sep',
+	'10' => 'oct',
+	'11' => 'nov',
+	'12' => 'dec',
+);
+
+if($page == 'overview' || $page == 'customers') 
+{
+	if($action == 'su' && $id != 0)
+	{
+		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$id . "' " . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' "));
+
+		if($result['loginname'] != '')
+		{
+			$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid`='" . (int)$userinfo['userid'] . "'");
+			$s = md5(uniqid(microtime(), 1));
+			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$id . "', '" . $db->escape($result['ipaddress']) . "', '" . $db->escape($result['useragent']) . "', '" . time() . "', '" . $db->escape($result['language']) . "', '0')");
+			redirectTo('customer_traffic.php', Array(
+				's' => $s
+			));
+		}
+		else
+		{
+			redirectTo('index.php', Array(
+				'action' => 'login'
+			));
+		}
+	}
+	$customerview = 1;
+	$stats_tables = '';
+	$minyear = $db->query_first("SELECT `year` FROM `". TABLE_PANEL_TRAFFIC . "` ORDER BY `year` ASC LIMIT 1");
+	if (!isset($minyear['year']) || $minyear['year'] == 0)
+	{
+		$maxyears = 0;
+	}
+	else
+	{
+		$maxyears = date("Y") - $minyear['year'];
+	}
+	for($years = 0; $years<=$maxyears; $years++) {
+		$overview['year'] = date("Y")-$years;
+		$overview['type'] = $lng['traffic']['customer'];
+		$domain_list = '';
+		$customer_name_list = $db->query("SELECT `customerid`,`company`,`name`,`firstname` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = '" . (int)$userinfo['adminid'] . "' ") . " ORDER BY name");
+		$totals = array(
+			'jan' => 0,
+			'feb' => 0,
+			'mar' => 0,
+			'apr' => 0,
+			'may' => 0,
+			'jun' => 0,
+			'jul' => 0,
+			'aug' => 0,
+			'sep' => 0,
+			'oct' => 0,
+			'nov' => 0,
+			'dec' => 0,
+		);
+		while($customer_name = $db->fetch_array($customer_name_list)) {
+			$virtual_host = array(
+				'name' => ($customer_name['company'] == '' ? $customer_name['name'] . ", " . $customer_name['firstname'] : $customer_name['company']),
+				'customerid' => $customer_name['customerid'],
+				'jan' => '-',
+				'feb' => '-',
+				'mar' => '-',
+				'apr' => '-',
+				'may' => '-',
+				'jun' => '-',
+				'jul' => '-',
+				'aug' => '-',
+				'sep' => '-',
+				'oct' => '-',
+				'nov' => '-',
+				'dec' => '-',
+			);
+			
+			$traffic_list = $db->query("SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE year = " . (date("Y")-$years) . " AND `customerid` = '" . $customer_name['customerid'] . "' GROUP BY month ORDER BY month");
+			while($traffic_month = $db->fetch_array($traffic_list)) {
+				$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s');
+				$totals[$months[(int)$traffic_month['month']]] += $traffic_month['traffic'];
+			}
+			eval("\$domain_list .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
+		}
+		// sum up totals
+		$virtual_host = array(
+			'name' => $lng['traffic']['months']['total'],
+		);
+		foreach($totals as $month => $bytes) {
+			$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.'.(int)$settings['panel']['decimal_places'].'f %s'));
+		}
+		$customerview = 0;
+		eval("\$total_list = sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
+		eval("\$stats_tables .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table") . "\");");
+	}
+	eval("echo \"" . getTemplate("traffic/index") . "\";");
+}
--- a/admin_updates.php
+++ b/admin_updates.php
@@ -12,14 +12,13 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'admin');
-require ("./lib/init.php");
+require('./lib/init.php');

-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates");

 	/**
@@ -29,13 +28,13 @@ if($page == 'overview')
 	 */
 	if (!isFroxlor()) {
 		if (!isset($settings['panel']['version'])
-		|| $settings['panel']['version'] == ''
+			|| $settings['panel']['version'] == ''
 		) {
 			$settings['panel']['version'] = '1.4.2.1';
 			$db->query("INSERT INTO `" . TABLE_PANEL_SETTINGS . "` (`settinggroup`, `varname`, `value`) VALUES ('panel','version','".$settings['panel']['version']."')");
 		}
 		if (!isset($settings['system']['dbversion'])
-		|| $settings['system']['dbversion'] == ''
+			|| $settings['system']['dbversion'] == ''
 		) {
 			/**
 			 * for syscp-stable (1.4.2.1) this value has to be 0
@@ -43,11 +42,9 @@ if($page == 'overview')
 			 * and the svn-version has its value in the database
 			 * -> bug #54
 			 */
-			
 			$result = $db->query_first("SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'");
-			
-			if(isset($result['value']))
-			{
+
+			if (isset($result['value'])) {
 				$settings['system']['dbversion'] = (int)$result['value'];
 			} else {
 				$settings['system']['dbversion'] = 0;
@@ -55,46 +52,60 @@ if($page == 'overview')
 		}
 	}

-	if(hasUpdates($version))
-	{
-		if(isset($_POST['send'])
-		&& $_POST['send'] == 'send')
-		{
+	if (hasUpdates($version)) {
+		$successful_update = false;
+		$message = '';

-			eval("echo \"" . getTemplate("update/update_start") . "\";");
-
-			include_once('./install/updatesql.php');
-
-			$redirect_url = 'admin_index.php';
-			eval("echo \"" . getTemplate("update/update_end") . "\";");
-
-			updateCounters();
-			inserttask('1');
-			@chmod('./lib/userdata.inc.php', 0440);
+		if (isset($_POST['send'])
+			&& $_POST['send'] == 'send'
+		) {
+			if ((isset($_POST['update_preconfig'])
+				&& isset($_POST['update_changesagreed'])
+				&& intval($_POST['update_changesagreed']) != 0)
+				|| !isset($_POST['update_preconfig'])
+			) {
+				eval("echo \"" . getTemplate('update/update_start') . "\";");
+	
+				include_once './install/updatesql.php';
+	
+				$redirect_url = 'admin_index.php?s=' . $s;
+				eval("echo \"" . getTemplate('update/update_end') . "\";");
+	
+				updateCounters();
+				inserttask('1');
+				@chmod('./lib/userdata.inc.php', 0440);
+				
+				$successful_update = true;
+			} else {
+				$message = '<br /><strong style="color: red">You have to agree that you have read the update notifications.</strong>';
+			}
 		}
-		else
-		{
+
+		if (!$successful_update) {
 			$current_version = $settings['panel']['version'];
 			$new_version = $version;

-			$ui_text = $lng['update']['update_information'];
+			$ui_text = $lng['update']['update_information']['part_a'];
 			$ui_text = str_replace('%curversion', $current_version, $ui_text);
 			$ui_text = str_replace('%newversion', $new_version, $ui_text);
 			$update_information = $ui_text;

-			eval("echo \"" . getTemplate("update/index") . "\";");
+			include_once './install/updates/preconfig.php';
+			$preconfig = getPreConfig($current_version);
+			if ($preconfig != '') {
+				$update_information .= '<br />' . $preconfig . $message;
+			}
+
+			$update_information .= $lng['update']['update_information']['part_b'];
+
+			eval("echo \"" . getTemplate('update/index') . "\";");
 		}
-	}
-	else
-	{
+	} else {
 		/*
 		 * @TODO version-webcheck check here
 		 */
-
 		$success_message = $lng['update']['noupdatesavail'];
-		$redirect_url = 'admin_index.php';
-		eval("echo \"" . getTemplate("update/noupdatesavail") . "\";");
+		$redirect_url = 'admin_index.php?s=' . $s;
+		eval("echo \"" . getTemplate('update/noupdatesavail') . "\";");
 	}
 }
-
-?>
--- a/cache/.gitignore
+++ b/cache/.gitignore
@@ -0,0 +1 @@
+*
--- a/cache/.keep
+++ b/cache/.keep
--- a/css/jquery-ui.min.css
+++ b/css/jquery-ui.min.css
--- a/css/jquery.jqplot.min.css
+++ b/css/jquery.jqplot.min.css
@@ -0,0 +1 @@
+.jqplot-target{position:relative;color:#666;font-family:"Trebuchet MS",Arial,Helvetica,sans-serif;font-size:1em}.jqplot-axis{font-size:.75em}.jqplot-xaxis{margin-top:10px}.jqplot-x2axis{margin-bottom:10px}.jqplot-yaxis{margin-right:10px}.jqplot-y2axis,.jqplot-y3axis,.jqplot-y4axis,.jqplot-y5axis,.jqplot-y6axis,.jqplot-y7axis,.jqplot-y8axis,.jqplot-y9axis,.jqplot-yMidAxis{margin-left:10px;margin-right:10px}.jqplot-axis-tick,.jqplot-xaxis-tick,.jqplot-yaxis-tick,.jqplot-x2axis-tick,.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick,.jqplot-yMidAxis-tick{position:absolute;white-space:pre}.jqplot-xaxis-tick{top:0;left:15px;vertical-align:top}.jqplot-x2axis-tick{bottom:0;left:15px;vertical-align:bottom}.jqplot-yaxis-tick{right:0;top:15px;text-align:right}.jqplot-yaxis-tick.jqplot-breakTick{right:-20px;margin-right:0;padding:1px 5px 1px 5px;z-index:2;font-size:1.5em}.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{left:0;top:15px;text-align:left}.jqplot-yMidAxis-tick{text-align:center;white-space:nowrap}.jqplot-xaxis-label{margin-top:10px;font-size:11pt;position:absolute}.jqplot-x2axis-label{margin-bottom:10px;font-size:11pt;position:absolute}.jqplot-yaxis-label{margin-right:10px;font-size:11pt;position:absolute}.jqplot-yMidAxis-label{font-size:11pt;position:absolute}.jqplot-y2axis-label,.jqplot-y3axis-label,.jqplot-y4axis-label,.jqplot-y5axis-label,.jqplot-y6axis-label,.jqplot-y7axis-label,.jqplot-y8axis-label,.jqplot-y9axis-label{font-size:11pt;margin-left:10px;position:absolute}.jqplot-meterGauge-tick{font-size:.75em;color:#999}.jqplot-meterGauge-label{font-size:1em;color:#999}table.jqplot-table-legend{margin-top:12px;margin-bottom:12px;margin-left:12px;margin-right:12px}table.jqplot-table-legend,table.jqplot-cursor-legend{background-color:rgba(255,255,255,0.6);border:1px solid #ccc;position:absolute;font-size:.75em}td.jqplot-table-legend{vertical-align:middle}td.jqplot-seriesToggle:hover,td.jqplot-seriesToggle:active{cursor:pointer}.jqplot-table-legend .jqplot-series-hidden{text-decoration:line-through}div.jqplot-table-legend-swatch-outline{border:1px solid #ccc;padding:1px}div.jqplot-table-legend-swatch{width:0;height:0;border-top-width:5px;border-bottom-width:5px;border-left-width:6px;border-right-width:6px;border-top-style:solid;border-bottom-style:solid;border-left-style:solid;border-right-style:solid}.jqplot-title{top:0;left:0;padding-bottom:.5em;font-size:1.2em}table.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em}.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-highlighter-tooltip,.jqplot-canvasOverlay-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-point-label{font-size:.75em;z-index:2}td.jqplot-cursor-legend-swatch{vertical-align:middle;text-align:center}div.jqplot-cursor-legend-swatch{width:1.2em;height:.7em}.jqplot-error{text-align:center}.jqplot-error-message{position:relative;top:46%;display:inline-block}div.jqplot-bubble-label{font-size:.8em;padding-left:2px;padding-right:2px;color:rgb(20%,20%,20%)}div.jqplot-bubble-label.jqplot-bubble-label-highlight{background:rgba(90%,90%,90%,0.7)}div.jqplot-noData-container{text-align:center;background-color:rgba(96%,96%,96%,0.3)}
--- a/customer_aps.php
+++ b/customer_aps.php
@@ -14,21 +14,21 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

-// Required code
-
 define('AREA', 'customer');
-require ("./lib/init.php");
+require ('./lib/init.php');
+
 $Id = 0;
+if (isset($_GET['id'])) {
+    $Id = (int)$_GET['id'];
+}
+if (isset($_POST['id'])) {
+    $Id = (int)$_POST['id'];
+}

-if(isset($_GET['id']))$Id = (int)$_GET['id'];
-
-if(isset($_POST['id']))$Id = (int)$_POST['id'];
-eval("echo \"" . getTemplate("aps/header") . "\";");
+eval("echo \"" . getTemplate('aps/header') . "\";");
 $Aps = new ApsParser($userinfo, $settings, $db);
 $Aps->MainHandler($action);
-eval("echo \"" . getTemplate("aps/footer") . "\";");
-
-?>
+eval("echo \"" . getTemplate('aps/footer') . "\";");
--- a/customer_autoresponder.php
+++ b/customer_autoresponder.php
@@ -14,67 +14,55 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

-// Required code
-
 define('AREA', 'customer');
-require ("./lib/init.php");
+require('./lib/init.php');

-// Create new autoresponder
-
-if($action == "add")
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+if ($action == 'add') {
+	// Create new autoresponder
+	if (isset($_POST['send'])
+	   && $_POST['send'] == 'send'
+	) {
 		$account = trim($_POST['account']);
 		$subject = trim($_POST['subject']);
 		$message = trim($_POST['message']);
-		
+
 		$date_from_off = isset($_POST['date_from_off']) ? -1 : 0;
 		$date_until_off = isset($_POST['date_until_off']) ? -1 : 0;
-		
+
 		/*
-		 * @TODO validate date (DD-MM-YYYY) 
-		 */	
+		 * @TODO validate date (DD-MM-YYYY)
+		 */
 		$ts_from = -1;
 		$ts_until = -1;

-		if($date_from_off > -1)
-		{
+		if ($date_from_off > -1) {
 			$date_from = $_POST['date_from'];
 			$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
 		}
-		if($date_until_off > -1)
-		{
+		if ($date_until_off > -1) {
 			$date_until = $_POST['date_until'];
 			$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
 		}

-		if(empty($account)
+		if (empty($account)
 		   || empty($subject)
-		   || empty($message))
-		{
+		   || empty($message)
+		) {
 			standard_error('missingfields');
 		}

 		// Does account exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
-		{
+		if ($db->num_rows($result) == 0) {
 			standard_error('accountnotexisting');
 		}

 		// Does autoresponder exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 1)
-		{
+		if ($db->num_rows($result) == 1) {
 			standard_error('autoresponderalreadyexists');
 		}

@@ -87,102 +75,87 @@ if($action == "add")
 			`subject` = '" . $db->escape($subject) . "',
 			`customerid` = '" . $db->escape((int)$userinfo['customerid']) . "'
 			");
+		$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_autoresponder_used` = `email_autoresponder_used` + 1 WHERE `customerid` = '" . $db->escape((int)$userinfo['customerid']). "'");
 		redirectTo($filename, Array('s' => $s));
 	}

 	// Get accounts
-
 	$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` NOT IN (SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "`) ORDER BY email ASC");
-
-	if($db->num_rows($result) == 0)
-	{
+	if ($db->num_rows($result) == 0) {
 		standard_error('noemailaccount');
 	}

 	$accounts = '';
-
-	while($row = $db->fetch_array($result))
-	{
-		$accounts.= "<option value=\"" . $row['email'] . "\">" . $row['email'] . "</option>";
+	while ($row = $db->fetch_array($result)) {
+		$accounts .= '<option value="' . $row['email'] . '">' . $row['email'] . '</option>';
 	}
-	
+
 	$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
-	$date_until_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);
+	$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, '-1', true, true);

-	eval("echo \"" . getTemplate("email/autoresponder_add") . "\";");
-}
+	//$isactive = makeyesno('active', '1', '0', '1');

-// Edit autoresponder
+	$autoresponder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_add.php';
+	$autoresponder_add_form = htmlform::genHTMLForm($autoresponder_add_data);

-else
+	$title = $autoresponder_add_data['autoresponder_add']['title'];
+	$image = $autoresponder_add_data['autoresponder_add']['image'];

-if($action == "edit")
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+	eval("echo \"" . getTemplate('autoresponder/autoresponder_add') . "\";");
+} elseif ($action == 'edit') {
+	// Edit autoresponder
+	if (isset($_POST['send'])
+	   && $_POST['send'] == 'send'
+	) {
 		$account = trim($_POST['account']);
 		$subject = trim($_POST['subject']);
 		$message = trim($_POST['message']);

 		$date_from_off = isset($_POST['date_from_off']) ? -1 : 0;
 		$date_until_off = isset($_POST['date_until_off']) ? -1 : 0;
-				
+
 		/*
-		 * @TODO validate date (DD-MM-YYYY) 
-		 */	
+		 * @TODO validate date (DD-MM-YYYY)
+		 */
 		$ts_from = -1;
 		$ts_until = -1;

-		if($date_from_off > -1)
-		{
+		if ($date_from_off > -1) {
 			$date_from = $_POST['date_from'];
 			$ts_from = mktime(0, 0, 0, substr($date_from, 3, 2), substr($date_from, 0, 2), substr($date_from, 6, 4));
 		}
-		if($date_until_off > -1)
-		{
+		if ($date_until_off > -1) {
 			$date_until = $_POST['date_until'];
 			$ts_until = mktime(0, 0, 0, substr($date_until, 3, 2), substr($date_until, 0, 2), substr($date_until, 6, 4));
-		}	
+		}

-		if(empty($account)
+		if (empty($account)
 		   || empty($subject)
-		   || empty($message))
-		{
+		   || empty($message)
+		) {
 			standard_error('missingfields');
 		}

 		// Does account exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
+		if ($db->num_rows($result) == 0)
 		{
 			standard_error('accountnotexisting');
 		}

 		// Does autoresponder exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
-		{
+		if ($db->num_rows($result) == 0) {
 			standard_error('invalidautoresponder');
 		}

-		$ResponderActive = 0;
-
-		if(isset($_POST['active'])
-		   && $_POST['active'] == '1')
-		{
-			$ResponderActive = 1;
-		}
+		$ResponderActive = (isset($_POST['active']) && $_POST['active'] == '1') ? 1 : 0;

 		$db->query("UPDATE `" . TABLE_MAIL_AUTORESPONDER . "`
 			SET `message` = '" . $db->escape($message) . "',
 			`enabled` = '" . (int)$ResponderActive . "',
 			`date_from` = '" . (int)$ts_from . "',
-			`date_until` = '" . (int)$ts_until . "',			
+			`date_until` = '" . (int)$ts_until . "',
 			`subject` = '" . $db->escape($subject) . "'
 			WHERE `email` = '" . $db->escape($account) . "'
 			AND `customerid` = '" . $db->escape((int)$userinfo['customerid']) . "'
@@ -193,71 +166,55 @@ if($action == "edit")
 	$email = trim(htmlspecialchars($_GET['email']));

 	// Get account data
-
 	$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($email) . "' LIMIT 0,1");
-
-	if($db->num_rows($result) == 0)
-	{
+	if ($db->num_rows($result) == 0) {
 		standard_error('invalidautoresponder');
 	}

 	$row = $db->fetch_array($result);
 	$subject = htmlspecialchars($row['subject']);
 	$message = htmlspecialchars($row['message']);
-	
+
 	$date_from = (int)$row['date_from'];
 	$date_until = (int)$row['date_until'];
-	
-	if($date_from == -1)
-	{
+
+	if ($date_from == -1) {
 		$deactivated = '-1';
-	}
-	else
-	{
+		$date_from = '';
+	} else {
 		$deactivated = '0';
 		$date_from = date('d-m-Y', $date_from);
 	}
 	$date_from_off = makecheckbox('date_from_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
-	
-	if($date_until == -1)
-	{
+
+	if ($date_until == -1) {
 		$deactivated = '-1';
-		$date_until = '-1';
-	}
-	else
-	{
+		$date_until = '';
+	} else {
 		$deactivated = '0';
 		$date_until = date('d-m-Y', $date_until);
 	}
-	$date_from_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);
+	$date_until_off = makecheckbox('date_until_off', $lng['panel']['not_activated'], '-1', false, $deactivated, true, true);

-	$checked = '';
+	//$isactive = makeyesno('active', '1', '0', $row['enabled']);

-	if($row['enabled'] == 1)
-	{
-		$checked = "checked=\"checked\"";
-	}
+	$autoresponder_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/autoresponder/formfield.autoresponder_edit.php';
+	$autoresponder_edit_form = htmlform::genHTMLForm($autoresponder_edit_data);

-	eval("echo \"" . getTemplate("email/autoresponder_edit") . "\";");
-}
+	$title = $autoresponder_edit_data['autoresponder_edit']['title'];
+	$image = $autoresponder_edit_data['autoresponder_edit']['image'];

-// Delete autoresponder
-
-else
-
-if($action == "delete")
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+	eval("echo \"" . getTemplate('autoresponder/autoresponder_edit') . "\";");
+} elseif ($action == 'delete') {
+	// Delete autoresponder
+	if (isset($_POST['send'])
+	   && $_POST['send'] == 'send'
+	) {
 		$account = trim($_POST['account']);

 		// Does autoresponder exist?
-
 		$result = $db->query("SELECT `email` FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' AND `email` = '" . $db->escape($account) . "' LIMIT 0,1");
-
-		if($db->num_rows($result) == 0)
-		{
+		if ($db->num_rows($result) == 0) {
 			standard_error('invalidautoresponder');
 		}

@@ -265,42 +222,31 @@ if($action == "delete")
 			WHERE `email` = '" . $db->escape($account) . "'
 			AND `customerid` = '" . $db->escape((int)$userinfo['customerid']) . "'
 			");
+		$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_autoresponder_used` = `email_autoresponder_used` - 1 WHERE `customerid` = '" . $db->escape((int)$userinfo['customerid']). "'");
 		redirectTo($filename, Array('s' => $s));
 	}

 	$email = trim(htmlspecialchars($_GET['email']));
 	ask_yesno('autoresponderdelete', $filename, array('action' => $action, 'account' => $email));
-}
-
-// List existing autoresponders
-
-else 
-{
+} else {
+	// List existing autoresponders
 	$autoresponder = '';
+	$count = 0;
 	$result = $db->query("SELECT * FROM `" . TABLE_MAIL_AUTORESPONDER . "` WHERE `customerid` = '" . (int)$userinfo['customerid'] . "' ORDER BY email ASC");

-	while($row = $db->fetch_array($result))
-	{
-		if($row['date_from'] == -1 && $row['date_until'] == -1)
-		{
+	while ($row = $db->fetch_array($result)) {
+		if ($row['date_from'] == -1 && $row['date_until'] == -1) {
 			$activated_date = $lng['panel']['not_activated'];
-		}
-		elseif($row['date_from'] == -1 && $row['date_until'] != -1)
-		{
+		} elseif($row['date_from'] == -1 && $row['date_until'] != -1) {
 			$activated_date = $lng['autoresponder']['date_until'].': '.date('d-m-Y', $row['date_until']);
-		}
-		elseif($row['date_from'] != -1 && $row['date_until'] == -1)
-		{
+		} elseif($row['date_from'] != -1 && $row['date_until'] == -1) {
 			$activated_date = $lng['autoresponder']['date_from'].': '.date('d-m-Y', $row['date_from']);
-		}	
-		else
-		{
+		} else {
 			$activated_date = date('d-m-Y', $row['date_from']) . ' - ' . date('d-m-Y', $row['date_until']);
 		}
-		eval("\$autoresponder.=\"" . getTemplate("email/autoresponder_autoresponder") . "\";");
-	}	
+		eval("\$autoresponder.=\"" . getTemplate('autoresponder/autoresponder_autoresponder') . "\";");
+		$count++;
+	}

-	eval("echo \"" . getTemplate("email/autoresponder") . "\";");
+	eval("echo \"" . getTemplate('autoresponder/autoresponder') . "\";");
 }
-
-?>
--- a/customer_domains.php
+++ b/customer_domains.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -45,9 +45,7 @@ elseif($page == 'domains')
 	{
 		$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains");
 		$fields = array(
-			'd.domain' => $lng['domains']['domainname'],
-			'd.documentroot' => $lng['panel']['path'],
-			'd.aliasdomain' => $lng['domains']['aliasdomain']
+			'd.domain' => $lng['domains']['domainname']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$result = $db->query("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id` LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`email_only`='0' AND `d`.`id` <> " . (int)$userinfo['standardsubdomain'] . " " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
@@ -68,22 +66,39 @@ elseif($page == 'domains')
 			$row['domainalias'] = $idna_convert->decode($row['domainalias']);

 			if($row['parentdomainid'] == '0'
-			   && $row['iswildcarddomain'] != '1'
 			   && $row['caneditdomain'] == '1')
 			{
 				$parentdomains_count++;
 			}

-			$domains_count++;
-			$domainparts = explode('.', $row['domain']);
-			$domainparts = array_reverse($domainparts);
-			$sortkey = '';
-			foreach($domainparts as $key => $part)
-			{
-				$sortkey.= $part . '.';
+			/**
+			 * check for set ssl-certs to show different state-icons
+			 */
+			// nothing (ssl_global)
+			$row['domain_hascert'] = 0;
+			$ssl_result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`='".(int)$row['id']."';");
+			if (is_array($ssl_result)
+				&& isset($ssl_result['ssl_cert_file'])
+				&& $ssl_result['ssl_cert_file'] != ''
+			) {
+				// own certificate (ssl_customer_green)
+				$row['domain_hascert'] = 1;
+			} else {
+				// check if it's parent has one set (shared)
+				if ($row['parentdomainid'] != 0) {
+					$ssl_result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid`='".(int)$row['parentdomainid']."';");
+					if (is_array($ssl_result)
+							&& isset($ssl_result['ssl_cert_file'])
+							&& $ssl_result['ssl_cert_file'] != ''
+					) {
+						// parent has a certificate (ssl_shared)
+						$row['domain_hascert'] = 2;
+					}
+				}
 			}

-			$domain_array[$sortkey] = $row;
+			$domains_count++;
+			$domain_array[$row['domain']] = $row;
 		}

 		ksort($domain_array);
@@ -125,6 +140,11 @@ elseif($page == 'domains')
 			if($paging->checkDisplay($i))
 			{
 				$row = htmlentities_array($domain_array[$sortkey]);
+				if($settings['system']['awstats_enabled'] == '1') {
+					$statsapp = 'awstats';
+				} else {
+					$statsapp = 'webalizer';
+				}
 				eval("\$domains.=\"" . getTemplate("domains/domains_delimiter") . "\";");

 				if($paging->sortfield == 'd.domain'
@@ -145,6 +165,14 @@ elseif($page == 'domains')
 						$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
 					}

+					// get ssl-ips if activated
+					$show_ssledit = false;
+					if ($settings['system']['use_ssl'] == '1'
+							&& domainHasSslIpPort($row['id'])
+							&& $row['caneditdomain'] == '1'
+					) {
+						$show_ssledit = true;
+					}
 					$row = htmlentities_array($row);
 					eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
 				}
@@ -178,11 +206,22 @@ elseif($page == 'domains')
 					}
 				}

+				/*
+				 * check for APS packages used with this domain, #110
+				 */
+				if(domainHasApsInstances($id))
+				{
+					standard_error('domains_cantdeletedomainwithapsinstances');
+				}
+
 				$log->logAction(USR_ACTION, LOG_INFO, "deleted subdomain '" . $idna_convert->decode($result['domain']) . "'");
 				$result = $db->query("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 				$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`-1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				inserttask('1');
+
+				// Using nameserver, insert a task which rebuilds the server config
 				inserttask('4');
+
 				redirectTo($filename, Array('page' => $page, 's' => $s));
 			}
 			else
@@ -205,17 +244,19 @@ elseif($page == 'domains')
 			{
 				$subdomain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['subdomain'], 'subdomain', '', 'subdomainiswrong')));
 				$domain = $idna_convert->encode($_POST['domain']);
-				$domain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($domain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `iswildcarddomain`='0' AND `caneditdomain`='1' ");
+				$domain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($domain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `caneditdomain`='1' ");
 				$completedomain = $subdomain . '.' . $domain;
 				$completedomain_check = $db->query_first("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($completedomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "' AND `email_only`='0' AND `caneditdomain` = '1'");
 				$aliasdomain = intval($_POST['alias']);
 				$aliasdomain_check = array(
 					'id' => 0
 				);
+				$_doredirect = false;

 				if($aliasdomain != 0)
-				{
-					$aliasdomain_check = $db->query_first('SELECT `id` FROM `' . TABLE_PANEL_DOMAINS . '` `d`,`' . TABLE_PANEL_CUSTOMERS . '` `c` WHERE `d`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`aliasdomain` IS NULL AND `d`.`id`<>`c`.`standardsubdomain` AND `c`.`customerid`=\'' . (int)$userinfo['customerid'] . '\' AND `d`.`id`=\'' . (int)$aliasdomain . '\'');
+				{ 
+					// also check ip/port combination to be the same, #176
+					$aliasdomain_check = $db->query_first("SELECT `d`.`id` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` = '".(int)$aliasdomain."' AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`customerid` = '" . (int)$userinfo['customerid'] . "' AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '".(int)$aliasdomain."') GROUP BY `d`.`domain` ORDER BY `d`.`domain` ASC;");
 				}

 				if(isset($_POST['url'])
@@ -223,6 +264,7 @@ elseif($page == 'domains')
 				   && validateUrl($idna_convert->encode($_POST['url'])))
 				{
 					$path = $_POST['url'];
+					$_doredirect = true;
 				}
 				else
 				{
@@ -232,8 +274,25 @@ elseif($page == 'domains')
 				if(!preg_match('/^https?\:\/\//', $path)
 				   || !validateUrl($idna_convert->encode($path)))
 				{
-					$path = $userinfo['documentroot'] . '/' . $path;
-					$path = makeCorrectDir($path);
+					// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+					// set default path to subdomain or domain name
+					if((($path == '') || ($path == '/'))
+						&& $settings['system']['documentroot_use_default_value'] == 1)
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
+					}
+					else
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
+					}
+					if (strstr($path, ":") !== FALSE)
+					{
+						standard_error('pathmaynotcontaincolon');
+					}
+				}
+				else
+				{
+					$_doredirect = true;
 				}

 				if(isset($_POST['openbasedir_path'])
@@ -286,17 +345,51 @@ elseif($page == 'domains')
 				}
 				else
 				{
-					$result = $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` (`customerid`, `domain`, `documentroot`, `ipandport`, `aliasdomain`, `parentdomainid`, `isemaildomain`, `openbasedir`, `openbasedir_path`, `safemode`, `speciallogfile`, `specialsettings`, `ssl_redirect`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($completedomain) . "', '" . $db->escape($path) . "', '" . $db->escape($domain_check['ipandport']) . "', " . (($aliasdomain != 0) ? "'" . $db->escape($aliasdomain) . "'" : "NULL") . ", '" . (int)$domain_check['id'] . "', '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', '" . $db->escape($domain_check['openbasedir']) . "', '" . $db->escape($openbasedir_path) . "', '" . $db->escape($domain_check['safemode']) . "', '" . $db->escape($domain_check['speciallogfile']) . "', '" . $db->escape($domain_check['specialsettings']) . "', '" . $ssl_redirect . "')");
+					// get the phpsettingid from parentdomain, #107
+					$phpsid_result = $db->query_first("SELECT `phpsettingid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `id` = '".(int)$domain_check['id']."'");
+					if(!isset($phpsid_result['phpsettingid'])
+						|| (int)$phpsid_result['phpsettingid'] <= 0
+					) {
+						// assign default config
+						$phpsid_result['phpsettingid'] = 1;
+					}
+
+					$result = $db->query("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET 
+								`customerid` = '" . (int)$userinfo['customerid'] . "',
+								`domain` = '" . $db->escape($completedomain) . "', 
+								`documentroot` = '" . $db->escape($path) . "', 
+								`aliasdomain` = ".(($aliasdomain != 0) ? "'" . $db->escape($aliasdomain) . "'" : "NULL") .", 
+								`parentdomainid` = '" . (int)$domain_check['id'] . "', 
+								`isemaildomain` = '" . ($domain_check['subcanemaildomain'] == '3' ? '1' : '0') . "', 
+								`openbasedir` = '" . $db->escape($domain_check['openbasedir']) . "', 
+								`openbasedir_path` = '" . $db->escape($openbasedir_path) . "',
+								`speciallogfile` = '" . $db->escape($domain_check['speciallogfile']) . "', 
+								`specialsettings` = '" . $db->escape($domain_check['specialsettings']) . "', 
+								`ssl_redirect` = '" . $ssl_redirect . "', 
+								`phpsettingid` = '" . $phpsid_result['phpsettingid'] . "'");
+
+					$result = $db->query("INSERT INTO `".TABLE_DOMAINTOIP."` (`id_domain`, `id_ipandports`) SELECT LAST_INSERT_ID(), `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '" . (int)$domain_check['id'] . "';");
+
+					if($_doredirect)
+					{
+						$did = $db->insert_id();
+						$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : $settings['customredirect']['default'];
+						addRedirectToDomain($did, $redirect);
+					}
+
 					$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `subdomains_used`=`subdomains_used`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 					$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
 					inserttask('1');
+
+					// Using nameserver, insert a task which rebuilds the server config
 					inserttask('4');
+
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
 			}
 			else
 			{
-				$result = $db->query("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `iswildcarddomain`='0' AND `caneditdomain`='1' ORDER BY `domain` ASC");
+				$result = $db->query("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `email_only`='0' AND `caneditdomain`='1' ORDER BY `domain` ASC");
 				$domains = '';

 				while($row = $db->fetch_array($result))
@@ -312,9 +405,32 @@ elseif($page == 'domains')
 					$aliasdomains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
 				}

-				$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
+				$redirectcode = '';
+				if($settings['customredirect']['enabled'] == '1')
+				{
+					$codes = getRedirectCodesArray();
+					foreach($codes as $rc)
+					{
+						$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $settings['customredirect']['default']);
+					}
+				}
+
+				// check if we at least have one ssl-ip/port, #1179
+				$ssl_ipsandports = '';
+				$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
+				if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
+					$ssl_ipsandports = 'notempty';
+				}
+
 				$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
 				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
+
+				$subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php';
+				$subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data);
+
+				$title = $subdomain_add_data['domain_add']['title'];
+				$image = $subdomain_add_data['domain_add']['image'];
+
 				eval("echo \"" . getTemplate("domains/domains_add") . "\";");
 			}
 		}
@@ -322,9 +438,10 @@ elseif($page == 'domains')
 	elseif($action == 'edit'
 	       && $id != 0)
 	{
-		$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir_path` ,`pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
+		$result = $db->query_first("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`wwwserveralias`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `pd`.`subcanemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd` WHERE `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `d`.`id`='" . (int)$id . "' AND ((`d`.`parentdomainid`!='0' AND `pd`.`id`=`d`.`parentdomainid`) OR (`d`.`parentdomainid`='0' AND `pd`.`id`=`d`.`id`)) AND `d`.`caneditdomain`='1'");
 		$alias_check = $db->query_first('SELECT COUNT(`id`) AS count FROM `' . TABLE_PANEL_DOMAINS . '` WHERE `aliasdomain`=\'' . (int)$result['id'] . '\'');
 		$alias_check = $alias_check['count'];
+		$_doredirect = false;

 		if(isset($result['customerid'])
 		   && $result['customerid'] == $userinfo['customerid'])
@@ -337,6 +454,7 @@ elseif($page == 'domains')
 				   && validateUrl($idna_convert->encode($_POST['url'])))
 				{
 					$path = $_POST['url'];
+					$_doredirect = true;
 				}
 				else
 				{
@@ -346,30 +464,37 @@ elseif($page == 'domains')
 				if(!preg_match('/^https?\:\/\//', $path)
 				   || !validateUrl($idna_convert->encode($path)))
 				{
-					$path = $userinfo['documentroot'] . '/' . $path;
-					$path = makeCorrectDir($path);
+					// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
+					// set default path to subdomain or domain name
+					if((($path == '') || ($path == '/'))
+						&& $settings['system']['documentroot_use_default_value'] == 1)
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
+					}
+					else
+					{
+						$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
+					}
+					if (strstr($path, ":") !== FALSE)
+					{
+						standard_error('pathmaynotcontaincolon');
+					}
+				}
+				else
+				{
+					$_doredirect = true;
 				}

 				$aliasdomain = intval($_POST['alias']);

-				if(isset($_POST['iswildcarddomain'])
-				   && $_POST['iswildcarddomain'] == '1'
+				if(isset($_POST['selectserveralias'])
 				   && $result['parentdomainid'] == '0'
-				   && $userinfo['subdomains'] != '0')
-				{
-					$wildcarddomaincheck = $db->query("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `parentdomainid` = '" . (int)$result['id'] . "'");
-
-					if($db->num_rows($wildcarddomaincheck) != '0')
-					{
-						standard_error('firstdeleteallsubdomains');
-						exit;
-					}
-
-					$iswildcarddomain = '1';
-				}
-				else
-				{
+				) {
+					$iswildcarddomain = ($_POST['selectserveralias'] == '0') ? '1' : '0';
+					$wwwserveralias = ($_POST['selectserveralias'] == '1') ? '1' : '0';
+				} else {
 					$iswildcarddomain = '0';
+					$wwwserveralias = '0';
 				}

 				if($result['parentdomainid'] != '0'
@@ -431,17 +556,36 @@ elseif($page == 'domains')
 						$log->logAction(USR_ACTION, LOG_NOTICE, "automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'");
 					}

+					if($_doredirect)
+					{
+						$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : false;
+						updateRedirectOfDomain($id, $redirect);
+					}
+
 					if($path != $result['documentroot']
 					   || $isemaildomain != $result['isemaildomain']
+					   || $wwwserveralias != $result['wwwserveralias']
 					   || $iswildcarddomain != $result['iswildcarddomain']
 					   || $aliasdomain != $result['aliasdomain']
 					   || $openbasedir_path != $result['openbasedir_path']
 					   || $ssl_redirect != $result['ssl_redirect'])
 					{
 						$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
-						$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `documentroot`='" . $db->escape($path) . "', `isemaildomain`='" . (int)$isemaildomain . "', `iswildcarddomain`='" . (int)$iswildcarddomain . "', `aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",`openbasedir_path`='" . $db->escape($openbasedir_path) . "', `ssl_redirect`='" . $ssl_redirect . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+						$result = $db->query("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
+							`documentroot`='" . $db->escape($path) . "',
+							`isemaildomain`='" . (int)$isemaildomain . "',
+							`wwwserveralias`='" . (int)$wwwserveralias . "',
+							`iswildcarddomain`='" . (int)$iswildcarddomain . "',
+							`aliasdomain`=" . (($aliasdomain != 0 && $alias_check == 0) ? '\'' . $db->escape($aliasdomain) . '\'' : 'NULL') . ",
+							`openbasedir_path`='" . $db->escape($openbasedir_path) . "',
+							`ssl_redirect`='" . $ssl_redirect . "'
+							WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'"
+						);
 						inserttask('1');
+
+						// Using nameserver, insert a task which rebuilds the server config
 						inserttask('4');
+
 					}

 					redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -450,8 +594,10 @@ elseif($page == 'domains')
 			else
 			{
 				$result['domain'] = $idna_convert->decode($result['domain']);
+  
 				$domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true);
-				$result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id`<>'" . (int)$result['id'] . "' AND `c`.`standardsubdomain`<>`d`.`id` AND `d`.`customerid`='" . (int)$userinfo['customerid'] . "' AND `c`.`customerid`=`d`.`customerid` ORDER BY `d`.`domain` ASC");
+				// also check ip/port combination to be the same, #176
+				$result_domains = $db->query("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip` WHERE `d`.`aliasdomain` IS NULL AND `d`.`id` <> '".(int)$result['id']."' AND `c`.`standardsubdomain` <> `d`.`id` AND `d`.`customerid` = '" . (int)$userinfo['customerid'] . "' AND `c`.`customerid` = `d`.`customerid` AND `d`.`id` = `dip`.`id_domain` AND `dip`.`id_ipandports` IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."` WHERE `id_domain` = '".(int)$result['id']."') GROUP BY `d`.`domain` ORDER BY `d`.`domain` ASC");

 				while($row_domain = $db->fetch_array($result_domains))
 				{
@@ -460,10 +606,17 @@ elseif($page == 'domains')

 				if(preg_match('/^https?\:\/\//', $result['documentroot'])
 				   && validateUrl($idna_convert->encode($result['documentroot']))
-				   && $settings['panel']['pathedit'] == 'Dropdown')
-				{
-					$urlvalue = $result['documentroot'];
-					$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
+				) {
+					if($settings['panel']['pathedit'] == 'Dropdown')
+					{
+						$urlvalue = $result['documentroot'];
+						$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
+					}
+					else
+					{
+						$urlvalue = '';
+						$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot'], true);						
+					}
 				}
 				else
 				{
@@ -471,15 +624,52 @@ elseif($page == 'domains')
 					$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']);
 				}

-				$ssl_redirect = makeyesno('ssl_redirect', '1', '0', $result['ssl_redirect']);
-				$iswildcarddomain = makeyesno('iswildcarddomain', '1', '0', $result['iswildcarddomain']);
-				$isemaildomain = makeyesno('isemaildomain', '1', '0', $result['isemaildomain']);
+				$redirectcode = '';
+				if($settings['customredirect']['enabled'] == '1')
+				{
+					$def_code = getDomainRedirectId($id);
+					$codes = getRedirectCodesArray();
+					foreach($codes as $rc)
+					{
+						$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $def_code);
+					}
+				}
+
+				// check if we at least have one ssl-ip/port, #1179
+				$ssl_ipsandports = '';
+				$resultX = $db->query_first("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
+				if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
+					$ssl_ipsandports = 'notempty';
+				}
+
 				$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
+
+				// create serveralias options
+				$serveraliasoptions = "";
+				$_value = '2';
+				if ($result['iswildcarddomain'] == '1') {
+					$_value = '0';
+				} elseif ($result['wwwserveralias'] == '1') {
+					$_value = '1';
+				}
+				$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_wildcard'], '0', $_value, true, true);
+				$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_www'], '1', $_value, true, true);
+				$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_none'], '2', $_value, true, true);
+
+				$resultips = $db->query("SELECT `p`.`ip` AS `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` `p` LEFT JOIN `".TABLE_DOMAINTOIP."` `dip` ON ( `dip`.`id_ipandports` = `p`.`id` ) WHERE `dip`.`id_domain` = '".(int)$result['id']."' GROUP BY `p`.`ip`");
+				$result_ipandport['ip'] = '';
+				while ($rowip = $db->fetch_array($resultips)) {
+					$result_ipandport['ip'] .= $rowip['ip'] . "<br />";
+				}
+
+				$domainip = $result_ipandport['ip'];
 				$result = htmlentities_array($result);

-				if($settings['system']['use_ssl'] == "1")
-				{
-				}
+				$subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php';
+				$subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data);
+
+				$title = $subdomain_edit_data['domain_edit']['title'];
+				$image = $subdomain_edit_data['domain_edit']['image'];

 				eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
 			}
@@ -490,5 +680,126 @@ elseif($page == 'domains')
 		}
 	}
 }
+elseif ($page == 'domainssleditor') {

-?>
+	if ($action == ''
+			|| $action == 'view'
+	) {
+		if (isset($_POST['send'])
+				&& $_POST['send'] == 'send'
+		) {
+
+			$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
+			$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
+			$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
+			$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
+			$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
+
+			if ($ssl_cert_file != '' && $ssl_key_file == '') {
+				standard_error('sslcertificateismissingprivatekey');
+			}
+
+			$do_verify = true;
+
+			// no cert-file given -> forget everything
+			if ($ssl_cert_file == '') {
+				$ssl_key_file = '';
+				$ssl_ca_file = '';
+				$ssl_cert_chainfile = '';
+				$do_verify = false;
+			}
+
+			// verify certificate content
+			if ($do_verify) {
+				// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
+				// openssl_x509_parse() returns information about the supplied x509cert, including fields such as 
+				// subject name, issuer name, purposes, valid from and valid to dates etc.
+				$cert_content = openssl_x509_parse($ssl_cert_file);
+
+				if (is_array($cert_content)
+						&& isset($cert_content['subject'])
+						&& isset($cert_content['subject']['CN'])
+				) {
+					// TODO self-signed certs might differ and don't need/want this
+					/*
+					$domain = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAINS."` WHERE `id`='".(int)$id."'");
+					if (strtolower($cert_content['subject']['CN']) != strtolower($idna_convert->decode($domain['domain']))) {
+						standard_error('sslcertificatewrongdomain');
+					}
+					*/
+
+					// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
+					// Checks whether the given key is the private key that corresponds to cert.
+					if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
+						standard_error('sslcertificateinvalidcertkeypair');
+					}
+
+					// check optional stuff
+					if ($ssl_ca_file != '') {
+						$ca_content = openssl_x509_parse($ssl_ca_file);
+						if (!is_array($ca_content)) {
+							// invalid
+							standard_error('sslcertificateinvalidca');
+						}
+					}
+					if ($ssl_cert_chainfile != '') {
+						$chain_content = openssl_x509_parse($ssl_cert_chainfile);
+						if (!is_array($chain_content)) {
+							// invalid
+							standard_error('sslcertificateinvalidchain');
+						}
+					}
+				} else {
+					standard_error('sslcertificateinvalidcert');
+				}
+			}
+
+			// Add/Update database entry
+			$qrystart = "UPDATE ";
+			$qrywhere = "WHERE ";
+			if ($do_insert) {
+				$qrystart = "INSERT INTO ";
+				$qrywhere = ", ";
+			}
+			$db->query($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
+					`ssl_cert_file` = '".$db->escape($ssl_cert_file)."',
+					`ssl_key_file` = '".$db->escape($ssl_key_file)."',
+					`ssl_ca_file` = '".$db->escape($ssl_ca_file)."',
+					`ssl_cert_chainfile` = '".$db->escape($ssl_cert_chainfile)."'
+					".$qrywhere." `domainid`='".(int)$id."';"
+			);
+
+			// insert task to re-generate webserver-configs (#1260)
+			inserttask('1');
+
+			// back to domain overview
+			redirectTo($filename, array('page' => 'domains', 's' => $s));
+		}
+
+		$result = $db->query_first("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
+			WHERE `domainid`='".(int)$id."';"
+		);
+
+		$do_insert = false;
+		// if no entry can be found, behave like we have empty values
+		if (!is_array($result) || !isset($result['ssl_cert_file'])) {
+			$result = array(
+				'ssl_cert_file' => '',
+				'ssl_key_file' => '',
+				'ssl_ca_file' => '',
+				'ssl_cert_chainfile' => ''
+			);
+			$do_insert = true;
+		}
+
+		$result = htmlentities_array($result);
+
+		$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
+		$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
+
+		$title = $ssleditor_data['domain_ssleditor']['title'];
+		$image = $ssleditor_data['domain_ssleditor']['image'];
+
+		eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
+	}
+}
--- a/customer_email.php
+++ b/customer_email.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -50,7 +50,7 @@ elseif($page == 'emails')
 			'm.destination' => $lng['emails']['forwarders']
 		);
 		$paging = new paging($userinfo, $db, TABLE_MAIL_VIRTUAL, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query('SELECT `m`.`id`, `m`.`domainid`, `m`.`email`, `m`.`email_full`, `m`.`iscatchall`, `u`.`quota`, `m`.`destination`, `m`.`popaccountid`, `d`.`domain` FROM `' . TABLE_MAIL_VIRTUAL . '` `m` LEFT JOIN `' . TABLE_PANEL_DOMAINS . '` `d` ON (`m`.`domainid` = `d`.`id`) LEFT JOIN `' . TABLE_MAIL_USERS . '` `u` ON (`m`.`popaccountid` = `u`.`id`) WHERE `m`.`customerid`="' . $db->escape($userinfo['customerid']) . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query('SELECT `m`.`id`, `m`.`domainid`, `m`.`email`, `m`.`email_full`, `m`.`iscatchall`, `u`.`quota`, `m`.`destination`, `m`.`popaccountid`, `d`.`domain`, `u`.`mboxsize` FROM `' . TABLE_MAIL_VIRTUAL . '` `m` LEFT JOIN `' . TABLE_PANEL_DOMAINS . '` `d` ON (`m`.`domainid` = `d`.`id`) LEFT JOIN `' . TABLE_MAIL_USERS . '` `u` ON (`m`.`popaccountid` = `u`.`id`) WHERE `m`.`customerid`="' . $db->escape($userinfo['customerid']) . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -66,6 +66,7 @@ elseif($page == 'emails')
 				$emails[$row['domain']] = array();
 			}

+			$row['mboxsize'] = size_readable($row['mboxsize']);
 			$emails[$row['domain']][$row['email_full']] = $row;
 		}

@@ -139,8 +140,10 @@ elseif($page == 'emails')
 			}
 		}

-		$emaildomains_count = $db->query_first("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' AND `isemaildomain`='1' ORDER BY `domain` ASC");
+		$emaildomains_count = $db->query_first("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `isemaildomain`='1' ORDER BY `domain` ASC");
 		$emaildomains_count = $emaildomains_count['count'];
+
+		$emailscount = $db->num_rows($result);
 		eval("echo \"" . getTemplate("email/emails") . "\";");
 	}
 	elseif($action == 'delete'
@@ -182,6 +185,12 @@ elseif($page == 'emails')
 					$number_forwarders = 0;
 				}

+				if(isset($_POST['delete_userfiles'])
+				  && (int)$_POST['delete_userfiles'] == 1)
+				{
+					inserttask('7', $userinfo['loginname'], $result['email_full']);
+				}
+
 				$db->query("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 				$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `emails_used`=`emails_used` - 1 , `email_forwarders_used` = `email_forwarders_used` - " . (int)$number_forwarders . " $update_users_query_addon WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				$log->logAction(USR_ACTION, LOG_INFO, "deleted email address '" . $result['email'] . "'");
@@ -189,7 +198,12 @@ elseif($page == 'emails')
 			}
 			else
 			{
-				ask_yesno('email_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full']));
+				if(maildirExists($result))  {
+					$show_checkbox = true;
+				} else {
+					$show_checkbox = false;
+				}
+				ask_yesno_withcheckbox('email_reallydelete', 'admin_customer_alsoremovemail', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full']), $show_checkbox);
 			}
 		}
 	}
@@ -224,7 +238,7 @@ elseif($page == 'emails')
 					standard_error('emailiswrong', $email_full);
 				}

-				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE ( `email`='" . $db->escape($email) . "' OR `email_full` = '" . $db->escape($email_full) . "' ) AND `customerid`='" . (int)$userinfo['customerid'] . "'");
+				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE (`email` = '" . strtolower($db->escape($email)) . "' OR `email_full` = '" . strtolower($db->escape($email_full)) . "') AND `customerid`='" . (int)$userinfo['customerid'] . "'");

 				if($email == ''
 				   || $email_full == ''
@@ -240,7 +254,7 @@ elseif($page == 'emails')
 				{
 					standard_error('maindomainnonexist', $domain);
 				}
-				elseif($email_check['email_full'] == $email_full)
+				elseif(strtolower($email_check['email_full']) == strtolower($email_full))
 				{
 					standard_error('emailexistalready', $email_full);
 				}
@@ -268,7 +282,20 @@ elseif($page == 'emails')
 					$domains.= makeoption($idna_convert->decode($row['domain']), $row['domain']);
 				}

-				$iscatchall = makeyesno('iscatchall', '1', '0', '0');
+				//$iscatchall = makeyesno('iscatchall', '1', '0', '0');
+
+				$email_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_add.php';
+
+				if ( $settings['catchall']['catchall_enabled'] != '1' )
+				{
+					unset($email_add_data['emails_add']['sections']['section_a']['fields']['iscatchall']);
+				}
+
+				$email_add_form = htmlform::genHTMLForm($email_add_data);
+
+				$title = $email_add_data['emails_add']['title'];
+				$image = $email_add_data['emails_add']['image'];
+
 				eval("echo \"" . getTemplate("email/emails_add") . "\";");
 			}
 		}
@@ -308,40 +335,60 @@ elseif($page == 'emails')

 			$destinations_count = count($result['destination']);
 			$result = htmlentities_array($result);
+
+			$email_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_edit.php';
+
+			if ( $settings['catchall']['catchall_enabled'] != '1' )
+			{
+				unset($email_edit_data['emails_edit']['sections']['section_a']['fields']['mail_catchall']);
+			}
+
+			$email_edit_form = htmlform::genHTMLForm($email_edit_data);
+
+			$title = $email_edit_data['emails_edit']['title'];
+			$image = $email_edit_data['emails_edit']['image'];
+			
 			eval("echo \"" . getTemplate("email/emails_edit") . "\";");
 		}
 	}
 	elseif($action == 'togglecatchall'
 	       && $id != 0)
 	{
-		$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-
-		if(isset($result['email'])
-		   && $result['email'] != '')
+		if ( $settings['catchall']['catchall_enabled'] == '1' )
 		{
-			if($result['iscatchall'] == '1')
-			{
-				$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
-			}
-			else
-			{
-				$email_parts = explode('@', $result['email_full']);
-				$email = '@' . $email_parts[1];
-				$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
+			$result = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid`, `popaccountid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");

-				if($email_check['email'] == $email)
+			if(isset($result['email'])
+			   && $result['email'] != '')
+			{
+				if($result['iscatchall'] == '1')
 				{
-					standard_error('youhavealreadyacatchallforthisdomain');
-					exit;
+					$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '" . $db->escape($result['email_full']) . "', `iscatchall` = '0' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['id'] . "'");
 				}
 				else
 				{
-					$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
-					$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
-				}
-			}
+					$email_parts = explode('@', $result['email_full']);
+					$email = '@' . $email_parts[1];
+					$email_check = $db->query_first("SELECT `id`, `email`, `email_full`, `iscatchall`, `destination`, `customerid` FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `email`='" . $db->escape($email) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");

-			redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
+					if($email_check['email'] == $email)
+					{
+						standard_error('youhavealreadyacatchallforthisdomain');
+						exit;
+					}
+					else
+					{
+						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `email` = '$email' , `iscatchall` = '1' WHERE `customerid`='" . $userinfo['customerid'] . "' AND `id`='" . $result['id'] . "'");
+						$log->logAction(USR_ACTION, LOG_INFO, "edited email address '" . $email . "'");
+					}
+				}
+
+				redirectTo($filename, Array('page' => $page, 'action' => 'edit', 'id' => $id, 's' => $s));
+			}
+		}
+		else
+		{
+			standard_error(array('operationnotpermitted', 'featureisdisabled'), 'Catchall');
 		}
 	}
 }
@@ -372,6 +419,7 @@ elseif($page == 'accounts')
 					$email_full = $result['email_full'];
 					$username = $idna_convert->decode($email_full);
 					$password = validate($_POST['email_password'], 'password');
+					$password = validatePassword($password);

 					if($settings['panel']['sendalternativemail'] == 1)
 					{
@@ -411,11 +459,42 @@ elseif($page == 'accounts')
 							$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
 						}

-						$db->query("INSERT INTO `" . TABLE_MAIL_USERS . "` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($email_full) . "', '" . $db->escape($username) . "', " . ($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "'," : '') . " ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_full . '/') . "', '" . (int)$settings['system']['vmail_uid'] . "', '" . (int)$settings['system']['vmail_gid'] . "', '" . (int)$result['domainid'] . "', 'y', '" . (int)$quota . "', '" . (int)$userinfo['imap'] . "', '" . (int)$userinfo['pop3'] . "')");
+						$cryptPassword = makeCryptPassword($password);
+
+						$email_user=substr($email_full,0,strrpos($email_full,"@"));
+						$email_domain=substr($email_full,strrpos($email_full,"@")+1);
+						$maildirname=trim($settings['system']['vmail_maildirname']);
+						// Add trailing slash to Maildir if needed
+						$maildirpath=$maildirname;
+						if (!empty($maildirname) and substr($maildirname,-1) != "/") $maildirpath.="/";
+
+						$db->query("INSERT INTO `" . TABLE_MAIL_USERS . 
+							"` (`customerid`, `email`, `username`, " . ($settings['system']['mailpwcleartext'] == '1' ? '`password`, ' : '') . " `password_enc`, `homedir`, `maildir`, `uid`, `gid`, `domainid`, `postfix`, `quota`, `imap`, `pop3`) ".
+							"VALUES (".
+							"'" . (int)$userinfo['customerid'] . "', ".
+							"'" . $db->escape($email_full) . "', ".
+							"'" . $db->escape($username) . "', " .
+							($settings['system']['mailpwcleartext'] == '1' ? "'" . $db->escape($password) . "', " : '') .
+							"'" . $db->escape($cryptPassword) . "', ".
+							"'" . $db->escape($settings['system']['vmail_homedir']) . "', '" . $db->escape($userinfo['loginname'] . '/' . $email_domain . "/" . $email_user . "/" . $maildirpath) . "', ".
+							"'" . (int)$settings['system']['vmail_uid'] . "', ".
+							"'" . (int)$settings['system']['vmail_gid'] . "', ".
+							"'" . (int)$result['domainid'] . "', ".
+							"'y', ".
+							"'" . (int)$quota . "', ".
+							"'" . (int)$userinfo['imap'] . "', ".
+							"'" . (int)$userinfo['pop3'] . "')");
+
 						$popaccountid = $db->insert_id();
 						$result['destination'].= ' ' . $email_full;
-						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET `destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', `popaccountid` = '" . (int)$popaccountid . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used`=`email_accounts_used`+1, `email_quota_used`=`email_quota_used`+" . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
+						$db->query("UPDATE `" . TABLE_MAIL_VIRTUAL . "` SET ".
+							"`destination` = '" . $db->escape(makeCorrectDestination($result['destination'])) . "', ".
+							"`popaccountid` = '" . (int)$popaccountid . "' ".
+							"WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+						$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET ".
+							"`email_accounts_used`=`email_accounts_used`+1, ".
+							"`email_quota_used`=`email_quota_used`+" . (int)$quota . " ".
+							"WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 						$log->logAction(USR_ACTION, LOG_INFO, "added email account for '" . $email_full . "'");
 						$replace_arr = array(
 							'EMAIL' => $email_full,
@@ -434,7 +513,7 @@ elseif($page == 'accounts')
 							$mail->Subject = $mail_subject;
 							$mail->AltBody = $mail_body;
 							$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
-							$mail->AddAddress($email_full, getCorrectUserSalutation($userinfo));
+							$mail->AddAddress($email_full);
 							$mail->Send();
 						} catch(phpmailerException $e) {
 							$mailerr_msg = $e->errorMessage();
@@ -446,7 +525,7 @@ elseif($page == 'accounts')

 						if ($_mailerror) {	
 							$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
-							standard_error('errorsendingmail', $email);
+							standard_error('errorsendingmail', $email_full);
 						}

 						$mail->ClearAddresses();
@@ -491,6 +570,13 @@ elseif($page == 'accounts')
 					$result['email_full'] = $idna_convert->decode($result['email_full']);
 					$result = htmlentities_array($result);
 					$quota = $settings['system']['mail_quota'];
+
+					$account_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addaccount.php';
+					$account_add_form = htmlform::genHTMLForm($account_add_data);
+
+					$title = $account_add_data['emails_addaccount']['title'];
+					$image = $account_add_data['emails_addaccount']['image'];
+
 					eval("echo \"" . getTemplate("email/account_add") . "\";");
 				}
 			}
@@ -518,17 +604,25 @@ elseif($page == 'accounts')
 					standard_error(array('stringisempty', 'mypassword'));
 					exit;
 				}
-				else
-				{
-					$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'");
-					$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
-					redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
-				}
+				
+				$password = validatePassword($password);
+				
+				$log->logAction(USR_ACTION, LOG_NOTICE, "changed email password for '" . $result['email_full'] . "'");
+				$cryptPassword = makeCryptPassword($password);
+				$result = $db->query("UPDATE `" . TABLE_MAIL_USERS . "` SET " . ($settings['system']['mailpwcleartext'] == '1' ? "`password` = '" . $db->escape($password) . "', " : '') . " `password_enc`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$result['popaccountid'] . "'");
+				redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
 			}
 			else
 			{
 				$result['email_full'] = $idna_convert->decode($result['email_full']);
 				$result = htmlentities_array($result);
+
+				$account_changepw_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangepasswd.php';
+				$account_changepw_form = htmlform::genHTMLForm($account_changepw_data);
+
+				$title = $account_changepw_data['emails_accountchangepasswd']['title'];
+				$image = $account_changepw_data['emails_accountchangepasswd']['image'];
+
 				eval("echo \"" . getTemplate("email/account_changepw") . "\";");
 			}
 		}
@@ -570,6 +664,13 @@ elseif($page == 'accounts')
 			{
 				$result['email_full'] = $idna_convert->decode($result['email_full']);
 				$result = htmlentities_array($result);
+
+				$quota_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_accountchangequota.php';
+				$quota_edit_form = htmlform::genHTMLForm($quota_edit_data);
+
+				$title = $quota_edit_data['emails_accountchangequota']['title'];
+				$image = $quota_edit_data['emails_accountchangequota']['image'];
+        
 				eval("echo \"" . getTemplate("email/account_changequota") . "\";");
 			}
 		}
@@ -599,13 +700,19 @@ elseif($page == 'accounts')
 					$quota = 0;
 				}

+				if(isset($_POST['delete_userfiles'])
+				  && (int)$_POST['delete_userfiles'] == 1)
+				{
+					inserttask('7', $userinfo['loginname'], $result['email_full']);
+				}
+
 				$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_accounts_used` = `email_accounts_used` - 1, `email_quota_used` = `email_quota_used` - " . (int)$quota . " WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				$log->logAction(USR_ACTION, LOG_INFO, "deleted email account for '" . $result['email_full'] . "'");
 				redirectTo($filename, Array('page' => 'emails', 'action' => 'edit', 'id' => $id, 's' => $s));
 			}
 			else
 			{
-				ask_yesno('email_reallydelete_account', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full']));
+				ask_yesno_withcheckbox('email_reallydelete_account', 'admin_customer_alsoremovemail', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['email_full']));
 			}
 		}
 	}
@@ -658,6 +765,13 @@ elseif($page == 'forwarders')
 				{
 					$result['email_full'] = $idna_convert->decode($result['email_full']);
 					$result = htmlentities_array($result);
+
+					$forwarder_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/email/formfield.emails_addforwarder.php';
+					$forwarder_add_form = htmlform::genHTMLForm($forwarder_add_data);
+
+					$title = $forwarder_add_data['emails_addforwarder']['title'];
+					$image = $forwarder_add_data['emails_addforwarder']['image'];
+
 					eval("echo \"" . getTemplate("email/forwarder_add") . "\";");
 				}
 			}
--- a/customer_extras.php
+++ b/customer_extras.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -39,6 +39,30 @@ if($page == 'overview')
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras");
 	eval("echo \"" . getTemplate("extras/extras") . "\";");
 }
+elseif($page == 'backup')
+{
+    $log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras_backup");
+
+    $result = $db->query("SELECT `backup_enabled` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
+    $row = $db->fetch_array($result);
+
+    $backup_enabled = makeyesno('backup_enabled', '1', '0', $row['backup_enabled']);
+
+    if(isset($_POST['send']) && $_POST['send'] == 'send'){
+	$backup_enabled = ($_POST['backup_enabled'] == '1' ? '1' : '0');
+	
+        $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `backup_enabled`='" . $backup_enabled . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
+	redirectTo($filename, Array('page' => $page, 's' => $s));
+    }
+
+    $backup_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.backup.php';
+	$backup_form = htmlform::genHTMLForm($backup_data);
+
+	$title = $backup_data['backup']['title'];
+	$image = $backup_data['backup']['image'];
+    
+    eval("echo \"" . getTemplate("extras/backup") . "\";");
+}
 elseif($page == 'htpasswds')
 {
 	if($action == '')
@@ -49,7 +73,7 @@ elseif($page == 'htpasswds')
 			'path' => $lng['panel']['path']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_HTPASSWDS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -81,7 +105,7 @@ elseif($page == 'htpasswds')
 	elseif($action == 'delete'
 	       && $id != 0)
 	{
-		$result = $db->query_first("SELECT `id`, `customerid`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");

 		if(isset($result['username'])
 		   && $result['username'] != '')
@@ -114,6 +138,7 @@ elseif($page == 'htpasswds')
 			$userpath = $path;
 			$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
 			$username = validate($_POST['username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
+			$authname = validate($_POST['directory_authname'], 'directory_authname', '/^[a-zA-Z0-9][a-zA-Z0-9\-_ ]+\$?$/');
 			validate($_POST['directory_password'], 'password');
 			$username_path_check = $db->query_first("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `username`='" . $db->escape($username) . "' AND `path`='" . $db->escape($path) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");

@@ -151,7 +176,7 @@ elseif($page == 'htpasswds')
 			}
 			else
 			{
-				$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` (`customerid`, `username`, `password`, `path`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($password) . "', '" . $db->escape($path) . "')");
+				$db->query("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` (`customerid`, `username`, `password`, `path`, `authname`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($password) . "', '" . $db->escape($path) . "', '" . $db->escape($authname) . "')");
 				$log->logAction(USR_ACTION, LOG_INFO, "added htpasswd for '" . $username . " (" . $path . ")'");
 				inserttask('1');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -160,13 +185,20 @@ elseif($page == 'htpasswds')
 		else
 		{
 			$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
+
+			$htpasswd_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_add.php';
+			$htpasswd_add_form = htmlform::genHTMLForm($htpasswd_add_data);
+
+			$title = $htpasswd_add_data['htpasswd_add']['title'];
+			$image = $htpasswd_add_data['htpasswd_add']['image'];
+
 			eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";");
 		}
 	}
 	elseif($action == 'edit'
 	       && $id != 0)
 	{
-		$result = $db->query_first("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+		$result = $db->query_first("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");

 		if(isset($result['username'])
 		   && $result['username'] != '')
@@ -175,6 +207,7 @@ elseif($page == 'htpasswds')
 			   && $_POST['send'] == 'send')
 			{
 				validate($_POST['directory_password'], 'password');
+				$authname = validate($_POST['directory_authname'], 'directory_authname', '/^[a-zA-Z0-9][a-zA-Z0-9\-_ ]+\$?$/');

 				if(CRYPT_STD_DES == 1)
 				{
@@ -186,13 +219,25 @@ elseif($page == 'htpasswds')
 					$password = crypt($_POST['directory_password']);
 				}

-				if($_POST['directory_password'] == '')
+				$pwd_sql = '';
+				if($_POST['directory_password'] != '')
 				{
-					standard_error(array('stringisempty', 'mypassword'));
+					$pwd_sql = "`password`='" . $db->escape($password) . "' ";
 				}
-				else
+				
+				$auth_sql = '';
+				if($authname != $result['authname'])
 				{
-					$db->query("UPDATE `" . TABLE_PANEL_HTPASSWDS . "` SET `password`='" . $db->escape($password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+					$auth_sql = "`authname`='" . $db->escape($authname) . "' ";
+				}
+
+				if($pwd_sql != '' || $auth_sql != '')
+				{
+					if($pwd_sql !='' && $auth_sql != '') {
+						$pwd_sql.= ', ';
+					}
+
+					$db->query("UPDATE `" . TABLE_PANEL_HTPASSWDS . "` SET ".$pwd_sql.$auth_sql." WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 					$log->logAction(USR_ACTION, LOG_INFO, "edited htpasswd for '" . $result['username'] . " (" . $result['path'] . ")'");
 					inserttask('1');
 					redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -206,6 +251,13 @@ elseif($page == 'htpasswds')
 				}

 				$result = htmlentities_array($result);
+
+				$htpasswd_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htpasswd_edit.php';
+				$htpasswd_edit_form = htmlform::genHTMLForm($htpasswd_edit_data);
+
+				$title = $htpasswd_edit_data['htpasswd_edit']['title'];
+				$image = $htpasswd_edit_data['htpasswd_edit']['image'];
+
 				eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";");
 			}
 		}
@@ -221,10 +273,11 @@ elseif($page == 'htaccess')
 			'options_indexes' => $lng['extras']['view_directory'],
 			'error404path' => $lng['extras']['error404path'],
 			'error403path' => $lng['extras']['error403path'],
-			'error500path' => $lng['extras']['error500path']
+			'error500path' => $lng['extras']['error500path'],
+			'options_cgi' => $lng['extras']['execute_perl']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_HTACCESS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `id`, `path`, `options_indexes`, `error404path`, `error403path`, `error500path` FROM `" . TABLE_PANEL_HTACCESS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT * FROM `" . TABLE_PANEL_HTACCESS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -234,6 +287,8 @@ elseif($page == 'htaccess')
 		$count = 0;
 		$htaccess = '';

+		$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
+
 		while($row = $db->fetch_array($result))
 		{
 			if($paging->checkDisplay($i))
@@ -241,10 +296,14 @@ elseif($page == 'htaccess')
 				if(strpos($row['path'], $userinfo['documentroot']) === 0)
 				{
 					$row['path'] = substr($row['path'], strlen($userinfo['documentroot']));
+					// don't show nothing wehn it's the docroot, show slash
+					if ($row['path'] == '') { $row['path'] = '/'; }
 				}

 				$row['options_indexes'] = str_replace('1', $lng['panel']['yes'], $row['options_indexes']);
 				$row['options_indexes'] = str_replace('0', $lng['panel']['no'], $row['options_indexes']);
+				$row['options_cgi'] = str_replace('1', $lng['panel']['yes'], $row['options_cgi']);
+				$row['options_cgi'] = str_replace('0', $lng['panel']['no'], $row['options_cgi']);
 				$row = htmlentities_array($row);
 				eval("\$htaccess.=\"" . getTemplate("extras/htaccess_htaccess") . "\";");
 				$count++;
@@ -293,34 +352,27 @@ elseif($page == 'htaccess')
 				standard_error('invalidpath');
 			}

-			if(($_POST['error404path'] === '')
-			   || (validateUrl($idna_convert->encode($_POST['error404path']))))
-			{
-				$error404path = $_POST['error404path'];
+			if(isset($_POST['options_cgi'])
+				&& (int)$_POST['options_cgi'] != 0
+			) {
+				$options_cgi = '1';
 			}
 			else
 			{
-				standard_error('mustbeurl');
-			}
+				$options_cgi = '0';
+			} 

-			if(($_POST['error403path'] === '')
-			   || (validateUrl($idna_convert->encode($_POST['error403path']))))
-			{
-				$error403path = $_POST['error403path'];
+			$error404path = '';
+			if (isset($_POST['error404path'])) {
+				$error404path = correctErrorDocument($_POST['error404path']);
 			}
-			else
-			{
-				standard_error('mustbeurl');
+			$error403path = '';
+			if (isset($_POST['error403path'])) {
+				$error403path = correctErrorDocument($_POST['error403path']);
 			}
-
-			if(($_POST['error500path'] === '')
-			   || (validateUrl($idna_convert->encode($_POST['error500path']))))
-			{
-				$error500path = $_POST['error500path'];
-			}
-			else
-			{
-				standard_error('mustbeurl');
+			$error500path = '';
+			if (isset($_POST['error500path'])) {
+				$error500path = correctErrorDocument($_POST['error500path']);
 			}

 			if($path_dupe_check['path'] == $path)
@@ -333,7 +385,15 @@ elseif($page == 'htaccess')
 			}
 			else
 			{
-				$db->query('INSERT INTO `' . TABLE_PANEL_HTACCESS . '`  (`customerid`,  `path`,  `options_indexes`,  `error404path`,  `error403path`,  `error500path`  ) VALUES ("' . (int)$userinfo['customerid'] . '",  "' . $db->escape($path) . '",  "' . $db->escape($_POST['options_indexes'] == '1' ? '1' : '0') . '",  "' . $db->escape($error404path) . '",  "' . $db->escape($error403path) . '",  "' . $db->escape($error500path) . '"  )');
+				$db->query('INSERT INTO `' . TABLE_PANEL_HTACCESS . '` SET
+							`customerid` = "'.(int)$userinfo['customerid'].'",
+							`path` = "'.$db->escape($path).'",
+							`options_indexes` = "'.$db->escape($_POST['options_indexes'] == '1' ? '1' : '0').'",
+							`error404path` = "'.$db->escape($error404path).'",
+							`error403path` = "'.$db->escape($error403path).'",
+							`error500path` = "'.$db->escape($error500path).'",
+							`options_cgi` = "'.$db->escape($options_cgi).'"');
+
 				$log->logAction(USR_ACTION, LOG_INFO, "added htaccess for '" . $path . "'");
 				inserttask('1');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
@@ -342,7 +402,18 @@ elseif($page == 'htaccess')
 		else
 		{
 			$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
-			$options_indexes = makeyesno('options_indexes', '1', '0', '1');
+			$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
+			/*
+			$options_indexes = makeyesno('options_indexes', '1', '0', '0');
+			$options_cgi = makeyesno('options_cgi', '1', '0', '0');
+			*/
+
+			$htaccess_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_add.php';
+			$htaccess_add_form = htmlform::genHTMLForm($htaccess_add_data);
+
+			$title = $htaccess_add_data['htaccess_add']['title'];
+			$image = $htaccess_add_data['htaccess_add']['image'];
+
 			eval("echo \"" . getTemplate("extras/htaccess_add") . "\";");
 		}
 	}
@@ -359,49 +430,30 @@ elseif($page == 'htaccess')
 			   && $_POST['send'] == 'send')
 			{
 				$option_indexes = intval($_POST['options_indexes']);
+				$options_cgi = isset($_POST['options_cgi']) ? intval($_POST['options_cgi']) : 0;

 				if($option_indexes != '1')
 				{
 					$option_indexes = '0';
 				}

-				if(($_POST['error404path'] === '')
-				   || (validateUrl($idna_convert->encode($_POST['error404path']))))
+				if($options_cgi != '1')
 				{
-					$error404path = $_POST['error404path'];
-				}
-				else
-				{
-					standard_error('mustbeurl');
+					$options_cgi = '0';
 				}

-				if(($_POST['error403path'] === '')
-				   || (validateUrl($idna_convert->encode($_POST['error403path']))))
-				{
-					$error403path = $_POST['error403path'];
-				}
-				else
-				{
-					standard_error('mustbeurl');
-				}
-
-				if(($_POST['error500path'] === '')
-				   || (validateUrl($idna_convert->encode($_POST['error500path']))))
-				{
-					$error500path = $_POST['error500path'];
-				}
-				else
-				{
-					standard_error('mustbeurl');
-				}
+				$error404path = correctErrorDocument($_POST['error404path']);
+				$error403path = correctErrorDocument($_POST['error403path']);
+				$error500path = correctErrorDocument($_POST['error500path']);

 				if(($option_indexes != $result['options_indexes'])
 				   || ($error404path != $result['error404path'])
 				   || ($error403path != $result['error403path'])
-				   || ($error500path != $result['error500path']))
+				   || ($error500path != $result['error500path'])
+				   || ($options_cgi != $result['options_cgi']))
 				{
 					inserttask('1');
-					$db->query('UPDATE `' . TABLE_PANEL_HTACCESS . '` SET `options_indexes` = "' . $db->escape($option_indexes) . '", `error404path`    = "' . $db->escape($error404path) . '",  `error403path`    = "' . $db->escape($error403path) . '",  `error500path`    = "' . $db->escape($error500path) . '" WHERE `customerid` = "' . (int)$userinfo['customerid'] . '"  AND `id` = "' . (int)$id . '"');
+					$db->query('UPDATE `' . TABLE_PANEL_HTACCESS . '` SET `options_indexes` = "' . $db->escape($option_indexes) . '", `error404path`    = "' . $db->escape($error404path) . '",  `error403path`    = "' . $db->escape($error403path) . '",  `error500path`    = "' . $db->escape($error500path) . '", `options_cgi` = "' . $db->escape($options_cgi) . '" WHERE `customerid` = "' . (int)$userinfo['customerid'] . '"  AND `id` = "' . (int)$id . '"');
 					$log->logAction(USR_ACTION, LOG_INFO, "edited htaccess for '" . str_replace($userinfo['documentroot'], '', $result['path']) . "'");
 				}

@@ -412,13 +464,26 @@ elseif($page == 'htaccess')
 				if(strpos($result['path'], $userinfo['documentroot']) === 0)
 				{
 					$result['path'] = substr($result['path'], strlen($userinfo['documentroot']));
+					// don't show nothing wehn it's the docroot, show slash
+					if ($result['path'] == '') { $result['path'] = '/'; }
 				}

 				$result['error404path'] = $result['error404path'];
 				$result['error403path'] = $result['error403path'];
 				$result['error500path'] = $result['error500path'];
+				$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
+				/*
 				$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
+				$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
+				*/
 				$result = htmlentities_array($result);
+
+				$htaccess_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/extras/formfield.htaccess_edit.php';
+				$htaccess_edit_form = htmlform::genHTMLForm($htaccess_edit_data);
+	
+				$title = $htaccess_edit_data['htaccess_edit']['title'];
+				$image = $htaccess_edit_data['htaccess_edit']['image'];
+
 				eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";");
 			}
 		}
--- a/customer_ftp.php
+++ b/customer_ftp.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -22,34 +22,27 @@ define('AREA', 'customer');
 /**
 * Include our init.php, which manages Sessions, Language etc.
 */
+require('./lib/init.php');

-require ("./lib/init.php");
-
-if(isset($_POST['id']))
-{
+$id = 0;
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif(isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }

-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
-	eval("echo \"" . getTemplate("ftp/ftp") . "\";");
-}
-elseif($page == 'accounts')
-{
-	if($action == '')
-	{
+	eval("echo \"" . getTemplate('ftp/ftp') . "\";");
+} elseif ($page == 'accounts') {
+	if ($action == '') {
 		$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
 		$fields = array(
 			'username' => $lng['login']['username'],
 			'homedir' => $lng['panel']['path']
 		);
 		$paging = new paging($userinfo, $db, TABLE_FTP_USERS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . $userinfo['customerid'] . "'  AND `username` NOT LIKE '%_backup'" . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -59,23 +52,18 @@ elseif($page == 'accounts')
 		$count = 0;
 		$accounts = '';

-		while($row = $db->fetch_array($result))
-		{
-			if($paging->checkDisplay($i))
-			{
-				if(strpos($row['homedir'], $userinfo['documentroot']) === 0)
-				{
+		while ($row = $db->fetch_array($result)) {
+			if ($paging->checkDisplay($i)) {
+				if (strpos($row['homedir'], $userinfo['documentroot']) === 0) {
 					$row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot']));
-				}
-				else
-				{
+				} else {
 					$row['documentroot'] = $row['homedir'];
 				}

 				$row['documentroot'] = makeCorrectDir($row['documentroot']);
 				
 				$row = htmlentities_array($row);
-				eval("\$accounts.=\"" . getTemplate("ftp/accounts_account") . "\";");
+				eval("\$accounts.=\"" . getTemplate('ftp/accounts_account') . "\";");
 				$count++;
 			}

@@ -83,163 +71,246 @@ elseif($page == 'accounts')
 		}

 		$ftps_count = $db->num_rows($result);
-		eval("echo \"" . getTemplate("ftp/accounts") . "\";");
-	}
-	elseif($action == 'delete'
-	       && $id != 0)
-	{
+		eval("echo \"" . getTemplate('ftp/accounts') . "\";");
+	} elseif ($action == 'delete' && $id != 0) {
 		$result = $db->query_first("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");

-		if(isset($result['username'])
-		   && $result['username'] != $userinfo['loginname'])
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+		if (isset($result['username'])
+		   && $result['username'] != $userinfo['loginname']
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `up_count`=`up_count`+'" . (int)$result['up_count'] . "', `up_bytes`=`up_bytes`+'" . (int)$result['up_bytes'] . "', `down_count`=`down_count`+'" . (int)$result['down_count'] . "', `down_bytes`=`down_bytes`+'" . (int)$result['down_bytes'] . "' WHERE `username`='" . $db->escape($userinfo['loginname']) . "'");
+				$result = $db->query_first("SELECT `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+				$db->query("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $db->escape($result['username']) . "'");
 				$db->query("DELETE FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
 				$log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'");
 				$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=REPLACE(`members`,'," . $db->escape($result['username']) . "','') WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");

-				//					$db->query("DELETE FROM `".TABLE_FTP_GROUPS."` WHERE `customerid`='".$userinfo['customerid']."' AND `id`='$id'");
+				$resetaccnumber = ($userinfo['ftps_used'] == '1') ? " , `ftp_lastaccountnumber`='0'" : '';

-				if($userinfo['ftps_used'] == '1')
-				{
-					$resetaccnumber = " , `ftp_lastaccountnumber`='0'";
-				}
-				else
-				{
-					$resetaccnumber = '';
+				// refs #293
+				if (isset($_POST['delete_userfiles'])
+				  && (int)$_POST['delete_userfiles'] == 1
+				) {
+					inserttask('8', $userinfo['loginname'], $result['homedir']);
 				}

 				$result = $db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`-1 $resetaccnumber WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 				redirectTo($filename, Array('page' => $page, 's' => $s));
+			} else {
+				ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
 			}
-			else
-			{
-				ask_yesno('ftp_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
-			}
-		}
-		else
-		{
+		} else {
 			standard_error('ftp_cantdeletemainaccount');
 		}
-	}
-	elseif($action == 'add')
-	{
-		if($userinfo['ftps_used'] < $userinfo['ftps']
-		   || $userinfo['ftps'] == '-1')
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+	} elseif ($action == 'add') {
+		if ($userinfo['ftps_used'] < $userinfo['ftps']
+		   || $userinfo['ftps'] == '-1'
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
+				// @FIXME use a good path-validating regex here (refs #1231)
 				$path = validate($_POST['path'], 'path');
 				$password = validate($_POST['ftp_password'], 'password');
+				$password = validatePassword($password);

-				if($settings['customer']['ftpatdomain'] == '1')
-				{
+				$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
+				if ($sendinfomail != 1) {
+					$sendinfomail = 0;
+				}
+
+				if ($settings['customer']['ftpatdomain'] == '1') {
 					$ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
-					if($ftpusername == '')
-					{
+					if ($ftpusername == '') {
 						standard_error(array('stringisempty', 'username'));
 					}
 					$ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain'));
 					$ftpdomain_check = $db->query_first("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `domain`='" . $db->escape($ftpdomain) . "' AND `customerid`='" . (int)$userinfo['customerid'] . "'");
-					if($ftpdomain_check['domain'] != $ftpdomain)
-					{
+					if ($ftpdomain_check['domain'] != $ftpdomain) {
 						standard_error('maindomainnonexist', $domain);
 					}
 					$username = $ftpusername . "@" . $ftpdomain;
-				}
-				else
-				{
+				} else {
 					$username = $userinfo['loginname'] . $settings['customer']['ftpprefix'] . (intval($userinfo['ftp_lastaccountnumber']) + 1);
 				}
 				
 				$username_check = $db->query_first('SELECT * FROM `' . TABLE_FTP_USERS .'` WHERE `username` = \'' . $db->escape($username) . '\'');
 				
-				if(!empty($username_check) && $username_check['username'] = $username)
-				{
+				if (!empty($username_check) && $username_check['username'] = $username) {
 					standard_error('usernamealreadyexists', $username);
-				}
-				elseif($password == '')
-				{
+				} elseif ($password == '') {
 					standard_error(array('stringisempty', 'mypassword'));
-				}
-				elseif($path == '')
-				{
+				} elseif ($path == '') {
 					standard_error('patherror');
-				}
-				else
-				{
-					$userpath = makeCorrectDir($path);
+				} else {
 					$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
-					
-					$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', ENCRYPT('" . $db->escape($password) . "'), '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
+
+					$cryptPassword = makeCryptPassword($password);
+					$db->query("INSERT INTO `" . TABLE_FTP_USERS . "` (`customerid`, `username`, `password`, `homedir`, `login_enabled`, `uid`, `gid`) VALUES ('" . (int)$userinfo['customerid'] . "', '" . $db->escape($username) . "', '" . $db->escape($cryptPassword) . "', '" . $db->escape($path) . "', 'y', '" . (int)$userinfo['guid'] . "', '" . (int)$userinfo['guid'] . "')");
+					$result = $db->query("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = '" . $userinfo['loginname'] . "'");
+					while ($row = $db->fetch_array($result)) {
+						$db->query("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "` (`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`) VALUES ('" . $db->escape($username) . "', 'user', '" . $db->escape($row['bytes_in_used']) . "', '0', '0', '0', '0', '0')");
+					}
 					$db->query("UPDATE `" . TABLE_FTP_GROUPS . "` SET `members`=CONCAT_WS(',',`members`,'" . $db->escape($username) . "') WHERE `customerid`='" . $userinfo['customerid'] . "' AND `gid`='" . (int)$userinfo['guid'] . "'");
-
-					//						$db->query("INSERT INTO `".TABLE_FTP_GROUPS."` (`customerid`, `groupname`, `gid`, `members`) VALUES ('".$userinfo['customerid']."', '$username', '$uid', '$username')");
-
 					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `ftps_used`=`ftps_used`+1, `ftp_lastaccountnumber`=`ftp_lastaccountnumber`+1 WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");

-					//						$db->query("UPDATE `".TABLE_PANEL_SETTINGS."` SET `value`='$uid' WHERE settinggroup='ftp' AND varname='lastguid'");
-
 					$log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'");
 					inserttask(5);
+
+					if ($sendinfomail == 1) {
+						$replace_arr = array(
+							'SALUTATION' => getCorrectUserSalutation($userinfo),
+							'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
+							'USR_NAME' => $username,
+							'USR_PASS' => $password,
+							'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot'])))
+						);
+						
+						$def_language = $userinfo['def_language'];
+						$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_ftpaccount_by_customer_subject\'');
+						$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['ftp_add']['infomail_subject']), $replace_arr));
+						$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_ftpaccount_by_customer_mailbody\'');
+						$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['ftp_add']['infomail_body']['main']), $replace_arr));
+						
+						$_mailerror = false;
+						try {
+							$mail->Subject = $mail_subject;
+							$mail->AltBody = $mail_body;
+							$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
+							$mail->AddAddress($userinfo['email'], getCorrectUserSalutation($userinfo));
+							$mail->Send();
+						} catch(phpmailerException $e) {
+							$mailerr_msg = $e->errorMessage();
+							$_mailerror = true;
+						} catch (Exception $e) {
+							$mailerr_msg = $e->getMessage();
+							$_mailerror = true;
+						}
+
+						if ($_mailerror) {
+							$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
+							standard_error('errorsendingmail', $userinfo['email']);
+						}
+
+						$mail->ClearAddresses();
+					}
+
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
-			}
-			else
-			{
-				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
+			} else {
+				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], '/');

-				if($settings['customer']['ftpatdomain'] == '1')
-				{
+				if ($settings['customer']['ftpatdomain'] == '1') {
+					$domainlist = array();
 					$domains = '';

 					$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");

-					while($row_domain = $db->fetch_array($result_domains))
-					{
-						$domains.= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
+					while ($row_domain = $db->fetch_array($result_domains)) {
+						$domainlist[] =  $row_domain['domain'];
+					}
+
+					sort($domainlist);
+
+					if (isset($domainlist[0]) && $domainlist[0] != '') {
+						foreach ($domainlist as $dom) {
+							$domains .= makeoption($idna_convert->decode($dom), $dom);
+						}
 					}
 				}

-				eval("echo \"" . getTemplate("ftp/accounts_add") . "\";");
+				//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
+
+				$ftp_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_add.php';
+				$ftp_add_form = htmlform::genHTMLForm($ftp_add_data);
+
+				$title = $ftp_add_data['ftp_add']['title'];
+				$image = $ftp_add_data['ftp_add']['image'];
+
+				eval("echo \"" . getTemplate('ftp/accounts_add') . "\";");
 			}
 		}
-	}
-	elseif($action == 'edit'
-	       && $id != 0)
-	{
-		$result = $db->query_first("SELECT `id`, `username`, `homedir` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+	} elseif ($action == 'edit' && $id != 0) {
+		$result = $db->query_first("SELECT `id`, `username`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");

-		if(isset($result['username'])
-		   && $result['username'] != '')
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
-				$password = validate($_POST['ftp_password'], 'password');
+		if (isset($result['username'])
+		   && $result['username'] != ''
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
+				// @FIXME use a good path-validating regex here (refs #1231)
+				$path = validate($_POST['path'], 'path');
+				
+				$_setnewpass = false;
+				if (isset($_POST['ftp_password']) && $_POST['ftp_password'] != '') {
+					$password = validate($_POST['ftp_password'], 'password');
+					$password = validatePassword($password);
+					$_setnewpass = true;
+				}

-				if($password == '')
-				{
-					standard_error(array('stringisempty', 'mypassword'));
-					exit;
+				if ($_setnewpass) {
+					if ($password == '') {
+						standard_error(array('stringisempty', 'mypassword'));
+						exit;
+					}
+					$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
+					$cryptPassword = makeCryptPassword($password);
+					$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
+						
+					// also update customers backup user password if password of main ftp user is changed
+					if(!preg_match('/' . $settings['customer']['ftpprefix'] . '/', $result['username'])){
+					    $db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $result['username'] . "_backup'");
+					}
 				}
-				else
-				{
-					$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");
-					$log->logAction(USR_ACTION, LOG_INFO, "edited ftp-account '" . $result['username'] . "'");
-					redirectTo($filename, Array('page' => $page, 's' => $s));
+				
+				if ($path != '') {
+					$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
+
+					if ($path != $result['homedir']) {
+						if (!file_exists($path)) {
+							// it's the task for "new ftp" but that will 
+							// create all directories and correct their permissions
+							inserttask(5);
+						}
+
+						$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'");
+						$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `homedir`= '" . $db->escape($path) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `id`='" . (int)$id . "'");						
+					}
 				}
-			}
-			else
-			{
-				eval("echo \"" . getTemplate("ftp/accounts_edit") . "\";");
+
+				redirectTo($filename, Array('page' => $page, 's' => $s));
+			} else {
+				if (strpos($result['homedir'], $userinfo['documentroot']) === 0) {
+					$homedir = substr($result['homedir'], strlen($userinfo['documentroot']));
+				} else {
+					$homedir = $result['homedir'];
+				}
+				$homedir = makeCorrectDir($homedir);
+
+				$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $homedir);
+
+				if ($settings['customer']['ftpatdomain'] == '1') {
+					$domains = '';
+
+					$result_domains = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
+
+					while ($row_domain = $db->fetch_array($result_domains)) {
+						$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
+					}
+				}
+
+				$ftp_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/ftp/formfield.ftp_edit.php';
+				$ftp_edit_form = htmlform::genHTMLForm($ftp_edit_data);
+
+				$title = $ftp_edit_data['ftp_edit']['title'];
+				$image = $ftp_edit_data['ftp_edit']['image'];
+
+				eval("echo \"" . getTemplate('ftp/accounts_edit') . "\";");
 			}
 		}
 	}
 }
-
-?>
--- a/customer_index.php
+++ b/customer_index.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -22,40 +22,32 @@ define('AREA', 'customer');
 /**
 * Include our init.php, which manages Sessions, Language etc.
 */
+require('./lib/init.php');

-require ("./lib/init.php");
+if ($action == 'logout') {
+	$log->logAction(USR_ACTION, LOG_NOTICE, 'logged out');

-if($action == 'logout')
-{
-	$log->logAction(USR_ACTION, LOG_NOTICE, "logged out");
-
-	if($settings['session']['allow_multiple_login'] == '1')
-	{
-		$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0' AND `hash` = '" . $s . "'");
+        $query = "DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'";
+	if ($settings['session']['allow_multiple_login'] == '1') {
+		$query .= " AND `hash` = '" . $s . "'";
 	}
-	else
-	{
-		$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['customerid'] . "' AND `adminsession` = '0'");
-	}
-
+	$db->query($query);
 	redirectTo('index.php');
 	exit;
 }

-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index");
 	$domains = '';
 	$result = $db->query("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `parentdomainid`='0' AND `id` <> '" . (int)$userinfo['standardsubdomain'] . "' ");
 	$domainArray = array();

-	while($row = $db->fetch_array($result))
-	{
+	while ($row = $db->fetch_array($result)) {
 		$domainArray[] = $idna_convert->decode($row['domain']);
 	}

 	natsort($domainArray);
-	$domains = implode(', ', $domainArray);
+	$domains = implode(',<br />', $domainArray);
 	$userinfo['email'] = $idna_convert->decode($userinfo['email']);
 	$yesterday = time() - (60 * 60 * 24);
 	$month = date('M Y', $yesterday);
@@ -67,7 +59,7 @@ if($page == 'overview')
 	$userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, $settings['panel']['decimal_places']);
 	$userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $settings['panel']['decimal_places']);
 	$userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $settings['panel']['decimal_places']);
-	$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps tickets subdomains aps_packages');
+	$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota email_autoresponder ftps tickets subdomains aps_packages');
 	$opentickets = 0;
 	$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
                                   WHERE `customerid` = "' . $userinfo['customerid'] . '"
@@ -77,67 +69,49 @@ if($page == 'overview')
 	$awaitingtickets = $opentickets['count'];
 	$awaitingtickets_text = '';

-	if($opentickets > 0)
-	{
+	if ($opentickets > 0) {
 		$awaitingtickets_text = strtr($lng['ticket']['awaitingticketreply'], array('%s' => '<a href="customer_tickets.php?page=tickets&amp;s=' . $s . '">' . $opentickets['count'] . '</a>'));
 	}

-	eval("echo \"" . getTemplate("index/index") . "\";");
-}
-elseif($page == 'change_password')
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+	eval("echo \"" . getTemplate('index/index') . "\";");
+} elseif ($page == 'change_password') {
+	if (isset($_POST['send']) && $_POST['send'] == 'send') {
 		$old_password = validate($_POST['old_password'], 'old password');
-
-		if(md5($old_password) != $userinfo['password'])
-		{
+		if (md5($old_password) != $userinfo['password']) {
 			standard_error('oldpasswordnotcorrect');
 			exit;
 		}

-		$new_password = validate($_POST['new_password'], 'new password');
-		$new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
+		$new_password = validatePassword($_POST['new_password'], 'new password');
+		$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm');

-		if($old_password == '')
-		{
+		if ($old_password == '') {
 			standard_error(array('stringisempty', 'oldpassword'));
-		}
-		elseif($new_password == '')
-		{
+		} elseif($new_password == '') {
 			standard_error(array('stringisempty', 'newpassword'));
-		}
-		elseif($new_password_confirm == '')
-		{
+		} elseif($new_password_confirm == '') {
 			standard_error(array('stringisempty', 'newpasswordconfirm'));
-		}
-		elseif($new_password != $new_password_confirm)
-		{
+		} elseif($new_password != $new_password_confirm) {
 			standard_error('newpasswordconfirmerror');
-		}
-		else
-		{
+		} else {
 			$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($new_password) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `password`='" . md5($old_password) . "'");
 			$log->logAction(USR_ACTION, LOG_NOTICE, 'changed password');

-			if(isset($_POST['change_main_ftp'])
-			   && $_POST['change_main_ftp'] == 'true')
-			{
-				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`=ENCRYPT('" . $db->escape($new_password) . "') WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
+			if (isset($_POST['change_main_ftp'])
+			   && $_POST['change_main_ftp'] == 'true'
+			) {
+				$cryptPassword = makeCryptPassword($new_password);
+				$db->query("UPDATE `" . TABLE_FTP_USERS . "` SET `password`='" . $db->escape($cryptPassword) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "' AND `username`='" . $db->escape($userinfo['loginname']) . "'");
 				$log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password');
 			}

-			if(isset($_POST['change_webalizer'])
-			   && $_POST['change_webalizer'] == 'true')
-			{
-				if(CRYPT_STD_DES == 1)
-				{
+			if (isset($_POST['change_webalizer'])
+			   && $_POST['change_webalizer'] == 'true'
+			) {
+				if (CRYPT_STD_DES == 1) {
 					$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
 					$new_webalizer_password = crypt($new_password, $saltfordescrypt);
-				}
-				else
-				{
+				} else {
 					$new_webalizer_password = crypt($new_password);
 				}

@@ -146,39 +120,52 @@ elseif($page == 'change_password')

 			redirectTo($filename, Array('s' => $s));
 		}
+	} else {
+		eval("echo \"" . getTemplate('index/change_password') . "\";");
 	}
-	else
-	{
-		eval("echo \"" . getTemplate("index/change_password") . "\";");
-	}
-}
-elseif($page == 'change_language')
-{
-	if(isset($_POST['send'])
-	   && $_POST['send'] == 'send')
-	{
+} elseif ($page == 'change_language') {
+	if (isset($_POST['send']) && $_POST['send'] == 'send') {
 		$def_language = validate($_POST['def_language'], 'default language');
-
-		if(isset($languages[$def_language]))
-		{
+		if (isset($languages[$def_language])) {
 			$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `def_language`='" . $db->escape($def_language) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
 			$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `language`='" . $db->escape($def_language) . "' WHERE `hash`='" . $db->escape($s) . "'");
 			$log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
 		}

 		redirectTo($filename, Array('s' => $s));
-	}
-	else
-	{
-		$language_options = '';
-
-		while(list($language_file, $language_name) = each($languages))
-		{
-			$language_options.= makeoption($language_name, $language_file, $userinfo['def_language'], true);
+	} else {
+		$default_lang = $settings['panel']['standardlanguage'];
+		if ($userinfo['def_language'] != '') { 
+			$default_lang = $userinfo['def_language'];
 		}

-		eval("echo \"" . getTemplate("index/change_language") . "\";");
+		$language_options = '';
+		while (list($language_file, $language_name) = each($languages)) {
+			$language_options .= makeoption($language_name, $language_file, $default_lang, true);
+		}
+
+		eval("echo \"" . getTemplate('index/change_language') . "\";");
+	}
+} elseif ($page == 'change_theme') {
+	if (isset($_POST['send']) && $_POST['send'] == 'send') {
+		$theme = validate($_POST['theme'], 'theme');
+ 
+		$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `customerid`='" . (int)$userinfo['customerid'] . "'");
+		$db->query("UPDATE `" . TABLE_PANEL_SESSIONS . "` SET `theme`='" . $db->escape($theme) . "' WHERE `hash`='" . $db->escape($s) . "'");
+		$log->logAction(USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'");
+		redirectTo($filename, Array('s' => $s));
+	} else {
+		$default_theme = $settings['panel']['default_theme'];
+		if ($userinfo['theme'] != '') {
+			$default_theme = $userinfo['theme'];
+		}
+
+		$theme_options = '';
+		$themes_avail = getThemes();
+		foreach ($themes_avail as $t) {
+			$theme_options .= makeoption($t, $t, $default_theme, true);
+		}
+
+		eval("echo \"" . getTemplate('index/change_theme') . "\";");
 	}
 }
-
-?>
--- a/customer_mysql.php
+++ b/customer_mysql.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -22,37 +22,29 @@ define('AREA', 'customer');
 /**
 * Include our init.php, which manages Sessions, Language etc.
 */
-
 $need_db_sql_data = true;
 $need_root_db_sql_data = true;
-require ("./lib/init.php");
+require('./lib/init.php');

-if(isset($_POST['id']))
-{
+if (isset($_POST['id'])) {
 	$id = intval($_POST['id']);
-}
-elseif(isset($_GET['id']))
-{
+} elseif(isset($_GET['id'])) {
 	$id = intval($_GET['id']);
 }

-if($page == 'overview')
-{
+if ($page == 'overview') {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
 	$lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']);
-	eval("echo \"" . getTemplate("mysql/mysql") . "\";");
-}
-elseif($page == 'mysqls')
-{
-	if($action == '')
-	{
+	eval("echo \"" . getTemplate('mysql/mysql') . "\";");
+} elseif($page == 'mysqls') {
+	if ($action == '') {
 		$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
 		$fields = array(
 			'databasename' => $lng['mysql']['databasename'],
 			'description' => $lng['mysql']['databasedescription']
 		);
 		$paging = new paging($userinfo, $db, TABLE_PANEL_DATABASES, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
-		$result = $db->query("SELECT `id`, `databasename`, `description`, `dbserver` FROM `" . TABLE_PANEL_DATABASES . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query("SELECT * FROM `" . TABLE_PANEL_DATABASES . "` WHERE `customerid`='" . (int)$userinfo['customerid'] . "' " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -62,114 +54,117 @@ elseif($page == 'mysqls')
 		$count = 0;
 		$mysqls = '';

-		while($row = $db->fetch_array($result))
-		{
-			if($paging->checkDisplay($i))
-			{
+		// Begin root-session
+		$db_root = new db($sql_root[0]['host'], $sql_root[0]['user'], $sql_root[0]['password'], '');
+		while ($row = $db->fetch_array($result)) {
+			if ($paging->checkDisplay($i)) {
 				$row = htmlentities_array($row);
-				eval("\$mysqls.=\"" . getTemplate("mysql/mysqls_database") . "\";");
+				$mbdata = $db_root->query_first("SELECT SUM( data_length + index_length) / 1024 / 1024 'MB' FROM information_schema.TABLES WHERE table_schema = '" . $db_root->escape($row['databasename']) . "' GROUP BY table_schema ;");
+				$row['size'] = number_format($mbdata['MB'], 3, '.', '');
+				eval("\$mysqls.=\"" . getTemplate('mysql/mysqls_database') . "\";");
 				$count++;
 			}
-
 			$i++;
 		}
+		$db_root->close();
+		// End root-session

 		$mysqls_count = $db->num_rows($result);
-		eval("echo \"" . getTemplate("mysql/mysqls") . "\";");
-	}
-	elseif($action == 'delete'
-	       && $id != 0)
-	{
-		$result = $db->query_first('SELECT `id`, `databasename`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
+		eval("echo \"" . getTemplate('mysql/mysqls') . "\";");
+	} elseif($action == 'delete' && $id != 0) {
+		$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');

-		if(isset($result['databasename'])
-		   && $result['databasename'] != '')
-		{
-			if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
-			{
+		if (isset($result['databasename'])
+		   && $result['databasename'] != ''
+		) {
+			if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) {
 				$result['dbserver'] = 0;
 			}

-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				// Begin root-session
-
 				$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
-				unset($db_root->password);
-				foreach(array_map('trim', array_unique(explode(',', $settings['system']['mysql_access_host']))) as $mysql_access_host)
-				{
-					$db_root->query('REVOKE ALL PRIVILEGES ON * . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-					$db_root->query('REVOKE ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($result['databasename'])) . '` . * FROM `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '`');
-					$db_root->query('DELETE FROM `mysql`.`user` WHERE `User` = "' . $db_root->escape($result['databasename']) . '" AND `Host` = "' . $db_root->escape($mysql_access_host) . '"');
+				$log->logAction(USR_ACTION, LOG_INFO, "deleted database '" . $result['databasename'] . "'");
+				if (mysql_get_server_info() < '5.0.2') { 
+					// Revoke privileges (only required for MySQL 4.1.2 - 5.0.1)
+					$db_root->query('REVOKE ALL PRIVILEGES, GRANT OPTION FROM \'' . $db_root->escape($result['databasename']) .'\'',false,true);
+				}
+
+				$host_res = $db_root->query("SELECT `Host` FROM `mysql`.`user` WHERE `User`='" . $db_root->escape($result['databasename']) . "'");
+				while ($host = $db_root->fetch_array($host_res)) {
+					// as of MySQL 5.0.2 this also revokes privileges. (requires MySQL 4.1.2+)
+					$db_root->query('DROP USER \'' . $db_root->escape($result['databasename']). '\'@\'' . $db_root->escape($host['Host']) . '\'', false, true);
 				}

 				$db_root->query('DROP DATABASE IF EXISTS `' . $db_root->escape($result['databasename']) . '`');
 				$db_root->query('FLUSH PRIVILEGES');
 				$db_root->close();
-
 				// End root-session

 				$db->query('DELETE FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');

-				if($userinfo['mysqls_used'] == '1')
-				{
-					$resetaccnumber = " , `mysql_lastaccountnumber`='0' ";
-				}
-				else
-				{
-					$resetaccnumber = '';
-				}
+				$resetaccnumber = ($userinfo['mysqls_used'] == '1') ? " , `mysql_lastaccountnumber`='0' " : '';

 				$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`-1 ' . $resetaccnumber . 'WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			}
-			else
-			{
-				ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['databasename']);
+			} else {
+				$dbnamedesc = $result['databasename'];
+				if (isset($result['description']) && $result['description'] != '') {
+					$dbnamedesc .= ' ('.$result['description'].')';
+				}
+				ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc);
 			}
 		}
-	}
-	elseif($action == 'add')
-	{
-		if($userinfo['mysqls_used'] < $userinfo['mysqls']
-		   || $userinfo['mysqls'] == '-1')
-		{
-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+	} elseif ($action == 'add') {
+		if ($userinfo['mysqls_used'] < $userinfo['mysqls']
+		   || $userinfo['mysqls'] == '-1'
+		) {
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				$password = validate($_POST['mysql_password'], 'password');
+				$password = validatePassword($password);

-				if($password == '')
-				{
-					standard_error(array('stringisempty', 'mypassword'));
+				$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
+				if ($sendinfomail != 1) {
+					$sendinfomail = 0;
 				}
-				else
-				{
-					$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);

-					if(count($sql_root) > 1)
-					{
+				if ($password == '') {
+					standard_error(array('stringisempty', 'mypassword'));
+				} else {
+					$dbserver = 0;
+					if (count($sql_root) > 1) {
 						$dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0);
-
-						if(!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver]))
-						{
+						if (!isset($sql_root[$dbserver]) || !is_array($sql_root[$dbserver])) {
 							$dbserver = 0;
 						}
 					}
-					else
-					{
-						$dbserver = 0;
-					}
+					
+					// validate description before actual adding the database, #1052
+					$databasedescription = validate(trim($_POST['description']), 'description');

 					// Begin root-session
-
 					$db_root = new db($sql_root[$dbserver]['host'], $sql_root[$dbserver]['user'], $sql_root[$dbserver]['password'], '');
-					unset($db_root->password);
+
+					if (strtoupper($settings['customer']['mysqlprefix']) == 'RANDOM') {
+						$result = $db_root->query('SELECT `User` FROM mysql.user');
+						while ($row = $db_root->fetch_array($result)) {
+							$allsqlusers[] = $row[User];
+						}
+						$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
+						while (in_array($username , $allsqlusers)) {
+							$username = $userinfo['loginname'] . '-' . substr(md5(uniqid(microtime(), 1)), 20, 3);
+						}
+					} else {
+						$username = $userinfo['loginname'] . $settings['customer']['mysqlprefix'] . (intval($userinfo['mysql_lastaccountnumber']) + 1);
+					}
+
 					$db_root->query('CREATE DATABASE `' . $db_root->escape($username) . '`');
 					$log->logAction(USR_ACTION, LOG_INFO, "created database '" . $username . "'");
-					foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
-					{
+					foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) {
 						$db_root->query('GRANT ALL PRIVILEGES ON `' . str_replace('_', '\_', $db_root->escape($username)) . '`.* TO `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` IDENTIFIED BY \'password\'');
 						$db_root->query('SET PASSWORD FOR `' . $db_root->escape($username) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
 						$log->logAction(USR_ACTION, LOG_NOTICE, "grant all privileges for '" . $username . "'@'" . $mysql_access_host . "'");
@@ -177,79 +172,121 @@ elseif($page == 'mysqls')

 					$db_root->query('FLUSH PRIVILEGES');
 					$db_root->close();
-
 					// End root-session
-					// Statement modifyed for Database description -- PH 2004-11-29

-					$databasedescription = validate($_POST['description'], 'description');
+					// Statement modified for Database description -- PH 2004-11-29
 					$result = $db->query('INSERT INTO `' . TABLE_PANEL_DATABASES . '` (`customerid`, `databasename`, `description`, `dbserver`) VALUES ("' . (int)$userinfo['customerid'] . '", "' . $db->escape($username) . '", "' . $db->escape($databasedescription) . '", "' . $db->escape($dbserver) . '")');
 					$result = $db->query('UPDATE `' . TABLE_PANEL_CUSTOMERS . '` SET `mysqls_used`=`mysqls_used`+1, `mysql_lastaccountnumber`=`mysql_lastaccountnumber`+1 WHERE `customerid`="' . (int)$userinfo['customerid'] . '"');
+
+					if ($sendinfomail == 1) {
+						$pma = $lng['admin']['notgiven'];
+						if ($settings['panel']['phpmyadmin_url'] != '') {
+							$pma = $settings['panel']['phpmyadmin_url'];
+						}
+
+						$replace_arr = array(
+							'SALUTATION' => getCorrectUserSalutation($userinfo),
+							'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
+							'DB_NAME' => $username,
+							'DB_PASS' => $password,
+							'DB_DESC' => $databasedescription,
+							'DB_SRV' => $sql_root[$dbserver]['host'],
+							'PMA_URI' => $pma 
+						);
+						
+						$def_language = $userinfo['def_language'];
+						$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_database_by_customer_subject\'');
+						$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['mysql_add']['infomail_subject']), $replace_arr));
+						$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$userinfo['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'new_database_by_customer_mailbody\'');
+						$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['customer']['mysql_add']['infomail_body']['main']), $replace_arr));
+
+						$_mailerror = false;
+						try {
+							$mail->Subject = $mail_subject;
+							$mail->AltBody = $mail_body;
+							$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
+							$mail->AddAddress($userinfo['email'], getCorrectUserSalutation($userinfo));
+							$mail->Send();
+						} catch(phpmailerException $e) {
+							$mailerr_msg = $e->errorMessage();
+							$_mailerror = true;
+						} catch (Exception $e) {
+							$mailerr_msg = $e->getMessage();
+							$_mailerror = true;
+						}
+
+						if ($_mailerror) {
+							$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
+							standard_error('errorsendingmail', $userinfo['email']);
+						}
+
+						$mail->ClearAddresses();
+					}
+
 					redirectTo($filename, Array('page' => $page, 's' => $s));
 				}
-			}
-			else
-			{
+			} else {
 				$mysql_servers = '';

-				foreach($sql_root as $mysql_server => $mysql_server_details)
-				{
+				foreach ($sql_root as $mysql_server => $mysql_server_details) {
 					$mysql_servers .= makeoption($mysql_server_details['caption'], $mysql_server);
 				}

-				eval("echo \"" . getTemplate("mysql/mysqls_add") . "\";");
+				//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
+
+				$mysql_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_add.php';
+				$mysql_add_form = htmlform::genHTMLForm($mysql_add_data);
+
+				$title = $mysql_add_data['mysql_add']['title'];
+				$image = $mysql_add_data['mysql_add']['image'];
+
+				eval("echo \"" . getTemplate('mysql/mysqls_add') . "\";");
 			}
 		}
-	}
-	elseif($action == 'edit'
-	       && $id != 0)
-	{
+	} elseif ($action == 'edit' && $id != 0) {
 		$result = $db->query_first('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '` WHERE `customerid`="' . $userinfo['customerid'] . '" AND `id`="' . $id . '"');

-		if(isset($result['databasename'])
-		   && $result['databasename'] != '')
-		{
-			if(!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']]))
-			{
+		if (isset($result['databasename'])
+		   && $result['databasename'] != ''
+		) {
+			if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) {
 				$result['dbserver'] = 0;
 			}

-			if(isset($_POST['send'])
-			   && $_POST['send'] == 'send')
-			{
+			if (isset($_POST['send'])
+			   && $_POST['send'] == 'send'
+			) {
 				// Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29
-
 				$password = validate($_POST['mysql_password'], 'password');
+				if ($password != '') {
+					// validate password
+					$password = validatePassword($password);

-				if($password != '')
-				{
 					// Begin root-session
-
 					$db_root = new db($sql_root[$result['dbserver']]['host'], $sql_root[$result['dbserver']]['user'], $sql_root[$result['dbserver']]['password'], '');
-					unset($db_root->password);
-					foreach(array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host)
-					{
+					foreach (array_map('trim', explode(',', $settings['system']['mysql_access_host'])) as $mysql_access_host) {
 						$db_root->query('SET PASSWORD FOR `' . $db_root->escape($result['databasename']) . '`@`' . $db_root->escape($mysql_access_host) . '` = PASSWORD(\'' . $db_root->escape($password) . '\')');
 					}

 					$db_root->query('FLUSH PRIVILEGES');
 					$db_root->close();
-
 					// End root-session
 				}

 				// Update the Database description -- PH 2004-11-29
-
 				$log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'");
 				$databasedescription = validate($_POST['description'], 'description');
 				$result = $db->query('UPDATE `' . TABLE_PANEL_DATABASES . '` SET `description`="' . $db->escape($databasedescription) . '" WHERE `customerid`="' . (int)$userinfo['customerid'] . '" AND `id`="' . (int)$id . '"');
 				redirectTo($filename, Array('page' => $page, 's' => $s));
-			}
-			else
-			{
-				eval("echo \"" . getTemplate("mysql/mysqls_edit") . "\";");
+			} else {
+				$mysql_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/mysql/formfield.mysql_edit.php';
+				$mysql_edit_form = htmlform::genHTMLForm($mysql_edit_data);
+
+				$title = $mysql_edit_data['mysql_edit']['title'];
+				$image = $mysql_edit_data['mysql_edit']['image'];
+
+				eval("echo \"" . getTemplate('mysql/mysqls_edit') . "\";");
 			}
 		}
 	}
 }
-
-?>
--- a/customer_tickets.php
+++ b/customer_tickets.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -28,6 +28,17 @@ require ("./lib/init.php");
 if(isset($_POST['id']))
 {
 	$id = intval($_POST['id']);
+	
+	/*
+	 * Check if the current user is allowed to see the current ticket.
+	 */
+	$sql = "SELECT `id` FROM `panel_tickets` WHERE `id` = '".$id."' AND `customerid` = '".$userinfo['customerid']."'";
+	
+	$result = $db->query_first($sql);
+	if ($result == null) {
+		// no rights to see the requested ticket
+		standard_error(array('ticketnotaccessible'));
+	}
 }
 elseif(isset($_GET['id']))
 {
@@ -37,7 +48,7 @@ elseif(isset($_GET['id']))
 if($page == 'overview')
 {
 	$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets");
-	eval("echo \"" . getTemplate("ticket/ticket") . "\";");
+	eval("echo \"" . getTemplate("tickets/ticket") . "\";");
 }
 elseif($page == 'tickets')
 {
@@ -55,7 +66,7 @@ elseif($page == 'tickets')
 		$paging = new paging($userinfo, $db, TABLE_PANEL_TICKETS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
 		$paging->sortfield = 'lastchange';
 		$paging->sortorder = 'desc';
-		$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" AND `adminid`="' . (int)$userinfo['adminid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
+		$result = $db->query('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub` WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority` FROM `' . TABLE_PANEL_TICKETS . '` as `main` WHERE `main`.`answerto` = "0" AND `archived` = "0" AND `customerid`="' . (int)$userinfo['customerid'] . '" ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
 		$paging->setEntries($db->num_rows($result));
 		$sortcode = $paging->getHtmlSortCode($lng);
 		$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
@@ -98,12 +109,13 @@ elseif($page == 'tickets')
 					$cananswer = 0;
 				}

+				$row['subject'] = html_entity_decode($row['subject']);
 				if(strlen($row['subject']) > 20)
 				{
 					$row['subject'] = substr($row['subject'], 0, 17) . '...';
 				}

-				eval("\$tickets.=\"" . getTemplate("ticket/tickets_tickets") . "\";");
+				eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";");
 				$count++;
 			}

@@ -156,7 +168,7 @@ elseif($page == 'tickets')
 		}

 		$ticketsopen = (int)$opentickets['count'];
-		eval("echo \"" . getTemplate("ticket/tickets") . "\";");
+		eval("echo \"" . getTemplate("tickets/tickets") . "\";");
 	}
 	elseif($action == 'new')
 	{
@@ -209,12 +221,12 @@ elseif($page == 'tickets')
 			else
 			{
 				$categories = '';
-				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
+				$result = $db->query_first('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');

 				if(isset($result['name'])
 				   && $result['name'] != '')
 				{
-					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
+					$result2 = $db->query('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `adminid` = "' . $userinfo['adminid'] . '" ORDER BY `logicalorder`, `name` ASC');

 					while($row = $db->fetch_array($result2))
 					{
@@ -226,9 +238,9 @@ elseif($page == 'tickets')
 					$categories = makeoption($lng['ticket']['no_cat'], '0');
 				}

-				$priorities = makeoption($lng['ticket']['unf_high'], '1');
-				$priorities.= makeoption($lng['ticket']['unf_normal'], '2');
-				$priorities.= makeoption($lng['ticket']['unf_low'], '3');
+				$priorities = makeoption($lng['ticket']['high'], '1', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['normal'], '2', $settings['ticket']['default_priority']);
+				$priorities.= makeoption($lng['ticket']['low'], '3', $settings['ticket']['default_priority']);
 				$ticketsopen = 0;
 				$opentickets = $db->query_first('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
                                           WHERE `customerid` = "' . $userinfo['customerid'] . '"
@@ -246,7 +258,14 @@ elseif($page == 'tickets')
 				}

 				$ticketsopen = (int)$opentickets['count'];
-				eval("echo \"" . getTemplate("ticket/tickets_new") . "\";");
+
+				$ticket_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_add.php';
+				$ticket_add_form = htmlform::genHTMLForm($ticket_add_data);
+
+				$title = $ticket_add_data['ticket_add']['title'];
+				$image = $ticket_add_data['ticket_add']['image'];
+
+				eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
 			}
 		}
 		else
@@ -321,12 +340,18 @@ elseif($page == 'tickets')
 			}
 			else
 			{
-				$by = $lng['ticket']['customer'];
+				$cid = $mainticket->Get('customer');
+				$usr = $db->query_first('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
+						FROM `' . TABLE_PANEL_CUSTOMERS . '`
+						WHERE `customerid` = "' . (int)$cid . '"'
+				);
+				$by = getCorrectFullUserDetails($usr);
+				//$by = $lng['ticket']['customer'];
 			}

 			$subject = $mainticket->Get('subject');
 			$message = $mainticket->Get('message');
-			eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_main") . "\";");
+			eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
 			$result = $db->query('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
                                WHERE `id`="' . (int)$mainticket->Get('category') . '"');
 			$row = $db->fetch_array($result);
@@ -343,12 +368,13 @@ elseif($page == 'tickets')
 				}
 				else
 				{
-					$by = $lng['ticket']['customer'];
+					$by = getCorrectFullUserDetails($usr);
+					//$by = $lng['ticket']['customer'];
 				}

 				$subject = $subticket->Get('subject');
 				$message = $subticket->Get('message');
-				eval("\$ticket_replies.=\"" . getTemplate("ticket/tickets_tickets_list") . "\";");
+				eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
 			}

 			$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
@@ -359,7 +385,13 @@ elseif($page == 'tickets')

 			// don't forget the main-ticket!

-			eval("echo \"" . getTemplate("ticket/tickets_reply") . "\";");
+			$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_reply.php';
+			$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
+
+			$title = $ticket_reply_data['ticket_reply']['title'];
+			$image = $ticket_reply_data['ticket_reply']['image'];
+
+			eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
 		}
 	}
 	elseif($action == 'close'
--- a/customer_traffic.php
+++ b/customer_traffic.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'customer');
@@ -22,21 +22,20 @@ define('AREA', 'customer');
 /**
 * Include our init.php, which manages Sessions, Language etc.
 */
-
-require ("./lib/init.php");
+$intrafficpage = 1;
+require('./lib/init.php');
 $traffic = '';
 $month = null;
 $year = null;

-if(isset($_POST['month'])
-   && isset($_POST['year']))
-{
+if (isset($_POST['month'])
+	&& isset($_POST['year'])
+) {
 	$month = intval($_POST['month']);
 	$year = intval($_POST['year']);
-}
-elseif(isset($_GET['month'])
-       && isset($_GET['year']))
-{
+} elseif (isset($_GET['month'])
+	&& isset($_GET['year'])
+) {
 	$month = intval($_GET['month']);
 	$year = intval($_GET['year']);
 }
@@ -44,40 +43,25 @@ elseif(isset($_GET['month'])
 //BAM! $_GET???

 elseif (isset($_GET['page'])
-       && $_GET['page'] == "current")
-{
-	if(date('d') != '01')
-	{
+	&& $_GET['page'] == 'current'
+) {
+	if (date('d') != '01') {
 		$month = date('m');
 		$year = date('Y');
-	}
-	else
-	{
-		if(date('m') == '01')
-		{
+	} else {
+		if (date('m') == '01') {
 			$month = 12;
 			$year = date('Y') - 1;
-		}
-		else
-		{
+		} else {
 			$month = date('m') - 1;
 			$year = date('Y');
 		}
 	}
 }

-if(!is_null($month)
-   && !is_null($year))
-{
+if (!is_null($month)
+	&& !is_null($year)) {
 	$traf['byte'] = 0;
-	$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
-	                     FROM `" . TABLE_PANEL_TRAFFIC . "`
-	                     WHERE `customerid`='" . $userinfo['customerid'] . "'
-	                     AND `month` = '" . $month . "'
-	                     AND `year` = '" . $year . "'");
-	$row = mysql_fetch_row($result);
-	rsort($row);
-	$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));;
 	$result = $db->query("SELECT
                                SUM(`http`) as 'http', SUM(`ftp_up`) AS 'ftp_up', SUM(`ftp_down`) as 'ftp_down', SUM(`mail`) as 'mail',
                                `day`, `month`, `year`
@@ -90,97 +74,50 @@ if(!is_null($month)
 	$traffic_complete['mail'] = 0;
 	$show = '';

-	while($row = $db->fetch_array($result))
-	{
+	while ($row = $db->fetch_array($result)) {
 		$http = $row['http'];
 		$ftp = $row['ftp_up'] + $row['ftp_down'];
 		$mail = $row['mail'];
 		$traf['byte'] = $http + $ftp + $mail;
-		$traffic_complete['http']+= $http;
-		$traffic_complete['ftp']+= $ftp;
-		$traffic_complete['mail']+= $mail;
-		$traf['day'] = $row['day'];
+		$traffic_complete['http'] += $http;
+		$traffic_complete['ftp'] += $ftp;
+		$traffic_complete['mail'] += $mail;
+		$traf['day'] = $row['day'] . '.';

-		if(extension_loaded('bcmath'))
-		{
+		if (extension_loaded('bcmath')) {
 			$traf['ftptext'] = bcdiv($row['ftp_up'], 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($row['ftp_down'], 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
 			$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
 			$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
-		}
-		else
-		{
+			$traf['ftp'] = bcdiv($ftp, 1024, $settings['panel']['decimal_places']);
+			$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']);
+			$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']);
+			$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
+		} else {
 			$traf['ftptext'] = round($row['ftp_up'] / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($row['ftp_down'] / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
 			$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
 			$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
-		}
-
-		if($traf['byte'] != 0
-		   && $traf['max'] != 0)
-		{
-			$proz = $traf['max'] / 100;
-			$traf['http'] = round($http / $proz, 0);
-			$traf['ftp'] = round($ftp / $proz, 0);
-			$traf['mail'] = round($mail / $proz, 0);
-
-			if($traf['http'] == 0)
-			{
-				$traf['http'] = 1;
-			}
-
-			if($traf['ftp'] == 0)
-			{
-				$traf['ftp'] = 1;
-			}
-
-			if($traf['mail'] == 0)
-			{
-				$traf['mail'] = 1;
-			}
-		}
-		else
-		{
-			$traf['http'] = 0;
-			$traf['ftp'] = 0;
-			$traf['mail'] = 0;
-		}
-
-		if(extension_loaded('bcmath'))
-		{
-			$traf['byte'] = bcdiv($traf['byte'], 1024, $settings['panel']['decimal_places']);
-		}
-		else
-		{
+			$traf['http'] = round($http, $settings['panel']['decimal_places']);
+			$traf['ftp'] = round($ftp, $settings['panel']['decimal_places']);
+			$traf['mail'] = round($mail, $settings['panel']['decimal_places']);
 			$traf['byte'] = round($traf['byte'] / 1024, $settings['panel']['decimal_places']);
 		}

-		eval("\$traffic.=\"" . getTemplate("traffic/traffic_month") . "\";");
-		$show = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
+		eval("\$traffic.=\"" . getTemplate('traffic/traffic_month') . "\";");
+		$show = $lng['traffic']['months'][intval($row['month'])] . ' ' . $row['year'];
 	}

-	if(extension_loaded('bcmath'))
-	{
+	if (extension_loaded('bcmath')) {
 		$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024, $settings['panel']['decimal_places']);
-	}
-	else
-	{
+	} else {
 		$traffic_complete['http'] = round($traffic_complete['http'] / 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024, $settings['panel']['decimal_places']);
 	}

-	eval("echo \"" . getTemplate("traffic/traffic_details") . "\";");
-}
-else
-{
-	$result = $db->query("SELECT MAX(`http`), MAX(`ftp_up`+`ftp_down`), MAX(`mail`)
-	                     FROM `" . TABLE_PANEL_TRAFFIC . "`
-	                     WHERE `customerid`='" . $userinfo['customerid'] . "'
-	                     GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
-	$row = mysql_fetch_row($result);
-	rsort($row);
-	$traf['max'] = ($row[0] > $row[1] ? ($row[0] > $row[2] ? $row[0] : $row[2]) : ($row[1] > $row[2] ? $row[1] : $row[2]));
+	eval("echo \"" . getTemplate('traffic/traffic_details') . "\";");
+} else {
 	$result = $db->query("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail
 	                     FROM `" . TABLE_PANEL_TRAFFIC . "` WHERE `customerid` = '" . $userinfo['customerid'] . "'
 	                     GROUP BY CONCAT(`year`,`month`) ORDER BY CONCAT(`year`,`month`) DESC LIMIT 12");
@@ -188,88 +125,49 @@ else
 	$traffic_complete['ftp'] = 0;
 	$traffic_complete['mail'] = 0;

-	while($row = $db->fetch_array($result))
-	{
+	while ($row = $db->fetch_array($result)) {
 		$http = $row['http'];
 		$ftp_up = $row['ftp_up'];
 		$ftp_down = $row['ftp_down'];
 		$mail = $row['mail'];
-		$traffic_complete['http']+= $http;
-		$traffic_complete['ftp']+= $ftp_up + $ftp_down;
-		$traffic_complete['mail']+= $mail;
+		$traffic_complete['http'] += $http;
+		$traffic_complete['ftp'] += $ftp_up + $ftp_down;
+		$traffic_complete['mail'] += $mail;
 		$traf['month'] = $row['month'];
 		$traf['year'] = $row['year'];
 		$traf['monthname'] = $lng['traffic']['months'][intval($row['month'])] . " " . $row['year'];
 		$traf['byte'] = $http + $ftp_up + $ftp_down + $mail;

-		if(extension_loaded('bcmath'))
-		{
-			$traf['ftptext'] = bcdiv($ftp_up, 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . bcdiv($ftp_down, 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
-			$traf['httptext'] = bcdiv($http, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
-			$traf['mailtext'] = bcdiv($mail, 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
-		}
-		else
-		{
-			$traf['ftptext'] = round($ftp_up / 1024 * 1024, $settings['panel']['decimal_places']) . " GB up/ " . round($ftp_down / 1024 * 1024, $settings['panel']['decimal_places']) . " GB down (FTP)";
-			$traf['httptext'] = round($http / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (HTTP)";
-			$traf['mailtext'] = round($mail / 1024 * 1024, $settings['panel']['decimal_places']) . " GB (Mail)";
+		if (extension_loaded('bcmath')) {
+			$traf['ftptext'] = bcdiv($ftp_up, 1024, $settings['panel']['decimal_places']) . " MB up/ " . bcdiv($ftp_down, 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
+			$traf['httptext'] = bcdiv($http, 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
+			$traf['mailtext'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
+			$traf['ftp'] = bcdiv(($ftp_up + $ftp_down), 1024, $settings['panel']['decimal_places']);
+			$traf['http'] = bcdiv($http, 1024, $settings['panel']['decimal_places']);
+			$traf['mail'] = bcdiv($mail, 1024, $settings['panel']['decimal_places']);
+			$traf['byte'] = bcdiv($traf['byte'], 1024 * 1024, $settings['panel']['decimal_places']);
+		} else {
+			$traf['ftptext'] = round($ftp_up / 1024, $settings['panel']['decimal_places']) . " MB up/ " . round($ftp_down / 1024, $settings['panel']['decimal_places']) . " MB down (FTP)";
+			$traf['httptext'] = round($http / 1024, $settings['panel']['decimal_places']) . " MB (HTTP)";
+			$traf['mailtext'] = round($mail / 1024, $settings['panel']['decimal_places']) . " MB (Mail)";
+			$traf['ftp'] = round(($ftp_up + $ftp_down) / 1024, $settings['panel']['decimal_places']);
+			$traf['http'] = round($http / 1024, $settings['panel']['decimal_places']);
+			$traf['mail'] = round($mail / 1024, $settings['panel']['decimal_places']);
+			$traf['byte'] = round($traf['byte'] / (1024 * 1024), $settings['panel']['decimal_places']);
 		}

-		if($traf['max'] != 0)
-		{
-			$proz = $traf['max'] / 100;
-			$traf['ftp'] = round(($ftp_up + $ftp_down) / $proz, 0);
-			$traf['http'] = round($http / $proz, 0);
-			$traf['mail'] = round($mail / $proz, 0);
-
-			if($traf['http'] == 0)
-			{
-				$traf['http'] = 1;
-			}
-
-			if($traf['ftp'] == 0)
-			{
-				$traf['ftp'] = 1;
-			}
-
-			if($traf['mail'] == 0)
-			{
-				$traf['mail'] = 1;
-			}
-		}
-		else
-		{
-			$traf['ftp'] = 0;
-			$traf['http'] = 0;
-			$traf['mail'] = 0;
-		}
-
-		if(extension_loaded('bcmath'))
-		{
-			$traf['byte'] = bcadd($traf['byte'] / (1024 * 1024), 0.0000, 4);
-		}
-		else
-		{
-			$traf['byte'] = round($traf['byte'] + (1024 * 1024), 4);
-		}
-
-		eval("\$traffic.=\"" . getTemplate("traffic/traffic_traffic") . "\";");
+		eval("\$traffic.=\"" . getTemplate('traffic/traffic_traffic') . "\";");
 	}

-	if(extension_loaded('bcmath'))
-	{
+	if (extension_loaded('bcmath')) {
 		$traffic_complete['http'] = bcdiv($traffic_complete['http'], 1024 * 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['ftp'] = bcdiv($traffic_complete['ftp'], 1024 * 1024, $settings['panel']['decimal_places']);
 		$traffic_complete['mail'] = bcdiv($traffic_complete['mail'], 1024 * 1024, $settings['panel']['decimal_places']);
-	}
-	else
-	{
-		$traffic_complete['http'] = round($traffic_complete['http'] / 1024 * 1024, $settings['panel']['decimal_places']);
-		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / 1024 * 1024, $settings['panel']['decimal_places']);
-		$traffic_complete['mail'] = round($traffic_complete['mail'] / 1024 * 1024, $settings['panel']['decimal_places']);
+	} else {
+		$traffic_complete['http'] = round($traffic_complete['http'] / (1024 * 1024), $settings['panel']['decimal_places']);
+		$traffic_complete['ftp'] = round($traffic_complete['ftp'] / (1024 * 1024), $settings['panel']['decimal_places']);
+		$traffic_complete['mail'] = round($traffic_complete['mail'] / (1024 * 1024), $settings['panel']['decimal_places']);
 	}

-	eval("echo \"" . getTemplate("traffic/traffic") . "\";");
+	eval("echo \"" . getTemplate('traffic/traffic') . "\";");
 }
-
-?>
--- a/images/ball.gif
+++ b/images/ball.gif
--- a/images/changelanguage.gif
+++ b/images/changelanguage.gif
--- a/images/default.png
+++ b/images/default.png
--- a/images/endsection.gif
+++ b/images/endsection.gif
--- a/images/error.gif
+++ b/images/error.gif
--- a/images/error.png
+++ b/images/error.png
--- a/images/footer.gif
+++ b/images/footer.gif
--- a/images/header.gif
+++ b/images/header.gif
--- a/images/header_r.gif
+++ b/images/header_r.gif
--- a/images/info.png
+++ b/images/info.png
--- a/images/login.gif
+++ b/images/login.gif
--- a/images/logininternal.gif
+++ b/images/logininternal.gif
--- a/images/order_asc.gif
+++ b/images/order_asc.gif
--- a/images/order_desc.gif
+++ b/images/order_desc.gif
--- a/images/section.gif
+++ b/images/section.gif
--- a/images/shadow.gif
+++ b/images/shadow.gif
--- a/images/subsection.gif
+++ b/images/subsection.gif
--- a/images/title.gif
+++ b/images/title.gif
--- a/index.php
+++ b/index.php
@@ -14,7 +14,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Panel
- * @version    $Id$
+ *
 */

 define('AREA', 'login');
@@ -22,69 +22,74 @@ define('AREA', 'login');
 /**
 * Include our init.php, which manages Sessions, Language etc.
 */
+require ('./lib/init.php');

-require ("./lib/init.php");
-
-if($action == '')
-{
+if ($action == '') {
 	$action = 'login';
 }

-if($action == 'login')
-{
-	if(isset($_POST['send'])
-	&& $_POST['send'] == 'send')
-	{
+if ($action == 'login') {
+	if (isset($_POST['send'])
+		&& $_POST['send'] == 'send'
+	) {
 		$loginname = validate($_POST['loginname'], 'loginname');
 		$password = validate($_POST['password'], 'password');

 		$row = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");

-		if($row['customer'] == $loginname)
-		{
+		if ($row['customer'] == $loginname) {
 			$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
 			$uid = 'customerid';
 			$adminsession = '0';
 			$is_admin = false;
-		}
-		else
-		{
+		} else {
 			$is_admin = true;
+			if ((int)$settings['login']['domain_login'] == 1) {
+				/**
+				 * check if the customer tries to login with a domain, #374
+				 */
+				$domainname = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname));
+				$row2 = $db->query_first("SELECT `customerid` FROM `".TABLE_PANEL_DOMAINS."` WHERE `domain` = '".$db->escape($domainname)."'");
+	
+				if (isset($row2['customerid']) && $row2['customerid'] > 0) {
+					$loginname = getCustomerDetail($row2['customerid'], 'loginname');
+					if ($loginname !== false) {
+						$row3 = $db->query_first("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
+						if ($row3['customer'] == $loginname) {
+							$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
+							$uid = 'customerid';
+							$adminsession = '0';
+							$is_admin = false;
+						}
+					}
+				}
+			}
 		}

-		if(hasUpdates($version) && $is_admin == false)
-		{
+		if (hasUpdates($version) && $is_admin == false) {
 			redirectTo('index.php');
 			exit;
 		}

-		if($is_admin)
-		{
-			if(hasUpdates($version))
-			{
+		if ($is_admin) {
+			if (hasUpdates($version)) {
 				$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "' AND `change_serversettings` = '1'");
 				/*
 				 * not an admin who can see updates
 				 */
-				if(!isset($row['admin']))
-				{
+				if (!isset($row['admin'])) {
 					redirectTo('index.php');
 					exit;
 				}
-			}
-			else
-			{
+			} else {
 				$row = $db->query_first("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname`='" . $db->escape($loginname) . "'");
 			}

-			if($row['admin'] == $loginname)
-			{
+			if ($row['admin'] == $loginname) {
 				$table = "`" . TABLE_PANEL_ADMINS . "`";
 				$uid = 'adminid';
 				$adminsession = '1';
-			}
-			else
-			{
+			} else {
 				redirectTo('index.php', Array('showmessage' => '2'), true);
 				exit;
 			}
@@ -92,235 +97,240 @@ if($action == 'login')

 		$userinfo = $db->query_first("SELECT * FROM $table WHERE `loginname`='" . $db->escape($loginname) . "'");

-		if($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
-		&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime']))
-		{
+		if ($userinfo['loginfail_count'] >= $settings['login']['maxloginattempts']
+			&& $userinfo['lastlogin_fail'] > (time() - $settings['login']['deactivatetime'])
+		) {
 			redirectTo('index.php', Array('showmessage' => '3'), true);
 			exit;
-		}
-		elseif($userinfo['password'] == md5($password))
-		{
+		} elseif($userinfo['password'] == md5($password)) {
 			// login correct
 			// reset loginfail_counter, set lastlogin_succ
-
 			$db->query("UPDATE $table SET `lastlogin_succ`='" . time() . "', `loginfail_count`='0' WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
 			$userinfo['userid'] = $userinfo[$uid];
 			$userinfo['adminsession'] = $adminsession;
-		}
-		else
-		{
+		} else {
 			// login incorrect
-
 			$db->query("UPDATE $table SET `lastlogin_fail`='" . time() . "', `loginfail_count`=`loginfail_count`+1 WHERE `$uid`='" . (int)$userinfo[$uid] . "'");
 			unset($userinfo);
 			redirectTo('index.php', Array('showmessage' => '2'), true);
 			exit;
 		}

-		if(isset($userinfo['userid'])
-		&& $userinfo['userid'] != '')
-		{
+		if (isset($userinfo['userid'])
+			&& $userinfo['userid'] != ''
+		) {
 			$s = md5(uniqid(microtime(), 1));

-			if(isset($_POST['language']))
-			{
+			if (isset($_POST['language'])) {
 				$language = validate($_POST['language'], 'language');
-
-				if($language == 'profile')
-				{
+				if ($language == 'profile') {
 					$language = $userinfo['def_language'];
-				}
-				elseif(!isset($languages[$language]))
-				{
+				} elseif(!isset($languages[$language])) {
 					$language = $settings['panel']['standardlanguage'];
 				}
-			}
-			else
-			{
+			} else {
 				$language = $settings['panel']['standardlanguage'];
 			}

-			if($settings['session']['allow_multiple_login'] != '1')
-			{
+			if (isset($userinfo['theme']) && $userinfo['theme'] != '') {
+				$theme = $userinfo['theme'];
+			} else {
+				$theme = $settings['panel']['default_theme'];
+			}
+
+			if ($settings['session']['allow_multiple_login'] != '1') {
 				$db->query("DELETE FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = '" . (int)$userinfo['userid'] . "' AND `adminsession` = '" . $db->escape($userinfo['adminsession']) . "'");
 			}

-			$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
+			// check for field 'theme' in session-table, refs #607
+			$fields = mysql_list_fields($db->getDbName(), TABLE_PANEL_SESSIONS);
+			$columns = mysql_num_fields($fields);
+			$field_array = array();
+			for ($i = 0; $i < $columns; $i++) {
+				$field_array[] = mysql_field_name($fields, $i);
+			}

-			if($userinfo['adminsession'] == '1')
-			{
-				if(hasUpdates($version))
-				{
+			if (!in_array('theme', $field_array)) {
+				$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "')");
+    			} else {
+    				$db->query("INSERT INTO `" . TABLE_PANEL_SESSIONS . "` (`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`) VALUES ('" . $db->escape($s) . "', '" . (int)$userinfo['userid'] . "', '" . $db->escape($remote_addr) . "', '" . $db->escape($http_user_agent) . "', '" . time() . "', '" . $db->escape($language) . "', '" . $db->escape($userinfo['adminsession']) . "', '" . $db->escape($theme) . "')");
+    			}
+
+			if ($userinfo['adminsession'] == '1') {
+				if (hasUpdates($version)) {
 					redirectTo('admin_updates.php', Array('s' => $s), true);
-					exit;
-				}
-				else
-				{
+				} else {
 					redirectTo('admin_index.php', Array('s' => $s), true);
-					exit;
 				}
-			}
-			else
-			{
+			} else {
 				redirectTo('customer_index.php', Array('s' => $s), true);
-				exit;
 			}
-		}
-		else
-		{
+		} else {
 			redirectTo('index.php', Array('showmessage' => '2'), true);
-			exit;
 		}
-	}
-	else
-	{
+		exit;
+	} else {
 		$language_options = '';
-		$language_options.= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
+		$language_options .= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);

-		while(list($language_file, $language_name) = each($languages))
-		{
-			$language_options.= makeoption($language_name, $language_file, 'profile', true);
+		while (list($language_file, $language_name) = each($languages)) {
+			$language_options .= makeoption($language_name, $language_file, 'profile', true);
 		}

 		$smessage = isset($_GET['showmessage']) ? (int)$_GET['showmessage'] : 0;
 		$message = '';
+		$successmessage = '';

-		switch($smessage)
-		{
+		switch ($smessage) {
 			case 1:
-				$message = $lng['pwdreminder']['success'];
+				$successmessage = $lng['pwdreminder']['success'];
 				break;
 			case 2:
 				$message = $lng['error']['login'];
 				break;
 			case 3:
-				$message = $lng['error']['login_blocked'];
+				$message = sprintf($lng['error']['login_blocked'],$settings['login']['deactivatetime']);
 				break;
 			case 4:
-				$message = $lng['error']['errorsendingmail'];
+				$cmail = isset($_GET['customermail']) ? $_GET['customermail'] : 'unknown';
+				$message = str_replace('%s', $cmail, $lng['error']['errorsendingmail']);
+				break;
+			case 5:
+				$message = $lng['error']['user_banned'];
 				break;
 		}

 		$update_in_progress = '';
-		if(hasUpdates($version))
-		{
+		if (hasUpdates($version)) {
 			$update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin'];
 		}

-		eval("echo \"" . getTemplate("login") . "\";");
+		eval("echo \"" . getTemplate('login') . "\";");
 	}
 }

-if($action == 'forgotpwd')
-{
-	if(isset($_POST['send'])
-	&& $_POST['send'] == 'send')
-	{
-		$adminchecked = false;
+if ($action == 'forgotpwd') {
+	$adminchecked = false;
+	$message = '';
+
+	if (isset($_POST['send'])
+		&& $_POST['send'] == 'send'
+	) {
 		$loginname = validate($_POST['loginname'], 'loginname');
 		$email = validateEmail($_POST['loginemail'], 'email');
-		$sql = "SELECT `customerid`, `firstname`, `name`, `email`, `loginname` FROM `" . TABLE_PANEL_CUSTOMERS . "`
+		$sql = "SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_CUSTOMERS . "`
 				WHERE `loginname`='" . $db->escape($loginname) . "'
 				AND `email`='" . $db->escape($email) . "'";
 		$result = $db->query($sql);

-		if($db->num_rows() == 0)
-		{
-			$sql = "SELECT `adminid`, `name`, `email`, `loginname` FROM `" . TABLE_PANEL_ADMINS . "`
+		if ($db->num_rows() == 0) {
+			$sql = "SELECT `adminid`, `name`, `email`, `loginname`, `def_language` FROM `" . TABLE_PANEL_ADMINS . "`
 				WHERE `loginname`='" . $db->escape($loginname) . "'
 				AND `email`='" . $db->escape($email) . "'";
 			$result = $db->query($sql);
-			$adminchecked = true;
-		}
-
-		$user = $db->fetch_array($result);
-
-		if(($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
-		|| $adminchecked == false)
-		{
-			if($user !== false)
-			{
-				$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
-
-				if($adminchecked)
-				{
-					$db->query("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `password`='" . md5($password) . "'
-							WHERE `loginname`='" . $user['loginname'] . "'
-							AND `email`='" . $user['email'] . "'");
-				}
-				else
-				{
-					$db->query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `password`='" . md5($password) . "'
-							WHERE `loginname`='" . $user['loginname'] . "'
-							AND `email`='" . $user['email'] . "'");
-				}
-
-				$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
-				$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
-				$body = strtr($lng['pwdreminder']['body'], array('%s' => $user['firstname'] . ' ' . $user['name'], '%p' => $password));
 				
-				$_mailerror = false;
-				try {
-					$mail->Subject = $lng['pwdreminder']['subject'];
-					$mail->AltBody = $body;
-					$mail->MsgHTML(str_replace("\\n", "<br />", $body));
-					$mail->AddAddress($user['email'], $user['firstname'] . ' ' . $user['name']);
-					$mail->Send();
-				} catch(phpmailerException $e) {
-					$mailerr_msg = $e->errorMessage();
-					$_mailerror = true;
-				} catch (Exception $e) {
-					$mailerr_msg = $e->getMessage();
-					$_mailerror = true;
-				}
+			if ($db->num_rows() > 0) {
+				$adminchecked = true;
+			} else {
+				$result = null;
+			}
+		}
+
+		if ($result !== null) {
+			$user = $db->fetch_array($result);
+			
+			/* Check whether user is banned */
+			if ($user['deactivated']) {
+				$message = $lng['pwdreminder']['notallowed'];
+				redirectTo('index.php', Array('showmessage' => '5'), true);
+			}
+
+			if (($adminchecked && $settings['panel']['allow_preset_admin'] == '1')
+				|| $adminchecked == false
+			) {
+				if ($user !== false) {
+					if ($settings['panel']['password_min_length'] <= 6) {
+						$password = substr(md5(uniqid(microtime(), 1)), 12, 6);
+					} else {
+						// make it two times larger than password_min_length
+						$rnd = '';
+						$minlength = $settings['panel']['password_min_length'];
+						while (strlen($rnd) < ($minlength * 2)) {
+							$rnd .= md5(uniqid(microtime(), 1));
+						}
+						$password = substr($rnd, (int)($minlength / 2), $minlength);
+					}
+
+					$passwordTable = $adminchecked ? TABLE_PANEL_ADMINS : TABLE_PANEL_CUSTOMERS;
+					$db->query("UPDATE `" . $passwordTable . "` SET `password`='" . md5($password) . "'
+							WHERE `loginname`='" . $user['loginname'] . "'
+							AND `email`='" . $user['email'] . "'");

-				if ($_mailerror) {
 					$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
-					$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
-					redirectTo('index.php', Array('showmessage' => '4'), true);
+					$rstlog->logAction(USR_ACTION, LOG_WARNING, "Password for user '" . $user['loginname'] . "' has been reset!");
+
+					$replace_arr = array(
+						'SALUTATION' => getCorrectUserSalutation($user),
+						'USERNAME' => $user['loginname'],
+						'PASSWORD' => $password
+					);
+
+					$body = strtr($lng['pwdreminder']['body'], array('%s' => $user['firstname'] . ' ' . $user['name'], '%p' => $password));
+
+					$def_language = ($user['def_language'] != '') ? $user['def_language'] : $settings['panel']['standardlanguage'];
+					$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$user['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'password_reset_subject\'');
+					$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['pwdreminder']['subject']), $replace_arr));
+					$result = $db->query_first('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '` WHERE `adminid`=\'' . (int)$user['adminid'] . '\' AND `language`=\'' . $db->escape($def_language) . '\' AND `templategroup`=\'mails\' AND `varname`=\'password_reset_mailbody\'');
+					$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $body), $replace_arr));
+						
+					$_mailerror = false;
+					try {
+						$mail->Subject = $mail_subject;
+						$mail->AltBody = $mail_body;
+						$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
+						$mail->AddAddress($user['email'], $user['firstname'] . ' ' . $user['name']);
+						$mail->Send();
+					} catch(phpmailerException $e) {
+						$mailerr_msg = $e->errorMessage();
+						$_mailerror = true;
+					} catch (Exception $e) {
+						$mailerr_msg = $e->getMessage();
+						$_mailerror = true;
+					}
+
+					if ($_mailerror) {
+						$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
+						$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
+						redirectTo('index.php', Array('showmessage' => '4', 'customermail' => $user['email']), true);
+						exit;
+					}
+
+					$mail->ClearAddresses();
+					redirectTo('index.php', Array('showmessage' => '1'), true);
 					exit;
+				} else {
+					$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
+					$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
+					$message = $lng['login']['combination_not_found'];
 				}

-				$mail->ClearAddresses();
-				redirectTo('index.php', Array('showmessage' => '1'), true);
-				exit;
+				unset($user);
 			}
-			else
-			{
-				$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'), $db, $settings);
-				$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to reset pwd but wasn't found in database!");
-				$message = $lng['login']['usernotfound'];
-			}
-
-			unset($user);
-		}
-		else
-		{
-			$message = '';
+		} else {
+			$message = $lng['login']['usernotfound'];
 		}
 	}
-	else
-	{
-		$message = '';
-	}

-	if($adminchecked)
-	{
-		if($settings['panel']['allow_preset_admin'] != '1')
-		{
+	if ($adminchecked) {
+		if ($settings['panel']['allow_preset_admin'] != '1') {
 			$message = $lng['pwdreminder']['notallowed'];
 			unset ($adminchecked);
 		}
-	}
-	else
-	{
-		if($settings['panel']['allow_preset'] != '1')
-		{
+	} else {
+		if ($settings['panel']['allow_preset'] != '1') {
 			$message = $lng['pwdreminder']['notallowed'];
 		}
 	}

-	eval("echo \"" . getTemplate("fpwd") . "\";");
+	eval("echo \"" . getTemplate('fpwd') . "\";");
 }
-
-?>
--- a/install/froxlor.sql
+++ b/install/froxlor.sql
--- a/install/install.php
+++ b/install/install.php
@@ -2,7 +2,6 @@

 /**
 * This file is part of the Froxlor project.
- * Copyright (c) 2003-2009 the SysCP Team (see authors).
 * Copyright (c) 2010 the Froxlor Team (see authors).
 *
 * For the full copyright and license information, please view the COPYING
@@ -10,819 +9,14 @@
 * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
 *
 * @copyright  (c) the authors
- * @author     Florian Lippert <flo@syscp.org> (2003-2009)
+ * @author     Michael Kaufmann <mkaufmann@nutime.de>
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Install
- * @version    $Id$
+ *
 */

-/**
- * Most elements are taken from the phpBB (www.phpbb.com)
- * installer, (c) 1999 - 2004 phpBB Group.
- */
+require 'lib/class.FroxlorInstall.php';

-if(file_exists('../lib/userdata.inc.php'))
-{
-	/**
-	 * Includes the Usersettings eg. MySQL-Username/Passwort etc. to test if Froxlor is already installed
-	 */
-
-	require ('../lib/userdata.inc.php');
-
-	if(isset($sql)
-	   && is_array($sql))
-	{
-		die('Sorry, Froxlor is already configured...');
-	}
-}
-
-/**
- * Include the functions
- */
-
-require ('../lib/functions.php');
-
-/**
- * Include the MySQL-Table-Definitions
- */
-
-require ('../lib/tables.inc.php');
-
-/**
- * Language Managament
- */
-
-$languages = Array(
-	'german' => 'Deutsch',
-	'english' => 'English',
-	'french' => 'Francais'
-);
-$standardlanguage = 'english';
-
-if(isset($_GET['language'])
-   && isset($languages[$_GET['language']]))
-{
-	$language = $_GET['language'];
-}
-elseif(isset($_POST['language'])
-       && isset($languages[$_POST['language']]))
-{
-	$language = $_POST['language'];
-}
-else
-{
-	$language = $standardlanguage;
-}
-
-if(file_exists('./lng/' . $language . '.lng.php'))
-{
-	/**
-	 * Includes file /lng/$language.lng.php if it exists
-	 */
-
-	require ('./lng/' . $language . '.lng.php');
-}
-
-/**
- * BEGIN FUNCTIONS -----------------------------------------------
- */
-
-function page_header()
-{
-
-?>
-<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
-<html xmlns="http://www.w3.org/1999/xhtml">
-<head>
-	<meta content="text/html; charset=ISO-8859-1" http-equiv="content-type" />
-	<link rel="stylesheet" href="../templates/main.css" type="text/css" />
-	<title>Froxlor</title>
-</head>
-	<body style="margin: 0; padding: 0;" onload="document.loginform.loginname.focus()">
-		<!--
-			We request you retain the full copyright notice below including the link to www.froxlor.org.
-			This not only gives respect to the large amount of time given freely by the developers
-			but also helps build interest, traffic and use of Froxlor. If you refuse
-			to include even this then support on our forums may be affected.
-			The Froxlor Team : 2009-2010
-		// -->
-		<!--
-			Templates based on work by Luca Piona (info@havanastudio.ch) and Luca Longinotti (chtekk@gentoo.org)
-		// -->
-		<table cellspacing="0" cellpadding="0" border="0" width="100%">
-			<tr>
-				<td width="800"><img src="../images/header.gif" width="800" height="90" alt="" /></td>
-				<td class="header">&nbsp;</td>
-			</tr>
-		</table>
-		<table cellspacing="0" cellpadding="0" border="0" width="100%">
-			<tr>
-				<td valign="top" bgcolor="#FFFFFF">
-				<br />
-				<br />
-<?php
-}
-
-function page_footer()
-{
-
-?>
-				</td>
-			</tr>
-		</table>
-		<table cellspacing="0" cellpadding="0" border="0" width="100%">
-			<tr>
-				<td width="100%" class="footer">
-					<br />Froxlor &copy; 2009-2010 by <a href="http://www.froxlor.org/" target="_blank">the Froxlor Team</a>
-					<br /><br/>
-				</td>
-			</tr>
-		</table>
-	</body>
-</html>
-<?php
-}
-
-function status_message($case, $text)
-{
-	if($case == 'begin')
-	{
-		echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\">$text";
-	}
-	else
-	{
-		echo " <span style=\"color:$case;\">$text</span></td>\n\t\t</tr>\n";
-	}
-}
-
-/**
- * END FUNCTIONS ---------------------------------------------------
- */
-
-/**
- * BEGIN VARIABLES ---------------------------------------------------
- */
-
-//guess Servername
-
-if(!empty($_POST['servername']))
-{
-	$servername = $_POST['servername'];
-}
-else
-{
-	if(!empty($_SERVER['SERVER_NAME']))
-	{
-		if(validate_ip($_SERVER['SERVER_NAME'], true) == false)
-		{
-			$servername = $_SERVER['SERVER_NAME'];
-		}
-		else
-		{
-			$servername = '';
-		}
-	}
-	else
-	{
-		$servername = '';
-	}
-}
-
-//guess serverip
-
-if(!empty($_POST['serverip']))
-{
-	$serverip = $_POST['serverip'];
-}
-else
-{
-	if(!empty($_SERVER['SERVER_ADDR']))
-	{
-		$serverip = $_SERVER['SERVER_ADDR'];
-	}
-	else
-	{
-		$serverip = '';
-	}
-}
-
-if(!empty($_POST['mysql_host']))
-{
-	$mysql_host = $_POST['mysql_host'];
-}
-else
-{
-	$mysql_host = '127.0.0.1';
-}
-
-if(!empty($_POST['mysql_database']))
-{
-	$mysql_database = $_POST['mysql_database'];
-}
-else
-{
-	$mysql_database = 'froxlor';
-}
-
-if(!empty($_POST['mysql_unpriv_user']))
-{
-	$mysql_unpriv_user = $_POST['mysql_unpriv_user'];
-}
-else
-{
-	$mysql_unpriv_user = 'froxlor';
-}
-
-if(!empty($_POST['mysql_unpriv_pass']))
-{
-	$mysql_unpriv_pass = $_POST['mysql_unpriv_pass'];
-}
-else
-{
-	$mysql_unpriv_pass = '';
-}
-
-if(!empty($_POST['mysql_root_user']))
-{
-	$mysql_root_user = $_POST['mysql_root_user'];
-}
-else
-{
-	$mysql_root_user = 'root';
-}
-
-if(!empty($_POST['mysql_root_pass']))
-{
-	$mysql_root_pass = $_POST['mysql_root_pass'];
-}
-else
-{
-	$mysql_root_pass = '';
-}
-
-if(!empty($_POST['admin_user']))
-{
-	$admin_user = $_POST['admin_user'];
-}
-else
-{
-	$admin_user = 'admin';
-}
-
-if(!empty($_POST['admin_pass1']))
-{
-	$admin_pass1 = $_POST['admin_pass1'];
-}
-else
-{
-	$admin_pass1 = '';
-}
-
-if(!empty($_POST['admin_pass2']))
-{
-	$admin_pass2 = $_POST['admin_pass2'];
-}
-else
-{
-	$admin_pass2 = '';
-}
-
-if($mysql_host == 'localhost'
-   || $mysql_host == '127.0.0.1')
-{
-	$mysql_access_host = $mysql_host;
-}
-else
-{
-	$mysql_access_host = $serverip;
-}
-
-// gues http software
-
-if(!empty($_POST['webserver']))
-{
-	$webserver = $_POST['webserver'];
-}
-else
-{
-	if(strtoupper(@php_sapi_name()) == "APACHE2HANDLER"
-	   || stristr($_SERVER[SERVER_SOFTWARE], "apache/2"))
-	{
-		$webserver = 'apache2';
-	}
-	elseif(substr(strtoupper(@php_sapi_name()), 0, 8) == "LIGHTTPD"
-	       || stristr($_SERVER[SERVER_SOFTWARE], "lighttpd"))
-	{
-		$webserver = 'lighttpd';
-	}
-	else
-	{
-		// we don't need to bail out, since unknown does not affect any critical installation routines
-
-		$webserver = 'unknown';
-	}
-}
-
-if(!empty($_POST['httpuser']))
-{
-	$httpuser = $_POST['httpuser'];
-}
-else
-{
-	$httpuser = '';
-}
-
-if(!empty($_POST['httpgroup']))
-{
-	$httpgroup = $_POST['httpgroup'];
-}
-else
-{
-	$httpgroup = '';
-}
-
-/**
- * END VARIABLES ---------------------------------------------------
- */
-
-/**
- * BEGIN INSTALL ---------------------------------------------------
- */
-
-if(isset($_POST['installstep'])
-   && $_POST['installstep'] == '1'
-   && $admin_pass1 == $admin_pass2
-   && $admin_pass1 != ''
-   && $admin_pass2 != ''
-   && $mysql_unpriv_pass != ''
-   && $mysql_root_pass != ''
-   && $servername != ''
-   && $serverip != ''
-   && $httpuser != ''
-   && $httpgroup != ''
-   && $mysql_unpriv_user != $mysql_root_user)
-{
-	page_header();
-
-?>
-	<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable">
-		<tr>
-			<td class="maintitle"><b><img src="../images/title.gif" alt="" />&nbsp;Froxlor Installation</b></td>
-		</tr>
-<?php
-	$_die = false;
-	
-	// check for correct php version
-	status_message('begin', $lng['install']['phpversion']);
-
-	if(version_compare("5.2.0", PHP_VERSION, ">="))
-	{
-		status_message('red', $lng['install']['notinstalled']);
-		$_die = true;
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-
-
-	status_message('begin', $lng['install']['phpmysql']);
-
-	if(!extension_loaded('mysql'))
-	{
-		status_message('red', $lng['install']['notinstalled']);
-		$_die = true;
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-
-	status_message('begin', $lng['install']['phpfilter']);
-
-	if(!extension_loaded('filter'))
-	{
-		status_message('red', $lng['install']['notinstalled']);
-		$_die = true;
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-
-	status_message('begin', $lng['install']['phpposix']);	
-
-	if(!extension_loaded('posix'))
-	{
-		status_message('red', $lng['install']['notinstalled']);
-		$_die = true;
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-	
-	status_message('begin', $lng['install']['phpbcmath']);
-
-	if(!extension_loaded('bcmath'))
-	{
-		status_message('orange', $lng['install']['notinstalled'] . '<br />' . $lng['install']['bcmathdescription']);
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-
-	status_message('begin', $lng['install']['openbasedir']);
-	$php_ob = @ini_get("open_basedir");
-
-	if(!empty($php_ob)
-	   && $php_ob != '')
-	{
-		status_message('orange', $lng['install']['openbasedirenabled']);
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-
-	if($_die)
-	{
-		status_message('begin', $lng['install']['diedbecauseofrequirements']);
-		die();
-	}
-
-	//first test if we can access the database server with the given root user and password
-
-	status_message('begin', $lng['install']['testing_mysql']);
-	$db_root = new db($mysql_host, $mysql_root_user, $mysql_root_pass, '');
-
-	//ok, if we are here, the database class is build up (otherwise it would have already die'd this script)
-
-	status_message('green', 'OK');
-
-	//first we make a backup of the old DB if it exists
-
-	status_message('begin', $lng['install']['backup_old_db']);
-	$result = mysql_list_tables($mysql_database);
-
-	if($result)
-	{
-		$filename = "/tmp/froxlor_backup_" . date(YmdHi) . ".sql";
-
-		if(is_file("/usr/bin/mysqldump"))
-		{
-			$command = "/usr/bin/mysqldump " . $mysql_database . " -u " . $mysql_root_user . " --password='" . $mysql_root_pass . "' --result-file=" . $filename;
-			$output = exec($command);
-
-			if(stristr($output, "error"))
-			{
-				status_message('red', $lng['install']['backing_up_failed']);
-			}
-			else
-			{
-				status_message('green', 'OK');
-			}
-		}
-		else
-		{
-			status_message('red', $lng['install']['backing_up_binary_missing']);
-		}
-	}
-
-	//so first we have to delete the database and the user given for the unpriv-user if they exit
-
-	status_message('begin', $lng['install']['erasing_old_db']);
-	$db_root->query("DELETE FROM `mysql`.`user` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
-	$db_root->query("DELETE FROM `mysql`.`db` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
-	$db_root->query("DELETE FROM `mysql`.`tables_priv` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
-	$db_root->query("DELETE FROM `mysql`.`columns_priv` WHERE `User` = '" . $db_root->escape($mysql_unpriv_user) . "' AND `Host` = '" . $db_root->escape($mysql_access_host) . "'");
-	$db_root->query("DROP DATABASE IF EXISTS `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "` ;");
-	$db_root->query("FLUSH PRIVILEGES;");
-	status_message('green', 'OK');
-
-	//then we have to create a new user and database for the froxlor unprivileged mysql access
-
-	status_message('begin', $lng['install']['create_mysqluser_and_db']);
-	$db_root->query("CREATE DATABASE `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "`");
-	$mysql_access_host_array = array_map('trim', explode(',', $mysql_access_host));
-
-	if(in_array('127.0.0.1', $mysql_access_host_array)
-	   && !in_array('localhost', $mysql_access_host_array))
-	{
-		$mysql_access_host_array[] = 'localhost';
-	}
-
-	if(!in_array('127.0.0.1', $mysql_access_host_array)
-	   && in_array('localhost', $mysql_access_host_array))
-	{
-		$mysql_access_host_array[] = '127.0.0.1';
-	}
-
-	$mysql_access_host_array[] = $serverip;
-	foreach($mysql_access_host_array as $mysql_access_host)
-	{
-		$db_root->query("GRANT ALL PRIVILEGES ON `" . $db_root->escape(str_replace('`', '', $mysql_database)) . "`.* TO '" . $db_root->escape($mysql_unpriv_user) . "'@'" . $db_root->escape($mysql_access_host) . "' IDENTIFIED BY 'password'");
-		$db_root->query("SET PASSWORD FOR '" . $db_root->escape($mysql_unpriv_user) . "'@'" . $db_root->escape($mysql_access_host) . "' = PASSWORD('" . $db_root->escape($mysql_unpriv_pass) . "')");
-	}
-
-	$db_root->query("FLUSH PRIVILEGES;");
-	$mysql_access_host = implode(',', $mysql_access_host_array);
-	status_message('green', 'OK');
-
-	//now a new database and the new froxlor-unprivileged-mysql-account have been created and we can fill it now with the data.
-
-	status_message('begin', $lng['install']['testing_new_db']);
-	$db = new db($mysql_host, $mysql_unpriv_user, $mysql_unpriv_pass, $mysql_database);
-	status_message('green', 'OK');
-	status_message('begin', $lng['install']['importing_data']);
-	$db_schema = './froxlor.sql';
-	$sql_query = @file_get_contents($db_schema, 'r');
-	$sql_query = remove_remarks($sql_query);
-	$sql_query = split_sql_file($sql_query, ';');
-	for ($i = 0;$i < sizeof($sql_query);$i++)
-	{
-		if(trim($sql_query[$i]) != '')
-		{
-			$result = $db->query($sql_query[$i]);
-		}
-	}
-
-	status_message('green', 'OK');
-	status_message('begin', 'System Servername...');
-
-	if(validate_ip($_SERVER['SERVER_NAME'], true) !== false)
-	{
-		status_message('red', $lng['install']['servername_should_be_fqdn']);
-	}
-	else
-	{
-		status_message('green', 'OK');
-	}
-
-	//now let's change the settings in our settings-table
-
-	status_message('begin', $lng['install']['changing_data']);
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = 'admin@" . $db->escape($servername) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'adminmail'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($serverip) . "' WHERE `settinggroup` = 'system' AND `varname` = 'ipaddress'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($servername) . "' WHERE `settinggroup` = 'system' AND `varname` = 'hostname'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($version) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'version'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($languages[$language]) . "' WHERE `settinggroup` = 'panel' AND `varname` = 'standardlanguage'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($mysql_access_host) . "' WHERE `settinggroup` = 'system' AND `varname` = 'mysql_access_host'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($webserver) . "' WHERE `settinggroup` = 'system' AND `varname` = 'webserver'");
-
-	//FIXME
-
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpuser) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpuser'");
-	$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '" . $db->escape($httpgroup) . "' WHERE `settinggroup` = 'system' AND `varname` = 'httpgroup'");
-
-	if($webserver == "apache2")
-	{
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/sites-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/apache2/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/apache2 reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
-	}
-	elseif($webserver == "lighttpd")
-	{
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/conf-enabled/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_vhost'");
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-diroptions/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_diroptions'");
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/froxlor-htpasswd/' WHERE `settinggroup` = 'system' AND `varname` = 'apacheconf_htpasswddir'");
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/init.d/lighttpd reload' WHERE `settinggroup` = 'system' AND `varname` = 'apachereload_command'");
-		$db->query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '/etc/lighttpd/lighttpd.pem' WHERE `settinggroup` = 'system' AND `varname` = 'ssl_cert_file'");
-	}
-
-	// insert the lastcronrun to be the installation date
-
-	$query = 'UPDATE `%s` SET `value` = UNIX_TIMESTAMP() WHERE `settinggroup` = \'system\'  AND `varname` = \'lastcronrun\'';
-	$query = sprintf($query, TABLE_PANEL_SETTINGS);
-	$db->query($query);
-
-	// and lets insert the default ip and port
-
-	$query = 'INSERT INTO `%s`  SET `ip`   = \'%s\',  `port` = \'80\' ';
-	$query = sprintf($query, TABLE_PANEL_IPSANDPORTS, $db->escape($serverip));
-	$db->query($query);
-	$defaultip = $db->insert_id();
-
-	// insert the defaultip
-
-	$query = 'UPDATE `%s` SET `value` = \'%s\' WHERE `settinggroup` = \'system\'  AND `varname` = \'defaultip\'';
-	$query = sprintf($query, TABLE_PANEL_SETTINGS, $db->escape($defaultip));
-	$db->query($query);
-	status_message('green', 'OK');
-
-	//last but not least create the main admin
-
-	status_message('begin', $lng['install']['adding_admin_user']);
-	$db->query("INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET
-		`loginname` = '" . $db->escape($admin_user) . "',
-		`password` = '" . md5($admin_pass1) . "',
-		`name` = 'Siteadmin',
-		`email` = 'admin@" . $db->escape($servername) . "',
-		`customers` = -1,
-		`customers_used` = 0,
-		`customers_see_all` = 1,
-		`caneditphpsettings` = 1,
-		`domains` = -1,
-		`domains_used` = 0,
-		`domains_see_all` = 1,
-		`change_serversettings` = 1,
-		`diskspace` = -1024,
-		`diskspace_used` = 0,
-		`mysqls` = -1,
-		`mysqls_used` = 0,
-		`emails` = -1,
-		`emails_used` = 0,
-		`email_accounts` = -1,
-		`email_accounts_used` = 0,
-		`email_forwarders` = -1,
-		`email_forwarders_used` = 0,
-		`email_quota` = -1,
-		`email_quota_used` = 0,
-		`ftps` = -1,
-		`ftps_used` = 0,
-		`tickets` = -1,
-		`tickets_used` = 0,
-		`subdomains` = -1,
-		`subdomains_used` = 0,
-		`traffic` = -1048576,
-		`traffic_used` = 0,
-		`deactivated` = 0,
-		`aps_packages` = -1");
-	status_message('green', 'OK');
-
-	//now we create the userdata.inc.php with the mysql-accounts
-
-	status_message('begin', $lng['install']['creating_configfile']);
-	$userdata = "<?php\n";
-	$userdata.= "//automatically generated userdata.inc.php for Froxlor\n";
-	$userdata.= "\$sql['host']='" . addcslashes($mysql_host, "'\\") . "';\n";
-	$userdata.= "\$sql['user']='" . addcslashes($mysql_unpriv_user, "'\\") . "';\n";
-	$userdata.= "\$sql['password']='" . addcslashes($mysql_unpriv_pass, "'\\") . "';\n";
-	$userdata.= "\$sql['db']='" . addcslashes($mysql_database, "'\\") . "';\n";
-	$userdata.= "\$sql_root[0]['caption']='Default';\n";
-	$userdata.= "\$sql_root[0]['host']='" . addcslashes($mysql_host, "'\\") . "';\n";
-	$userdata.= "\$sql_root[0]['user']='" . addcslashes($mysql_root_user, "'\\") . "';\n";
-	$userdata.= "\$sql_root[0]['password']='" . addcslashes($mysql_root_pass, "'\\") . "';\n";
-	$userdata.= "?>";
-
-	//we test now if we can store the userdata.inc.php in ../lib
-
-	if($fp = @fopen('../lib/userdata.inc.php', 'w'))
-	{
-		$result = @fputs($fp, $userdata, strlen($userdata));
-		@fclose($fp);
-		status_message('green', $lng['install']['creating_configfile_succ']);
-		chmod('../lib/userdata.inc.php', 0440);
-	}
-	elseif($fp = @fopen('/tmp/userdata.inc.php', 'w'))
-	{
-		$result = @fputs($fp, $userdata, strlen($userdata));
-		@fclose($fp);
-		status_message('orange', $lng['install']['creating_configfile_temp']);
-		chmod('/tmp/userdata.inc.php', 0440);
-	}
-	else
-	{
-		status_message('red', $lng['install']['creating_configfile_failed']);
-		echo "\t\t<tr>\n\t\t\t<td class=\"main_field_name\"><p>" . nl2br(htmlspecialchars($userdata)) . "</p></td>\n\t\t</tr>\n";
-	}
-
-?>
-		<tr>
-			<td class="main_field_display" align="center">
-				<?php echo $lng['install']['froxlor_succ_installed']; ?><br />
-				<a href="../index.php"><?php echo $lng['install']['click_here_to_login']; ?></a>
-			</td>
-		</tr>
-	</table>
-	<br />
-	<br />
-<?php
-	page_footer();
-}
-else
-{
-	page_header();
-
-?>
-	<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="get">
-		<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
-			<tr>
-				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['welcome']; ?></b></td>
-			</tr>
-			<tr>
-				<td class="main_field_name" colspan="2"><?php echo $lng['install']['welcometext']; ?></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"><?php echo $lng['install']['language']; ?>: </td>
-				<td class="main_field_display" nowrap="nowrap">
-					<select name="language" class="dropdown_noborder"><?php
-	$language_options = '';
-
-	while(list($language_file, $language_name) = each($languages))
-	{
-		$language_options.= "\n\t\t\t\t\t\t" . makeoption($language_name, $language_file, $language, true, true);
-	}
-
-	echo $language_options;
-
-?>
-
-					</select>
-				</td>
-			</tr>
-			<tr>
-				<td class="main_field_confirm" colspan="2">
-					<input class="bottom" type="submit" name="chooselang" value="Go" />
-				</td>
-			</tr>
-		</table>
-	</form>
-	<br />
-	<form action="<?php echo htmlspecialchars($_SERVER['PHP_SELF']) ?>" method="post">
-		<table cellpadding="5" cellspacing="4" border="0" align="center" class="maintable_40">
-			<tr>
-				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['database']; ?></b></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"><?php echo $lng['install']['mysql_hostname']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="mysql_host" value="<?php echo htmlspecialchars($mysql_host); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"><?php echo $lng['install']['mysql_database']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="mysql_database" value="<?php echo htmlspecialchars($mysql_database); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_user']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="mysql_unpriv_user" value="<?php echo htmlspecialchars($mysql_unpriv_user); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_unpriv_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_unpriv_pass']; ?>:</td>
-				<td class="main_field_display"><input type="password" name="mysql_unpriv_pass" value="<?php echo htmlspecialchars($mysql_unpriv_pass); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo (($mysql_unpriv_user == $mysql_root_user) ? ' style="color:blue;"' : ''); ?>><?php echo $lng['install']['mysql_root_user']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="mysql_root_user" value="<?php echo htmlspecialchars($mysql_root_user); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $mysql_root_pass == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['mysql_root_pass']; ?>:</td>
-				<td class="main_field_display"><input type="password" name="mysql_root_pass" value="<?php echo htmlspecialchars($mysql_root_pass); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['admin_account']; ?></b></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"><?php echo $lng['install']['admin_user']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="admin_user" value="<?php echo htmlspecialchars($admin_user); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass1 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass']; ?>:</td>
-				<td class="main_field_display"><input type="password" name="admin_pass1" value="<?php echo htmlspecialchars($admin_pass1); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && ($admin_pass2 == '' || $admin_pass1 != $admin_pass2)) ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['admin_pass_confirm']; ?>:</td>
-				<td class="main_field_display"><input type="password" name="admin_pass2" value="<?php echo htmlspecialchars($admin_pass2); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="maintitle" colspan="2"><b><img src="../images/title.gif" alt="" />&nbsp;<?php echo $lng['install']['serversettings']; ?></b></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $servername == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['servername']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="servername" value="<?php echo htmlspecialchars($servername); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['serverip']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="serverip" value="<?php echo htmlspecialchars($serverip); ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $webserver == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['webserver']; ?>:</td>
-				<td class="main_field_display"><input type="radio" name="webserver" value="apache2" <?php echo $webserver == "apache2" ? 'checked="checked"' : "" ?>/>Apache2&nbsp;<br /><input type="radio" name="webserver" value="lighttpd" <?php echo $webserver == "lighttpd" ? 'checked="checked"' : "" ?>/>Lighttpd</td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpuser']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="httpuser" value="<?php $posixusername = posix_getpwuid(posix_getuid()); echo $posixusername['name']; ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_name"<?php echo ((!empty($_POST['installstep']) && $serverip == '') ? ' style="color:red;"' : ''); ?>><?php echo $lng['install']['httpgroup']; ?>:</td>
-				<td class="main_field_display"><input type="text" name="httpgroup" value="<?php $posixgroup = posix_getgrgid(posix_getgid()); echo $posixgroup['name']; ?>"/></td>
-			</tr>
-			<tr>
-				<td class="main_field_confirm" colspan="2"><input type="hidden" name="language" value="<?php echo htmlspecialchars($language); ?>"/><input type="hidden" name="installstep" value="1"/><input class="bottom" type="submit" name="submitbutton" value="<?php echo $lng['install']['next']; ?>"/></td>
-			</tr>
-		</table>
-	</form>
-	<br />
-	<br />
-<?php
-	page_footer();
-}
-
-/**
- * END INSTALL ---------------------------------------------------
- */
-
-?>
+$frxinstall = new FroxlorInstall();
+$frxinstall->run();
--- a/install/lib/class.FroxlorInstall.php
+++ b/install/lib/class.FroxlorInstall.php
--- a/install/lng/english.lng.php
+++ b/install/lng/english.lng.php
@@ -14,74 +14,71 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Language
- * @version    $Id$
+ *
 */

-/**
- * Begin
- */
+$lng['requirements']['title'] = 'Checking system requirements...';
+$lng['requirements']['installed'] = 'installed';
+$lng['requirements']['not_true'] = 'no';
+$lng['requirements']['notfound'] = 'not found';
+$lng['requirements']['notinstalled'] = 'not installed';
+$lng['requirements']['activated'] = 'enabled';
+$lng['requirements']['phpversion'] = 'PHP version >= 5.2';
+$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime...';
+$lng['requirements']['phpmagic_quotes_runtime_description'] = 'PHP setting "magic_quotes_runtime" must be set to "Off". We have disabled it temporary for now please fix the coresponding php.ini.';
+$lng['requirements']['phpmysql'] = 'MySQL-extension...';
+$lng['requirements']['phpxml'] = 'PHP XML-extension...';
+$lng['requirements']['phpfilter'] = 'PHP filter-extension...';
+$lng['requirements']['phpposix'] = 'PHP posix-extension...';
+$lng['requirements']['phpbcmath'] = 'PHP bcmath-extension...';
+$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
+$lng['requirements']['openbasedir'] = 'open_basedir...';
+$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the coresponding php.ini';
+$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';
+$lng['requirements']['froxlor_succ_checks'] = 'All requirements are satisfied';

-$lng['install']['language'] = 'Installation - Language';
-$lng['install']['welcome'] = 'Welcome to Froxlor Installation';
+$lng['install']['title'] = 'Froxlor install - chose language';
+$lng['install']['language'] = 'Installation language';
+$lng['install']['lngbtn_go'] = 'Change language';
+$lng['install']['title'] = 'Froxlor install - setup';
 $lng['install']['welcometext'] = 'Thank you for choosing Froxlor. Please fill out the following fields with the required information to start the installation.<br /><b>Attention:</b> If the database you chose for Froxlor already exists on your System, it will be erased with all containing data!';
-$lng['install']['database'] = 'Database';
-$lng['install']['mysql_hostname'] = 'MySQL-Hostname';
-$lng['install']['mysql_database'] = 'MySQL-Database';
+$lng['install']['database'] = 'Database connection';
+$lng['install']['mysql_host'] = 'MySQL-Hostname';
+$lng['install']['mysql_database'] = 'Database name';
 $lng['install']['mysql_unpriv_user'] = 'Username for the unprivileged MySQL-account';
 $lng['install']['mysql_unpriv_pass'] = 'Password for the unprivileged MySQL-account';
 $lng['install']['mysql_root_user'] = 'Username for the MySQL-root-account';
 $lng['install']['mysql_root_pass'] = 'Password for the MySQL-root-account';
 $lng['install']['admin_account'] = 'Administrator Account';
 $lng['install']['admin_user'] = 'Administrator Username';
-$lng['install']['admin_pass'] = 'Administrator Password';
-$lng['install']['admin_pass_confirm'] = 'Administrator-Password (confirm)';
+$lng['install']['admin_pass1'] = 'Administrator Password';
+$lng['install']['admin_pass2'] = 'Administrator-Password (confirm)';
 $lng['install']['serversettings'] = 'Server settings';
-$lng['install']['servername'] = 'Server name (FQDN)';
+$lng['install']['servername'] = 'Server name (FQDN, no ip-address)';
 $lng['install']['serverip'] = 'Server IP';
+$lng['install']['webserver'] = 'Webserver';
+$lng['install']['apache2'] = 'Apache 2';
+$lng['install']['lighttpd'] = 'LigHTTPd';
+$lng['install']['nginx'] = 'NGINX';
 $lng['install']['httpuser'] = 'HTTP username';
 $lng['install']['httpgroup'] = 'HTTP groupname';
-$lng['install']['apacheversion'] = 'Apacheversion';
-$lng['install']['next'] = 'Next';

-/**
- * Progress
- */
-
-$lng['install']['testing_mysql'] = 'Testing if MySQL-root-username and password are correct...';
-$lng['install']['erasing_old_db'] = 'Erasing old Database...';
-$lng['install']['backup_old_db'] = 'Create backup of the old Database...';
-$lng['install']['backing_up'] = 'Backing up';
-$lng['install']['backing_up_binary_missing'] = '/usr/bin/mysqldump is missing';
-$lng['install']['create_mysqluser_and_db'] = 'Creating MySQL-database and username...';
-$lng['install']['testing_new_db'] = 'Testing if MySQL-database and username have been created correctly...';
-$lng['install']['importing_data'] = 'Importing data into MySQL-database...';
-$lng['install']['changing_data'] = 'Changing imported data...';
-$lng['install']['adding_admin_user'] = 'Adding Administrator Account...';
+$lng['install']['testing_mysql'] = 'Checking MySQL-root access...';
+$lng['install']['backup_old_db'] = 'Creating backup of old database...';
+$lng['install']['backup_binary_missing'] = 'Could not find mysqldump';
+$lng['install']['backup_failed'] = 'Could not backup database';
+$lng['install']['prepare_db'] = 'Preparing database...';
+$lng['install']['create_mysqluser_and_db'] = 'Creating database and username...';
+$lng['install']['testing_new_db'] = 'Testing if database and user have been created correctly...';
+$lng['install']['importing_data'] = 'Importing data...';
+$lng['install']['changing_data'] = 'Adjusting settings...';
+$lng['install']['creating_entries'] = 'Inserting new values...';
+$lng['install']['adding_admin_user'] = 'Creating admin-account...';
 $lng['install']['creating_configfile'] = 'Creating configfile...';
-$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php was saved in lib/.';
 $lng['install']['creating_configfile_temp'] = 'File was saved in /tmp/userdata.inc.php, please move to lib/.';
-$lng['install']['creating_configfile_failed'] = 'Cannot create lib/userdata.inc.php, please create it manually with the following data:';
+$lng['install']['creating_configfile_failed'] = 'Could not create lib/userdata.inc.php, please create it manually with the following content:';
 $lng['install']['froxlor_succ_installed'] = 'Froxlor was installed successfully.';
-$lng['install']['click_here_to_login'] = 'Click here to login.';
-$lng['install']['phpmysql'] = 'Testing if PHP MySQL-extension is installed...';
-$lng['install']['phpfilter'] = 'Testing if PHP filter-extension is installed...';
-$lng['install']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Aborting...';
-$lng['install']['notinstalled'] = 'not installed!';
-$lng['install']['phpbcmath'] = 'Testing if PHP bcmath-extension is installed...';
-$lng['install']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
-$lng['install']['openbasedir'] = 'Testing if open_basedir is enabled...';
-$lng['install']['openbasedirenabled'] = 'enabled. Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor';

-/**
- * Renamed in 1.2.19-svn40
- */
-
-$lng['install']['webserver'] = 'Webserver';
-
-/*
- * Added in Froxlor 0.9
- */
-$lng['install']['phpversion'] = 'Checking for PHP version >= 5.2';
-$lng['install']['phpposix'] = 'Testing if PHP posix-extension is installed...';
-
-?>
+$lng['click_here_to_refresh'] = 'Click here to check again';
+$lng['click_here_to_continue'] = 'Click here to continue';
+$lng['click_here_to_login'] = 'Click here to login.';
--- a/install/lng/french.lng.php
+++ b/install/lng/french.lng.php
@@ -1,71 +0,0 @@
-<?php
-
-/**
- * This file is part of the Froxlor project.
- * Copyright (c) 2003-2009 the SysCP Team (see authors).
- * Copyright (c) 2010 the Froxlor Team (see authors).
- *
- * For the full copyright and license information, please view the COPYING
- * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
- *
- * @copyright  (c) the authors
- * @author     Tim Zielosko <mail@zielosko.net>
- * @author     Romain MARIADASSOU <roms2000@free.fr>
- * @author     Froxlor Team <team@froxlor.org>
- * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
- * @package    Language
- * @version    $Id$
- */
-
-/**
- * Begin
- */
-
-$lng['install']['language'] = 'Langue d\'installation';
-$lng['install']['welcome'] = 'Bienvenue <20> l\'installation de Froxlor';
-$lng['install']['welcometext'] = 'Merci beaucoup d\'avoir choisi Froxlor. Pour installer Froxlor remplissez les cases ci-dessous avec les informations demand<6E>es.<br /><b>Attention :</b> Si vous entrez le nom d\'une base de donn<6E>es existante, celle-ci sera effac<61>e !';
-$lng['install']['database'] = 'Base de donn<6E>es';
-$lng['install']['mysql_hostname'] = 'Nom d\'h<>te du serveur MySQL';
-$lng['install']['mysql_database'] = 'Base de donn<6E>es MySQL';
-$lng['install']['mysql_unpriv_user'] = 'Utilisateur pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
-$lng['install']['mysql_unpriv_pass'] = 'Mot de passe pour l\'acc<63>s non privil<69>gi<67> <20> MySQL';
-$lng['install']['mysql_root_user'] = 'Utilisateur pour l\'acc<63>s root <20> MySQL';
-$lng['install']['mysql_root_pass'] = 'Mot de passe pour l\'acc<63>s root <20> MySQL';
-$lng['install']['admin_account'] = 'Acc<63>s administratif';
-$lng['install']['admin_user'] = 'Login de l\'administrateur';
-$lng['install']['admin_pass'] = 'Mot de passe de l\'administrateur';
-$lng['install']['admin_pass_confirm'] = 'Mot de passe de l\'administrateur (confirmation)';
-$lng['install']['serversettings'] = 'Configuration du serveur';
-$lng['install']['servername'] = 'Nom du serveur (FQDN)';
-$lng['install']['serverip'] = 'Adresse IP du serveur';
-$lng['install']['apacheversion'] = 'Version du serveur Apache';
-$lng['install']['next'] = 'Continuer';
-
-/**
- * Progress
- */
-
-$lng['install']['testing_mysql'] = 'V<>rification du login root de MySQL ...';
-$lng['install']['erasing_old_db'] = 'Effacement de l\'ancienne base de donn<6E>es ...';
-$lng['install']['create_mysqluser_and_db'] = 'Cr<43>ation de la base de donn<6E>es puis des utilisateurs ...';
-$lng['install']['testing_new_db'] = 'V<>rification de la base de donn<6E>es et des utilisateurs ...';
-$lng['install']['importing_data'] = 'Importation des informations dans la base de donn<6E>es ...';
-$lng['install']['changing_data'] = 'Modification des donn<6E>es import<72>s ...';
-$lng['install']['adding_admin_user'] = 'Ajout de l\'utilisateur administrateur ...';
-$lng['install']['creating_configfile'] = 'Cr<43>ation du fichier de configuration ...';
-$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php a <20>t<EFBFBD> sauvegard<72> dans le dossier lib/ de Froxlor.';
-$lng['install']['creating_configfile_temp'] = 'Le fichier a <20>t<EFBFBD> sauvegard<72> dans /tmp/userdata.inc.php, veuillez le d<>placer / copier dans le dossier lib/ de Froxlor.';
-$lng['install']['creating_configfile_failed'] = 'Erreur en cr<63>ant le fichier lib/userdata.inc.php, veuillez le cr<63>er avec le contenu ci-dessous :';
-$lng['install']['froxlor_succ_installed'] = 'Froxlor a <20>t<EFBFBD> install<6C> correctement.';
-$lng['install']['click_here_to_login'] = 'Cliquez ici pour vous rendre <20> l\'invite de connexion.';
-$lng['install']['httpuser'] = 'Nom du utilisateur du HTTP';
-$lng['install']['httpgroup'] = 'Nom du la group du HTTP';
-
-/**
- * Renamed in 1.2.19-svn40
- */
-
-$lng['install']['webserver'] = 'Version du serveur';
-
-?>
--- a/install/lng/german.lng.php
+++ b/install/lng/german.lng.php
@@ -2,86 +2,83 @@

 /**
 * This file is part of the Froxlor project.
- * Copyright (c) 2003-2007 the SysCP Team (see authors).
+ * Copyright (c) 2003-2009 the SysCP Team (see authors).
 * Copyright (c) 2010 the Froxlor Team (see authors).
 *
 * For the full copyright and license information, please view the COPYING
 * file that was distributed with this source code. You can also view the
- * COPYING file online at http://files.syscp.org/misc/COPYING.txt
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
 *
 * @copyright  (c) the authors
- * @author     Florian Lippert <flo@syscp.org> (2003-2007)
- * @author     Froxlor Team <team@froxlor.org> (2010-)
+ * @author     Florian Lippert <flo@syscp.org> (2003-2009)
+ * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Language
- * @version    $Id$
+ *
 */

-/**
- * Begin
- */
+$lng['requirements']['title'] = 'Prüfe Systemvoraussetzungen...';
+$lng['requirements']['installed'] = 'installiert';
+$lng['requirements']['not_true'] = 'nein';
+$lng['requirements']['notfound'] = 'nicht gefunden';
+$lng['requirements']['notinstalled'] = 'nicht installiert';
+$lng['requirements']['activated'] = 'ist aktiviert.';
+$lng['requirements']['phpversion'] = 'PHP Version >= 5.2';
+$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime';
+$lng['requirements']['phpmagic_quotes_runtime_description'] = 'Die PHP Einstellung "magic_quotes_runtime" muss deaktiviert sein ("Off"). Die Einstellung wurde temporär deaktiviert, bitte ändern Sie diese in der entsprechenden php.ini.';
+$lng['requirements']['phpmysql'] = 'PHP MySQL-Erweiterung...';
+$lng['requirements']['phpxml'] = 'PHP XML-Erweiterung...';
+$lng['requirements']['phpfilter'] = 'PHP filter-Erweiterung...';
+$lng['requirements']['phpposix'] = 'PHP posix-Erweiterung...';
+$lng['requirements']['phpbcmath'] = 'PHP bcmath-Erweiterung...';
+$lng['requirements']['bcmathdescription'] = 'Traffic-Berechnungs bezogene Funktionen stehen nicht vollständig zur Verfügung!';
+$lng['requirements']['openbasedir'] = 'open_basedir genutzt wird...';
+$lng['requirements']['openbasedirenabled'] = 'Froxlor wird mit aktiviertem open_basedir nicht vollständig funktionieren. Bitte deaktivieren Sie open_basedir für Froxlor in der entsprechenden php.ini';
+$lng['requirements']['diedbecauseofrequirements'] = 'Kann Froxlor ohne diese Voraussetzungen nicht installieren! Versuchen Sie die angezeigten Problem zu beheben und versuchen Sie es erneut.';
+$lng['requirements']['froxlor_succ_checks'] = 'Alle Vorraussetzungen sind erfüllt';

-$lng['install']['language'] = 'Installations - Sprache';
-$lng['install']['welcome'] = 'Willkommen zur Froxlor Installation';
-$lng['install']['welcometext'] = 'Vielen Dank dass Sie sich f&uuml;r Froxlor entschieden haben. Um Ihre Installation von Froxlor zu starten, f&uuml;llen Sie bitte alle Felder unten mit den geforderten Angaben.<br /><b>Achtung:</b> Eine eventuell bereits existierende Datenbank, die den selben Namen hat wie den, den Sie unten eingeben werden, wird mit allen enthaltenen Daten gel&ouml;scht!';
-$lng['install']['database'] = 'Datenbank';
-$lng['install']['mysql_hostname'] = 'MySQL-Hostname';
-$lng['install']['mysql_database'] = 'MySQL-Datenbank';
-$lng['install']['mysql_unpriv_user'] = 'Benutzername f&uuml;r den unprivilegierten MySQL-Account';
-$lng['install']['mysql_unpriv_pass'] = 'Passwort f&uuml;r den unprivilegierten MySQL-Account';
-$lng['install']['mysql_root_user'] = 'Benutzername f&uuml;r den MySQL-Root-Account';
-$lng['install']['mysql_root_pass'] = 'Passwort f&uuml;r den MySQL-Root-Account';
+$lng['install']['lngtitle'] = 'Froxlor Installation - Sprache auswählen';
+$lng['install']['language'] = 'Sprache für die Installation';
+$lng['install']['lngbtn_go'] = 'Sprache ändern';
+$lng['install']['title'] = 'Froxlor Installation - Einrichtung';
+$lng['install']['welcometext'] = 'Vielen Dank dass Sie sich für Froxlor entschieden haben. Um die Installation von Froxlor zu starten, füllen Sie bitte alle Felder mit den geforderten Angaben aus.<br /><b>Achtung:</b> Eine eventuell existierende Datenbank, die den selben Namen hat wie den Gewählten, wird mit allen enthaltenen Daten gelöscht!';
+$lng['install']['database'] = 'Datenbankverbindung';
+$lng['install']['mysql_host'] = 'MySQL-Hostname';
+$lng['install']['mysql_database'] = 'Datenbank Name';
+$lng['install']['mysql_unpriv_user'] = 'Benutzername für den unprivilegierten MySQL-Account';
+$lng['install']['mysql_unpriv_pass'] = 'Passwort für den unprivilegierten MySQL-Account';
+$lng['install']['mysql_root_user'] = 'Benutzername für den MySQL-Root-Account';
+$lng['install']['mysql_root_pass'] = 'Passwort für den MySQL-Root-Account';
 $lng['install']['admin_account'] = 'Admin-Zugang';
 $lng['install']['admin_user'] = 'Administrator-Benutzername';
-$lng['install']['admin_pass'] = 'Administrator-Passwort';
-$lng['install']['admin_pass_confirm'] = 'Administrator-Passwort (Best&auml;tigung)';
+$lng['install']['admin_pass1'] = 'Administrator-Passwort';
+$lng['install']['admin_pass2'] = 'Administrator-Passwort (Bestätigung)';
 $lng['install']['serversettings'] = 'Servereinstellungen';
-$lng['install']['servername'] = 'Servername (FQDN)';
+$lng['install']['servername'] = 'Servername (FQDN, keine IP-Adresse)';
 $lng['install']['serverip'] = 'Server-IP';
-$lng['install']['apacheversion'] = 'Apacheversion';
-$lng['install']['next'] = 'Fortfahren';
-
-/**
- * Progress
- */
-
-$lng['install']['testing_mysql'] = 'Teste, ob die MySQL-Root-Benutzerdaten richtig sind...';
-$lng['install']['erasing_old_db'] = 'Entferne alte Datenbank...';
-$lng['install']['backup_old_db'] = 'Sichere bisherige Datenbank...';
-$lng['install']['backing_up'] = 'Sicherung l&auml;ft';
-$lng['install']['backing_up_binary_missing'] = '/usr/bin/mysqldump nicht vorhanden';
-$lng['install']['create_mysqluser_and_db'] = 'Erstelle Datenbank und Benutzer...';
-$lng['install']['testing_new_db'] = 'Teste, ob die Datenbank und Passwort korrekt angelegt wurden...';
-$lng['install']['importing_data'] = 'Importiere Daten in die MySQL-Datenbank...';
-$lng['install']['changing_data'] = 'Passe die importierten Daten an...';
-$lng['install']['adding_admin_user'] = 'F&uuml;ge den Admin-Benutzer hinzu...';
-$lng['install']['creating_configfile'] = 'Erstelle Konfigurationsdatei...';
-$lng['install']['creating_configfile_succ'] = 'OK, userdata.inc.php wurde in lib/ gespeichert.';
-$lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach lib/ verschieben.';
-$lng['install']['creating_configfile_failed'] = 'Konnte lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:';
-$lng['install']['froxlor_succ_installed'] = 'Froxlor wurde erfolgreich installiert.';
-$lng['install']['click_here_to_login'] = 'Hier geht es weiter zum Login-Fenster.';
-$lng['install']['phpmysql'] = 'Teste, ob die PHP MySQL-Erweiterung installiert ist...';
-$lng['install']['phpfilter'] = 'Teste, ob die PHP Filter-Erweiterung installiert ist...';
-$lng['install']['diedbecauseofrequirements'] = 'Kann Froxlor ohne diese Voraussetzungen nicht installieren! Breche ab...';
-$lng['install']['notinstalled'] = 'nicht installiert!';
-$lng['install']['phpbcmath'] = 'Teste, ob die PHP bcmath-Erweiterung installiert ist...';
-$lng['install']['bcmathdescription'] = 'Traffic-Berechnungs bezogene Funktionen stehen nicht vollst&auml;ndig zur Verf&uuml;gung!';
-$lng['install']['openbasedir'] = 'Teste, ob open_basedir genutzt wird...';
-$lng['install']['openbasedirenabled'] = 'aktiviert. Froxlor wird mit aktiviertem open_basedir nicht vollst&auml;ndig funktionieren. Bitte deaktivieren Sie open_basedir f&uuml;r Froxlor';
+$lng['install']['webserver'] = 'Webserver';
+$lng['install']['apache2'] = 'Apache 2';
+$lng['install']['lighttpd'] = 'LigHTTPd';
+$lng['install']['nginx'] = 'NGINX';
 $lng['install']['httpuser'] = 'HTTP Username';
 $lng['install']['httpgroup'] = 'HTTP Gruppenname';

-/**
- * Renamed in 1.2.19-svn40
- */
+$lng['install']['testing_mysql'] = 'Teste MySQL-Root Zugang...';
+$lng['install']['backup_old_db'] = 'Sicherung vorheriger Datenbank...';
+$lng['install']['backup_binary_missing'] = 'Konnte mysqldump nicht finden';
+$lng['install']['backup_failed'] = 'Sicherung fehlgeschlagen';
+$lng['install']['prepare_db'] = 'Datenbank wird vorbereitet...';
+$lng['install']['create_mysqluser_and_db'] = 'Erstelle Datenbank und Benutzer...';
+$lng['install']['testing_new_db'] = 'Teste, ob Datenbank und Benutzer korrekt angelegt wurden...';
+$lng['install']['importing_data'] = 'Importiere Daten...';
+$lng['install']['changing_data'] = 'Einstellungen anpassen...';
+$lng['install']['creating_entries'] = 'Trage neue Werte ein...';
+$lng['install']['adding_admin_user'] = 'Erstelle Admin-Benutzer...';
+$lng['install']['creating_configfile'] = 'Erstelle Konfigurationsdatei...';
+$lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach lib/ verschieben.';
+$lng['install']['creating_configfile_failed'] = 'Konnte lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:';
+$lng['install']['froxlor_succ_installed'] = 'Froxlor wurde erfolgreich installiert.';

-$lng['install']['webserver'] = 'Webserver';
-
-/*
- * Added in Froxlor 0.9
- */
-$lng['install']['phpversion'] = 'Pr&uuml;fe PHP Version >= 5.2';
-$lng['install']['phpposix'] = 'Teste, ob die PHP Posix-Erweiterung installiert ist...';
-
-?>
+$lng['click_here_to_refresh'] = 'Hier klicken, um erneut zu prüfen';
+$lng['click_here_to_continue'] = 'Installation fortführen';
+$lng['click_here_to_login'] = 'Hier geht es weiter zum Login-Fenster.';
--- a/install/scripts/htpasswd-htaccess-remover.php
+++ b/install/scripts/htpasswd-htaccess-remover.php
@@ -12,7 +12,7 @@
 * @author     Michael Duergner <michael@duergner.com>
 * @license    GPLv2 http://files.syscp.org/misc/COPYING.txt
 * @package    System
- * @version    $Id$
+ *
 */

 if(@php_sapi_name() != 'cli'
--- a/install/scripts/language-check.php
+++ b/install/scripts/language-check.php
@@ -12,7 +12,7 @@
 * @author     Martin Burchert <eremit@syscp.org>
 * @license    GPLv2 http://files.syscp.org/misc/COPYING.txt
 * @package    System
- * @version    $Id$
+ *
 */

 // some configs
@@ -21,9 +21,7 @@ $baseLanguage = 'english.lng.php';

 // Check if we're in the CLI

-if(@php_sapi_name() != 'cli'
-   && @php_sapi_name() != 'cgi'
-   && @php_sapi_name() != 'cgi-fcgi')
+if(@php_sapi_name() != 'cli')
 {
 	die('This script will only work in the shell.');
 }
@@ -183,4 +181,4 @@ function compare($array1, $array2)
 	return $result;
 }

-?>
+?>
--- a/install/templates/assets/css/install.css
+++ b/install/templates/assets/css/install.css
@@ -0,0 +1,531 @@
+@charset "UTF-8";
+
+/* RESET */
+html,body,div,ul,ol,li,dl,dt,dd,h1,h2,h3,h4,h5,h6,pre,form,p,blockquote,fieldset,input { margin:0; padding:0; }
+h1,h2,h3,h4,h5,h6,pre,code,address,caption,cite,code,em,strong,th { font-size:1em; font-weight:400; font-style:normal; }
+ul,ol { list-style:none; }
+fieldset,img { border:none; }
+caption,th { text-align:left; }
+table { border-collapse:collapse; border-spacing:0; }
+article,aside,details,figcaption,figure,footer,header,hgroup,menu,nav,section { display:block; }
+
+/* TYPE */
+html,body {
+	font:12px/18px Helvetica,Arial,Verdana,sans-serif;
+	background-color:#f2f2f2;
+	color:#333;
+	-webkit-font-smoothing: antialiased;
+}
+
+body {
+	margin:0;
+	padding:0;
+}
+
+.dark {
+	background-color: #e9edf0;
+	border-bottom:1px solid #d1d5d8;
+}
+
+header img {
+	padding:10px 0 10px 10px;
+}
+
+h1 {
+	display:none;
+}
+
+h2, h3 {
+	margin: 0 0 1em 0;
+	padding: 0;
+	font-weight: bold;
+}
+
+h2 {
+	font-size:17px;
+}
+
+h3 {
+	font-size: 15px;
+}
+
+
+img {
+	border:0;
+	vertical-align:middle;
+}
+
+td a {
+	text-decoration:none;
+}
+
+.bradius {
+	border-radius: 5px 5px 5px 5px;
+	box-shadow: rgba(0, 0, 0, 0.34902) 0px 1px 3px 0px;
+}
+
+/* FOOTER */
+footer {
+	clear:both;
+	text-align:center;
+	color: #888;
+	font-size:10px !important;
+	margin: 10px 0;
+}
+
+footer a,footer a:active,footer a:visited {
+	color: #888;
+}
+
+.install {
+	background-color:#fff;
+	margin: 20px;
+	margin-left: auto;
+	margin-right: auto;
+	margin-bottom: 12px;
+	width: 800px;
+}
+
+p {
+	margin: 0 10px !important;
+}
+
+.installsec {
+	margin-top:10px;
+	padding:0;
+	text-align:left;
+}
+
+.installsec table {
+	width:100%;
+	padding:0 10px;
+	margin: 15px 0 15px 0;
+}
+
+.installsec h2 {
+	display: block;
+	border-bottom: 1px solid #d1d5d8;
+	margin: 0;
+	padding: 5px 15px 15px 15px;
+}
+
+.installsec form {
+	width:800px;
+	margin:0 auto;
+	padding:10px 0 0;
+	text-align:left;
+}
+
+.installsec fieldset {
+	border:0;
+	float:left;
+	clear:left;
+	width:600px;
+	margin:0 100px 10px;
+	padding:0;
+}
+
+.installsec legend {
+	display:none;
+}
+
+.installsec label {
+	float:left;
+	width:26em;
+	margin-right:1em;
+	margin-top:6px;
+	text-align:left;
+}
+
+p.submit {
+	text-align:right;
+	padding-right:46px;
+}
+
+.installsec aside {
+	border-top:1px solid #d1d5d8;
+	clear:both;
+	float:none;
+	width:auto;
+	text-align: right;
+	padding: 10px;
+}
+
+.line {
+	border: 0;
+	width: 800px;
+	border-bottom:1px solid #d1d5d8;
+}
+
+.messagewrapper {
+	width:650px;
+	margin:0 auto;
+	padding:120px 0 0;
+	overflow:hidden;
+}
+
+.messagewrapperfull {
+	width:100%;
+	margin:0 auto;
+	padding:0;
+	overflow:hidden;
+}
+
+.overviewsearch {
+	position:absolute;
+	top:155px;
+	right:36px;
+	font-size:80%;
+}
+
+.overviewadd {
+	padding:10px;
+	font-weight:700;
+}
+
+/*
+ * error message display
+ */
+.errorcontainer {
+	background:url(../img/icons/error_big.png) 10px center no-repeat #ffedef;
+	border:1px solid #ffc2ca;
+	padding:10px 10px 10px 68px!important;
+	margin: 10px 0 10px 0 !important;
+	text-align:left!important;
+	overflow:hidden;
+	box-shadow: 0px 0px 0px black;
+}
+
+.errortitle {
+	font-weight:700;
+	color:#c00!important;
+}
+
+.error {
+	font-weight:400!important;
+	color:#c00!important;
+}
+
+/*
+ * warning message display
+ */
+.warningcontainer,.ui-dialog {
+	background:url(../img/icons/warning_big.png) 10px center no-repeat #fffecc;
+	border:1px solid #f3c37e;
+	padding:10px 10px 10px 68px !important;
+	margin: 10px 0 10px 0 !important;
+	text-align:left!important;
+	overflow:hidden;
+	box-shadow: 0px 0px 0px black;
+}
+.ui-dialog {
+	padding: 10px !important;
+}
+
+.warningtitle,.ui-dialog-titlebar {
+	font-weight:700;
+	color:#D57D00;
+}
+
+.warning,.ui-dialog-content {
+	color:#D57D00!important;
+}
+
+/*
+ * success message display
+ */
+.successcontainer {
+	background:url(../img/icons/ok_big.png) 10px center no-repeat #E2F9E3;
+	border:1px solid #9C9;
+	padding:10px 10px 10px 68px!important;
+	margin: 10px 0 10px 0 !important;
+	text-align:left!important;
+	overflow:hidden;
+	box-shadow: 0px 0px 0px black;
+}
+
+.successtitle {
+	font-weight:700;
+	color:#060!important;
+}
+
+.success {
+	font-weight:400!important;
+}
+
+/*
+ * neutral/info message display
+ */
+.neutralcontainer {
+	background:url(../img/icons/info_big.png) 10px center no-repeat #d2eaf6;
+	border:1px solid #b7d8ed;
+	padding:10px 10px 10px 68px!important;
+	margin: 10px 0 10px 0 !important;
+	text-align:left!important;
+	overflow:hidden;
+	box-shadow: 0px 0px 0px black;
+}
+
+.neutraltitle {
+	font-weight:700;
+	color:#3188c1!important;
+}
+
+.neutral {
+	font-weight:400!important;
+	color:#3188c1!important;
+}
+
+/* std hyperlink */
+a,a:active,a:visited {
+	color:#176fa1;
+	text-decoration:none;
+}
+
+a:hover {
+	text-decoration:underline;
+}
+
+.infotext {
+	font-size:11px;
+}
+
+/*
+ * main container
+ */
+.main {
+	margin-left:240px;
+	margin-right:10px;
+	margin-top:105px;
+	margin-bottom:0;
+	background-color:#fff;
+	padding: 30px 30px 30px 30px;
+	min-height:400px;
+}
+
+.noborder {
+	width:100%;
+	border-spacing:0;
+	border-collapse:separate;
+	border: 0;
+}
+
+.noborder td {
+	border:0;
+}
+
+table {
+	width:100%;
+	border-spacing:0;
+	border:1px solid #d1d5d8;
+	border-collapse:separate;
+	box-shadow:0px 0px 0px black !important;
+}
+
+table thead th, table th {
+	border-top: 1px solid #d1d5d8;
+	border-bottom: 1px solid #d1d5d8;
+	height: 25px !important;
+	padding: 5px 0px 5px 8px;
+	background-color: #e9edf0;
+	font-weight: bold;
+}
+table thead:first-child th, table:first-child th {
+	border-top: none !important;
+}
+
+table th {
+	border-top: 0;
+}
+th a:hover {
+	text-decoration: none;
+}
+th a img {
+}
+th a:nth-child(odd) img {
+	position: relative;
+	top: -5px;
+	left: 4px;
+}
+th a:nth-child(even) img {
+	position: relative;
+	top: 3px;
+	left: -7px;
+}
+
+table thead:first-child th {
+	border-top: 0;
+}
+
+.disabled td, .disabled td a {
+	color: #cfcfcf;
+}
+
+table tbody td {
+	border-bottom:1px dotted #ccc;
+}
+table tbody tr:last-child td {
+	border-bottom: 0;
+}
+
+.formtable {
+	width: 100%;
+	border-spacing:0;
+	border:0;
+	border-collapse:separate;
+	margin:0 0 0;
+}
+
+.formtable tbody td {
+	border:0;
+	border-bottom:1px dotted #ccc;
+	min-height: 20px;
+}
+
+.formtable label {
+	float:none;
+	display:block;
+	padding:0;
+	margin:0;
+	width:100%;
+	text-align:left;
+}
+
+td {
+	padding-top:5px;
+	padding-left:10px;
+	padding-right: 10px;
+	padding-bottom:5px;
+	min-height: 20px;
+}
+
+table tfoot td {
+	height:25px;
+	border-top: 1px solid #d1d5d8;
+	background-color: #f2f8fa;
+}
+
+.tfootleft {
+	text-align:left;
+}
+
+.maintitle {
+	padding-top:20px;
+}
+
+/* input elements */
+input {
+	background: #fff url(../img/text_align_left.png) no-repeat 5px 4px;
+	padding:2px 4px 2px 24px;
+	height:22px;
+	border: 1px solid #d9d9d9;
+	margin-bottom: 5px;
+}
+
+textarea {
+	background:#fff url(../img/text_align_left.png) no-repeat 5px 4px;
+	padding:4px 4px 2px 24px;
+	border:1px solid #d9d9d9;
+	margin-bottom: 5px;
+}
+
+input[type="password"] {
+	background:#fff url(../img/password.png) no-repeat 5px 4px;
+}
+
+input[type="button"],input[type="submit"],input[type="reset"] {
+	background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #79bbff), color-stop(1, #378de5) );
+	background:-moz-linear-gradient( center top, #79bbff 5%, #378de5 100% );
+	filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#79bbff', endColorstr='#378de5');
+	background-color:#79bbff;
+	-moz-border-radius:5px;
+	-webkit-border-radius:5px;
+	border-radius:5px;
+	display:inline-block;
+	color:#ffffff;
+	padding:2px 24px 2px 24px;
+	text-decoration:none;
+	text-shadow:1px 1px 0px #528ecc;
+	height: 26px;
+	margin: 0 3px 0 3px;
+}
+input[type="button"]:hover,input[type="submit"]:hover,input[type="reset"]:hover {
+	background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #378de5), color-stop(1, #79bbff) );
+	background:-moz-linear-gradient( center top, #378de5 5%, #79bbff 100% );
+	filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#378de5', endColorstr='#79bbff');
+	background-color:#378de5;
+}
+
+input[type="submit"],input[class="yesbutton"] {
+	background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #9dce2c), color-stop(1, #8cb82b) );
+	background:-moz-linear-gradient( center top, #9dce2c 5%, #8cb82b 100% );
+	filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#9dce2c', endColorstr='#8cb82b');
+	background-color:#9dce2c;
+	text-shadow:1px 1px 0px #aade7c;
+}
+input[type="submit"]:hover,input[class="yesbutton"]:hover {
+	background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #8cb82b), color-stop(1, #9dce2c) );
+	background:-moz-linear-gradient( center top, #8cb82b 5%, #9dce2c 100% );
+	filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#8cb82b', endColorstr='#9dce2c');
+	background-color:#8cb82b;
+}
+
+input[class="nobutton"],input[type="reset"] {
+	background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #fe1a00), color-stop(1, #ce0100) );
+	background:-moz-linear-gradient( center top, #fe1a00 5%, #ce0100 100% );
+	filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#fe1a00', endColorstr='#ce0100');
+	background-color:#fe1a00;
+	text-shadow:1px 1px 0px #b23e35;
+}
+input[class="nobutton"]:hover,input[type="reset"]:hover {
+	background:-webkit-gradient( linear, left top, left bottom, color-stop(0.05, #ce0100), color-stop(1, #fe1a00) );
+	background:-moz-linear-gradient( center top, #ce0100 5%, #fe1a00 100% );
+	filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#ce0100', endColorstr='#fe1a00');
+	background-color:#ce0100;
+}
+
+input[type="checkbox"] {
+	background:#dae7ee;
+	padding: 0;
+	margin: 0 20px 0 0;
+}
+
+input[type="radio"] { /*the span element that immediately follow the radio button */
+	margin: 0 10px 0 10px;
+	height:22px;
+}
+
+select {
+	background:#fff;
+	padding:4px;
+	border:1px solid #d9d9d9;
+	margin-bottom: 5px;
+}
+
+.maintable {
+	width:90%;
+}
+
+.update_progess {
+	padding:2em;
+	text-align:left;
+}
+
+.preconfig {
+	text-align:left;
+	margin-top:20px;
+	margin-bottom:5px;
+	margin-right:15px;
+	margin-left:15px;
+}
+
+.preconfigitem {
+	padding:.15em;
+	border-bottom:1px solid #ccc;
+}
+
+.preconfdesc {
+	display:block;
+	margin-bottom:.5em;
+	font-size:120%;
+}
--- a/install/templates/assets/img/favicon.ico
+++ b/install/templates/assets/img/favicon.ico
--- a/install/templates/assets/img/logo.png
+++ b/install/templates/assets/img/logo.png
--- a/install/templates/assets/img/password.png
+++ b/install/templates/assets/img/password.png
--- a/install/templates/assets/img/text_align_left.png
+++ b/install/templates/assets/img/text_align_left.png
--- a/install/templates/dataform.tpl
+++ b/install/templates/dataform.tpl
@@ -0,0 +1,10 @@
+		<p style="margin: 20px 20px 0 !important">{$this->_lng['install']['title']}</p>
+		<form action="{$formaction}" method="get">
+			<fieldset>
+				{$formdata}
+				<p class="submit">
+					<input type="hidden" name="check" value="1" />
+					<input type="submit" name="chooselang" value="{$this->_lng['install']['btn_go']}" />
+				</p>
+			</fieldset>
+		</form>
--- a/install/templates/dataform2.tpl
+++ b/install/templates/dataform2.tpl
@@ -0,0 +1,13 @@
+		<p style="margin: 20px 20px 0 !important">{$this->_lng['install']['welcometext']}</p>
+		<form action="{$formaction}" method="post">
+			<hr class="line">
+			<fieldset>
+				{$formdata}
+			</fieldset>
+			<aside>
+			<input type="hidden" name="check" value="1" />
+			<input type="hidden" name="language" value="{$language}" />
+			<input type="hidden" name="installstep" value="1" />
+			<input class="bottom" type="submit" name="submitbutton" value="{$this->_lng['click_here_to_continue']}" />
+			</aside>
+		</form>
--- a/install/templates/dataitem.tpl
+++ b/install/templates/dataitem.tpl
@@ -0,0 +1,4 @@
+<p>
+	<label for="{$fieldname}" style="width:65%;{$style}">{$fieldlabel}:</label>&nbsp;
+	<input type="{$type}" name="{$fieldname}" id="{$fieldname}" value="{$fieldvalue}" {$required} />
+</p>
--- a/install/templates/dataitemchk.tpl
+++ b/install/templates/dataitemchk.tpl
@@ -0,0 +1,4 @@
+<p>
+	<label for="{$fieldname}" style="width:65%;{$style}">{$this->_lng['install']['webserver']} {$fieldlabel}:</label>
+	<input type="radio" name="webserver" id="{$fieldname}" value="{$fieldname}" {$checked} /><span>{$fieldlabel}<span>
+</p>
--- a/install/templates/datasection.tpl
+++ b/install/templates/datasection.tpl
@@ -0,0 +1,2 @@
+<br />
+<h3>{$section}</h3>
--- a/install/templates/footer.tpl
+++ b/install/templates/footer.tpl
@@ -0,0 +1,7 @@
+	</div>
+	<footer>
+		<span> Froxlor &copy; 2009-{$current_year} by <a href="http://www.froxlor.org/" rel="external">the Froxlor Team</a>
+		</span>
+	</footer>
+</body>
+</html>
--- a/install/templates/header.tpl
+++ b/install/templates/header.tpl
@@ -0,0 +1,18 @@
+<!DOCTYPE html>
+<html lang="en">
+<head>
+	<meta charset="utf-8" />
+	<meta http-equiv="Default-Style" content="text/css" />
+	<!--[if lt IE 9]><script src="../js/html5shiv.js"></script><![endif]-->
+	<link href="templates/assets/css/install.css" rel="stylesheet" type="text/css" />
+	<!--[if IE]><link rel="stylesheet" href="../templates/{$theme}/css/main_ie.css" type="text/css" /><![endif]-->
+	<link href="templates/assets/img/favicon.ico" rel="icon" type="image/x-icon" />
+	<title>Froxlor Server Management Panel - Installation</title>
+	<style type="text/css">
+	body {
+        font-family: Verdana, Geneva, sans-serif;
+	}
+	</style>
+</head>
+<body>
+	<div class="installsec">
--- a/install/templates/lngform.tpl
+++ b/install/templates/lngform.tpl
@@ -0,0 +1,14 @@
+		<form action="{$formaction}" method="get">
+			<fieldset>
+				<legend>{$this->_lng['install']['lngtitle']}</legend>
+				<p>
+					<label for="language">{$this->_lng['install']['language']}:</label>&nbsp;
+					<select name="language" id="language">
+						{$language_options}
+					</select>
+					<input type="hidden" name="check" value="1" />
+					<input type="submit" name="chooselang" value="{$this->_lng['install']['lngbtn_go']}" />
+				</p>
+			</fieldset>
+		</form>
+		<hr class="line">
--- a/install/templates/page.tpl
+++ b/install/templates/page.tpl
@@ -0,0 +1,11 @@
+<article class="install bradius">
+	<header class="dark">
+		<img src="../templates/{$theme}/assets/img/logo.png" alt="Froxlor Server Management Panel" />
+	</header>
+
+	<section class="installsec">
+		<h2>{$pagetitle}</h2>
+			{$pagecontent}
+		{$pagenavigation}
+	</section>
+</article>
--- a/install/templates/pagebottom.tpl
+++ b/install/templates/pagebottom.tpl
@@ -0,0 +1,4 @@
+<h3 style="color:{$msgcolor};text-align: center">{$message}</h3>
+<aside>
+	<a href="{$link}">{$linktext}</a>
+</aside>
--- a/install/templates/textarea.tpl
+++ b/install/templates/textarea.tpl
@@ -0,0 +1,5 @@
+<tr>
+	<td class="main_field_name">
+		<p>{$escpduserdata}</p>
+	</td>
+</tr>
--- a/install/tsmarty2c.php
+++ b/install/tsmarty2c.php
@@ -0,0 +1,124 @@
+#!/usr/bin/php
+<?php
+/**
+ * tsmarty2c.php - rips gettext strings from smarty template
+ *
+ * ------------------------------------------------------------------------- *
+ * This library is free software; you can redistribute it and/or             *
+ * modify it under the terms of the GNU Lesser General Public                *
+ * License as published by the Free Software Foundation; either              *
+ * version 2.1 of the License, or (at your option) any later version.        *
+ *                                                                           *
+ * This library is distributed in the hope that it will be useful,           *
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of            *
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU         *
+ * Lesser General Public License for more details.                           *
+ *                                                                           *
+ * You should have received a copy of the GNU Lesser General Public          *
+ * License along with this library; if not, write to the Free Software       *
+ * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA  02111-1307  USA *
+ * ------------------------------------------------------------------------- *
+ *
+ * This command line script rips gettext strings from smarty file, 
+ * and prints them to stdout in C format, that can later be used with the 
+ * standard gettext tools.
+ *
+ * Usage:
+ * ./tsmarty2c.php <filename or directory> <file2> <..> > smarty.c
+ *
+ * If a parameter is a directory, the template files within will be parsed.
+ *
+ * @package	smarty-gettext
+ * @version	$Id: tsmarty2c.php,v 1.3 2005/07/27 17:59:39 sagi Exp $
+ * @link	http://smarty-gettext.sf.net/
+ * @author	Sagi Bashari <sagi@boom.org.il>
+ * @copyright 2004-2005 Sagi Bashari
+ */
+
+// smarty open tag
+$ldq = preg_quote('{');
+
+// smarty close tag
+$rdq = preg_quote('}');
+
+// smarty command
+$cmd = preg_quote('t');
+
+// extensions of smarty files, used when going through a directory
+$extensions = array('tpl');
+
+// "fix" string - strip slashes, escape and convert new lines to \n
+function fs($str)
+{
+	$str = stripslashes($str);
+	$str = str_replace('"', '\"', $str);
+	$str = str_replace("\n", '\n', $str);
+	return $str;
+}
+
+// rips gettext strings from $file and prints them in C format
+function do_file($file)
+{
+	$content = @file_get_contents($file);
+
+	if (empty($content)) {
+		return;
+	}
+
+	global $ldq, $rdq, $cmd;
+
+	preg_match_all(
+			"/{$ldq}\s*({$cmd})\s*([^{$rdq}]*){$rdq}([^{$ldq}]*){$ldq}\/\\1{$rdq}/",
+			$content,
+			$matches
+	);
+	
+	for ($i=0; $i < count($matches[0]); $i++) {
+		// TODO: add line number
+		echo "/* $file */\n"; // credit: Mike van Lammeren 2005-02-14
+		
+		if (preg_match('/plural\s*=\s*["\']?\s*(.[^\"\']*)\s*["\']?/', $matches[2][$i], $match)) {
+			echo 'ngettext("'.fs($matches[3][$i]).'","'.fs($match[1]).'",x);'."\n";
+		} else {
+			echo 'gettext("'.fs($matches[3][$i]).'");'."\n";
+		}
+
+		echo "\n";
+	}
+}
+
+// go through a directory
+function do_dir($dir)
+{
+	$d = dir($dir);
+
+	while (false !== ($entry = $d->read())) {
+		if ($entry == '.' || $entry == '..') {
+			continue;
+		}
+
+		$entry = $dir.'/'.$entry;
+
+		if (is_dir($entry)) { // if a directory, go through it
+			do_dir($entry);
+		} else { // if file, parse only if extension is matched
+			$pi = pathinfo($entry);
+			
+			if (isset($pi['extension']) && in_array($pi['extension'], $GLOBALS['extensions'])) {
+				do_file($entry);
+			}
+		}
+	}
+
+	$d->close();
+}
+
+for ($ac=1; $ac < $_SERVER['argc']; $ac++) {
+	if (is_dir($_SERVER['argv'][$ac])) { // go through directory
+		do_dir($_SERVER['argv'][$ac]);
+	} else { // do file
+		do_file($_SERVER['argv'][$ac]);
+	}
+}
+
+?>
--- a/install/updates/froxlor/0.9/update_0.9.inc.php
+++ b/install/updates/froxlor/0.9/update_0.9.inc.php
--- a/install/updates/froxlor/0.9/update_1.0.inc.php
+++ b/install/updates/froxlor/0.9/update_1.0.inc.php
@@ -1,60 +0,0 @@
-<?php
-
-/*
-if(isFroxlorVersion('0.9'))
-{
-	showUpdateStep("Updating from 0.9 to 1.0", false);
-	showUpdateStep("Converting database tables to UTF-8");
-
-	// Convert all data to UTF-8 to have a sane standard across all data
-	$result = $db->query("SHOW TABLES");
-	while($table = $db->fetch_array($result, 'num'))
-	{
-		$db->query("ALTER TABLE " . $table[0] . " CONVERT TO CHARACTER SET utf8 COLLATE utf8_general_ci;");
-		$db->query("ALTER TABLE " . $table[0] . " DEFAULT CHARACTER SET utf8 COLLATE utf8_general_ci");
-
-		$affected_columns = array();
-
-		$primarykey = "";
-		$columns = $db->query("SHOW COLUMNS FROM ".$table[0]);
-		while ($column = $db->fetch_array($columns))
-		{
-			if (!(strpos($column['Type'], "char") === false) || !(strpos($column['Type'], "text") === false))
-			{
-				$affected_columns[] = $column['Field'];
-			}
-
-			if ($column['Key'] == 'PRI') {
-				$primarykey = $column['Field'];
-			}
-		}
-
-		$count_cols = count($affected_columns);
-		if ($count_cols > 0)
-		{
-			$load = "";
-			foreach($affected_columns as $col)
-			{
-				$load .= ", `" . $col . "`";
-			}
-
-			$rows = $db->query("SELECT $primarykey" . $load . " FROM `" . $table[0] . "`");
-			while ($row = $db->fetch_array($rows))
-			{
-				$changes = "";
-				for ($i = 0; $i < $count_cols; $i++)
-				{
-					$base = "`" . $affected_columns[$i] . "` = '" . convertUtf8($row[$affected_columns[$i]]) . "'";
-					$changes .= ($i == ($count_cols-1)) ? $base : $base . ", ";
-				}
-
-				$db->query("UPDATE `" . $table[0] . "` SET " . $changes . " WHERE `$primarykey` = '" . $db->escape($row[$primarykey]) . "';");
-			}
-		}
-	}
-	
-	lastStepStatus(0);
-}
-*/
-
-?>
--- a/install/updates/froxlor/upgrade_syscp.inc.php
+++ b/install/updates/froxlor/upgrade_syscp.inc.php
@@ -12,7 +12,7 @@
 * @author     Froxlor team <team@froxlor.org> (2010-)
 * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
 * @package    Install
- * @version    $Id$
+ *
 */

 $updateto = '0.9-r0';
--- a/Show More
+++ b/Show More
				`@@ -0,0 +1 @@`
				.jqplot-target{position:relative;color:#666;font-family:"Trebuchet MS",Arial,Helvetica,sans-serif;font-size:1em}.jqplot-axis{font-size:.75em}.jqplot-xaxis{margin-top:10px}.jqplot-x2axis{margin-bottom:10px}.jqplot-yaxis{margin-right:10px}.jqplot-y2axis,.jqplot-y3axis,.jqplot-y4axis,.jqplot-y5axis,.jqplot-y6axis,.jqplot-y7axis,.jqplot-y8axis,.jqplot-y9axis,.jqplot-yMidAxis{margin-left:10px;margin-right:10px}.jqplot-axis-tick,.jqplot-xaxis-tick,.jqplot-yaxis-tick,.jqplot-x2axis-tick,.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick,.jqplot-yMidAxis-tick{position:absolute;white-space:pre}.jqplot-xaxis-tick{top:0;left:15px;vertical-align:top}.jqplot-x2axis-tick{bottom:0;left:15px;vertical-align:bottom}.jqplot-yaxis-tick{right:0;top:15px;text-align:right}.jqplot-yaxis-tick.jqplot-breakTick{right:-20px;margin-right:0;padding:1px 5px 1px 5px;z-index:2;font-size:1.5em}.jqplot-y2axis-tick,.jqplot-y3axis-tick,.jqplot-y4axis-tick,.jqplot-y5axis-tick,.jqplot-y6axis-tick,.jqplot-y7axis-tick,.jqplot-y8axis-tick,.jqplot-y9axis-tick{left:0;top:15px;text-align:left}.jqplot-yMidAxis-tick{text-align:center;white-space:nowrap}.jqplot-xaxis-label{margin-top:10px;font-size:11pt;position:absolute}.jqplot-x2axis-label{margin-bottom:10px;font-size:11pt;position:absolute}.jqplot-yaxis-label{margin-right:10px;font-size:11pt;position:absolute}.jqplot-yMidAxis-label{font-size:11pt;position:absolute}.jqplot-y2axis-label,.jqplot-y3axis-label,.jqplot-y4axis-label,.jqplot-y5axis-label,.jqplot-y6axis-label,.jqplot-y7axis-label,.jqplot-y8axis-label,.jqplot-y9axis-label{font-size:11pt;margin-left:10px;position:absolute}.jqplot-meterGauge-tick{font-size:.75em;color:#999}.jqplot-meterGauge-label{font-size:1em;color:#999}table.jqplot-table-legend{margin-top:12px;margin-bottom:12px;margin-left:12px;margin-right:12px}table.jqplot-table-legend,table.jqplot-cursor-legend{background-color:rgba(255,255,255,0.6);border:1px solid #ccc;position:absolute;font-size:.75em}td.jqplot-table-legend{vertical-align:middle}td.jqplot-seriesToggle:hover,td.jqplot-seriesToggle:active{cursor:pointer}.jqplot-table-legend .jqplot-series-hidden{text-decoration:line-through}div.jqplot-table-legend-swatch-outline{border:1px solid #ccc;padding:1px}div.jqplot-table-legend-swatch{width:0;height:0;border-top-width:5px;border-bottom-width:5px;border-left-width:6px;border-right-width:6px;border-top-style:solid;border-bottom-style:solid;border-left-style:solid;border-right-style:solid}.jqplot-title{top:0;left:0;padding-bottom:.5em;font-size:1.2em}table.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em}.jqplot-cursor-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-highlighter-tooltip,.jqplot-canvasOverlay-tooltip{border:1px solid #ccc;font-size:.75em;white-space:nowrap;background:rgba(208,208,208,0.5);padding:1px}.jqplot-point-label{font-size:.75em;z-index:2}td.jqplot-cursor-legend-swatch{vertical-align:middle;text-align:center}div.jqplot-cursor-legend-swatch{width:1.2em;height:.7em}.jqplot-error{text-align:center}.jqplot-error-message{position:relative;top:46%;display:inline-block}div.jqplot-bubble-label{font-size:.8em;padding-left:2px;padding-right:2px;color:rgb(20%,20%,20%)}div.jqplot-bubble-label.jqplot-bubble-label-highlight{background:rgba(90%,90%,90%,0.7)}div.jqplot-noData-container{text-align:center;background-color:rgba(96%,96%,96%,0.3)}