Compare commits
1588 Commits
0.9.33-rc2
...
0.10.0-rc1
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
29365838b3 | ||
|
|
13ac7ef66c | ||
|
|
6764747fa9 | ||
|
|
91df02916c | ||
|
|
bf400fc5f8 | ||
|
|
6cd73c9ebf | ||
|
|
ed9ab39c5e | ||
|
|
678bd1bcdc | ||
|
|
90fe548901 | ||
|
|
a158d4bfb9 | ||
|
|
4028e3ba5c | ||
|
|
f7d24e8870 | ||
|
|
b1bbb1847d | ||
|
|
fb6e231f77 | ||
|
|
5786644c76 | ||
|
|
51efba0a8d | ||
|
|
2f38de90e5 | ||
|
|
410bfe2c97 | ||
|
|
cfae5b7516 | ||
|
|
6e81c235d9 | ||
|
|
0257149316 | ||
|
|
ef331ccc81 | ||
|
|
b187114c50 | ||
|
|
fdefd4f1fe | ||
|
|
4ec32c0972 | ||
|
|
111e9bf64b | ||
|
|
7d3577d649 | ||
|
|
a8fb0a6d88 | ||
|
|
8d628daf83 | ||
|
|
010f30bc9e | ||
|
|
2273a11978 | ||
|
|
5c36b79277 | ||
|
|
f5127eccd1 | ||
|
|
e962f76b32 | ||
|
|
6d8521d8dc | ||
|
|
7b231bb755 | ||
|
|
459cbcc0dd | ||
|
|
44433ef86e | ||
|
|
cb8e83bdfa | ||
|
|
84eec155de | ||
|
|
73a059b318 | ||
|
|
39d38eea8d | ||
|
|
bfb7f28ff0 | ||
|
|
036ec68651 | ||
|
|
8cebcc8a5d | ||
|
|
fbcba3ef4e | ||
|
|
fca7b95579 | ||
|
|
73c05fb231 | ||
|
|
d0fb77f3e9 | ||
|
|
32cf6dfaef | ||
|
|
8ab86a05b2 | ||
|
|
79b913131e | ||
|
|
8fd910a92e | ||
|
|
2ce1a5abb5 | ||
|
|
8448a7141a | ||
|
|
21f9a24780 | ||
|
|
1b5e31e59d | ||
|
|
03afbc902d | ||
|
|
83b760a43b | ||
|
|
c0e67dc240 | ||
|
|
2166999fef | ||
|
|
7bb7cc6a00 | ||
|
|
8b96912ab4 | ||
|
|
de33ec509b | ||
|
|
5ecb43ba73 | ||
|
|
97ff3485b7 | ||
|
|
98daef7224 | ||
|
|
2983aa5737 | ||
|
|
9a906427e7 | ||
|
|
7841eebf08 | ||
|
|
b4597d54af | ||
|
|
19ffc9587a | ||
|
|
bbe0a0b3a5 | ||
|
|
0d30f71097 | ||
|
|
0cc5693180 | ||
|
|
045a62a9db | ||
|
|
725372b6ae | ||
|
|
9e77fecc29 | ||
|
|
44c47fa6eb | ||
|
|
448de78ea5 | ||
|
|
f3859052e5 | ||
|
|
2b4199e558 | ||
|
|
b7585585dc | ||
|
|
92b133b11d | ||
|
|
5dda57458a | ||
|
|
16efd1191a | ||
|
|
1c9d76725c | ||
|
|
4ee735a81f | ||
|
|
2ba8fa2785 | ||
|
|
e64e8cafa6 | ||
|
|
3949a6858b | ||
|
|
792d25fdd8 | ||
|
|
af5ef4b9dc | ||
|
|
bd79022475 | ||
|
|
684130871b | ||
|
|
7416a41a42 | ||
|
|
30f5902b88 | ||
|
|
35c631946d | ||
|
|
585d42f1b8 | ||
|
|
c3d44b4558 | ||
|
|
04e87cce98 | ||
|
|
4cd005051b | ||
|
|
e1987af34d | ||
|
|
17c6b11a1b | ||
|
|
7170fab884 | ||
|
|
7f82038255 | ||
|
|
c1cd0004bf | ||
|
|
b43a63d665 | ||
|
|
3794003e63 | ||
|
|
13aa19e5f4 | ||
|
|
28bb614489 | ||
|
|
085d25346d | ||
|
|
685267d6fc | ||
|
|
0401e6971a | ||
|
|
7e39a7bc60 | ||
|
|
c800e89414 | ||
|
|
e719731de0 | ||
|
|
fed9efff41 | ||
|
|
48ff2e6b6d | ||
|
|
370ccbdb74 | ||
|
|
c5a58e3f36 | ||
|
|
5fa0f4b87e | ||
|
|
7c68fa7bd0 | ||
|
|
7563907df5 | ||
|
|
def3d6d19e | ||
|
|
59453a47fa | ||
|
|
1b090377ee | ||
|
|
b0e11f5708 | ||
|
|
a819d81ef2 | ||
|
|
0a28ef2af6 | ||
|
|
1ba4164028 | ||
|
|
f9ad392e39 | ||
|
|
97b5439c0d | ||
|
|
1ff784198c | ||
|
|
05402a4a1c | ||
|
|
dd8fbf0900 | ||
|
|
c0e89bbd05 | ||
|
|
b0df4e46d6 | ||
|
|
5888927239 | ||
|
|
f263175802 | ||
|
|
bed069f269 | ||
|
|
8c896d60d6 | ||
|
|
adc627ca4e | ||
|
|
d654b18517 | ||
|
|
26510f0745 | ||
|
|
60f1db5caf | ||
|
|
549ccda166 | ||
|
|
c4024c8107 | ||
|
|
8e84a4ff44 | ||
|
|
2c893fef25 | ||
|
|
e4a0cc73bd | ||
|
|
4c4b2a6df3 | ||
|
|
28f24fda72 | ||
|
|
3ff20e327f | ||
|
|
903b775f79 | ||
|
|
a25150babf | ||
|
|
a2f205bae3 | ||
|
|
a0125bb93e | ||
|
|
6329042d40 | ||
|
|
9d314aaa3f | ||
|
|
fc0a495f2d | ||
|
|
c9ee2ae7e0 | ||
|
|
4c27efa4ae | ||
|
|
c7e5df95e7 | ||
|
|
c3cc3d1f62 | ||
|
|
ba93265ac6 | ||
|
|
bf7df9a8d6 | ||
|
|
8b0966d332 | ||
|
|
aa90747089 | ||
|
|
efe54d8b56 | ||
|
|
1e816de8cf | ||
|
|
e3a78f0f84 | ||
|
|
d0c7706840 | ||
|
|
1a15cef76d | ||
|
|
dc44c67f86 | ||
|
|
ab819129dd | ||
|
|
8d966aebee | ||
|
|
4988600881 | ||
|
|
d381528c06 | ||
|
|
3d647a2c2e | ||
|
|
7e6180fed8 | ||
|
|
9e4ed645f7 | ||
|
|
9522e0cfb1 | ||
|
|
db36d57683 | ||
|
|
ddddbdfb18 | ||
|
|
df3ad9ed12 | ||
|
|
456875905d | ||
|
|
1707b5e7fd | ||
|
|
034d1b1c8e | ||
|
|
5dd915736b | ||
|
|
07d7908f6e | ||
|
|
cf53365007 | ||
|
|
1f2c1c1d2f | ||
|
|
51390d8add | ||
|
|
98120de7e1 | ||
|
|
88a2cb37c9 | ||
|
|
ec4d34d37a | ||
|
|
0b3d532028 | ||
|
|
4a0be40f92 | ||
|
|
2da59f1055 | ||
|
|
1ca1314ac4 | ||
|
|
426e46a2df | ||
|
|
212cb0140d | ||
|
|
8291c7d2ab | ||
|
|
1bd4c00631 | ||
|
|
69495b94af | ||
|
|
29c754e700 | ||
|
|
fd69fc22db | ||
|
|
c7bee4edf2 | ||
|
|
9756c792d7 | ||
|
|
a86f10a4b4 | ||
|
|
946c2507c5 | ||
|
|
56ac4b5c26 | ||
|
|
e4becfb1dd | ||
|
|
6129768711 | ||
|
|
72690e311f | ||
|
|
2ef067e12d | ||
|
|
ae71e3ad2a | ||
|
|
745621c416 | ||
|
|
069ccd24e6 | ||
|
|
76b5f813c5 | ||
|
|
9ad6616fa3 | ||
|
|
4dca2d6217 | ||
|
|
eab88abd54 | ||
|
|
ea3c49befe | ||
|
|
e1bfb2690d | ||
|
|
091f92400b | ||
|
|
18df961381 | ||
|
|
18c49e4c48 | ||
|
|
4da9d4c7c0 | ||
|
|
9a528532d2 | ||
|
|
96addebdf3 | ||
|
|
49adcb6886 | ||
|
|
ed86c2a892 | ||
|
|
7c7ef5be09 | ||
|
|
c269cd5c5c | ||
|
|
f6e0298d25 | ||
|
|
983e1ce6ad | ||
|
|
a87f1c5561 | ||
|
|
9d82f0d269 | ||
|
|
32b5bef221 | ||
|
|
50eec8d8a7 | ||
|
|
fc8373f6b6 | ||
|
|
1d3d8d0f28 | ||
|
|
b9e4adc634 | ||
|
|
3a3b35b2eb | ||
|
|
8a565532b2 | ||
|
|
02ba4b5f67 | ||
|
|
b032f5b2ba | ||
|
|
758111a7c1 | ||
|
|
ba124c99af | ||
|
|
776bb56b24 | ||
|
|
d2024e06ff | ||
|
|
8c8be45769 | ||
|
|
892d259805 | ||
|
|
13c624400e | ||
|
|
e184201327 | ||
|
|
059e36aa78 | ||
|
|
18aa8eb5d2 | ||
|
|
41acbc745c | ||
|
|
ab81004bf2 | ||
|
|
d80cf6525c | ||
|
|
247efb1c0a | ||
|
|
e1b62d3af4 | ||
|
|
b340221055 | ||
|
|
e16ea186dc | ||
|
|
ce2722d429 | ||
|
|
e0a195e3bc | ||
|
|
899a7ac189 | ||
|
|
fb4d379047 | ||
|
|
98c55435ae | ||
|
|
981f5840b3 | ||
|
|
4efdb0cd66 | ||
|
|
06dcaeacb5 | ||
|
|
14112bf5d7 | ||
|
|
c55ef54937 | ||
|
|
2e65de176b | ||
|
|
3b31cd8432 | ||
|
|
c1809fc084 | ||
|
|
090bdaaea8 | ||
|
|
611bec6849 | ||
|
|
8cf797374d | ||
|
|
20177e06fc | ||
|
|
d76df274f4 | ||
|
|
95b305b865 | ||
|
|
aa6f3d33eb | ||
|
|
b6e4dbd70a | ||
|
|
854986abcb | ||
|
|
c35407bc94 | ||
|
|
5752f7b64e | ||
|
|
23d4bee184 | ||
|
|
37988fa645 | ||
|
|
6c7ee0c222 | ||
|
|
108c4c25b3 | ||
|
|
095e54d88d | ||
|
|
70cb760862 | ||
|
|
738e629eec | ||
|
|
bd036a0fde | ||
|
|
f766c6f920 | ||
|
|
4588bc7f5c | ||
|
|
9e289a2380 | ||
|
|
f0edf97ac7 | ||
|
|
91195fda89 | ||
|
|
6161ad1bd3 | ||
|
|
f72d87228b | ||
|
|
4f0acd176a | ||
|
|
5f29b2cc4a | ||
|
|
164f1a921e | ||
|
|
94c4d52476 | ||
|
|
174739bc0c | ||
|
|
b777053133 | ||
|
|
d0c2888508 | ||
|
|
ff8afef614 | ||
|
|
a28b2e8115 | ||
|
|
b0e348a2c5 | ||
|
|
512abda38d | ||
|
|
963c7c4616 | ||
|
|
1690cadab9 | ||
|
|
9e7715430b | ||
|
|
4f69571e1c | ||
|
|
d4312fc481 | ||
|
|
f1d91dfef8 | ||
|
|
f198833f8c | ||
|
|
da99398561 | ||
|
|
436d141bd1 | ||
|
|
aa881560cc | ||
|
|
06ef81cc5b | ||
|
|
4a99e4ba57 | ||
|
|
2ba4137e7d | ||
|
|
72835c56ad | ||
|
|
d39cebc70e | ||
|
|
b80bdcbc4f | ||
|
|
c1e62e6be7 | ||
|
|
10330f8a7a | ||
|
|
18fb422a69 | ||
|
|
f8236dff7b | ||
|
|
8ccb898aa9 | ||
|
|
bad680cfdb | ||
|
|
5a070d6d91 | ||
|
|
07a3f76568 | ||
|
|
d07d63e240 | ||
|
|
67b95a301b | ||
|
|
926914788f | ||
|
|
6f9187d1bb | ||
|
|
84b8cda7ac | ||
|
|
75616cc727 | ||
|
|
b3d018c506 | ||
|
|
2508d855e3 | ||
|
|
a21f3c5a3f | ||
|
|
060115c5e9 | ||
|
|
697d972fba | ||
|
|
3f69c97874 | ||
|
|
85407abfb4 | ||
|
|
20d9be537a | ||
|
|
30d39d622d | ||
|
|
e58192edc2 | ||
|
|
d15e4a8270 | ||
|
|
45d7307a8f | ||
|
|
bf3ae3009f | ||
|
|
cb3d5f3488 | ||
|
|
efb416ae7c | ||
|
|
c98be3c04f | ||
|
|
6006b16c95 | ||
|
|
c149cbacf7 | ||
|
|
48d7110779 | ||
|
|
bd7f2c2654 | ||
|
|
5123b5fccd | ||
|
|
190c95baca | ||
|
|
975d46044d | ||
|
|
bf589cdec8 | ||
|
|
715e5f7a64 | ||
|
|
dfcb7160cb | ||
|
|
f5654d5931 | ||
|
|
2bf5fde0e5 | ||
|
|
be0099bf01 | ||
|
|
7a68dfc450 | ||
|
|
858a9ba6a4 | ||
|
|
f2809c47ac | ||
|
|
616fb77de5 | ||
|
|
b03d41087a | ||
|
|
724e88b94f | ||
|
|
3c802038f2 | ||
|
|
fe385b7800 | ||
|
|
38b57117e2 | ||
|
|
7e47383ee3 | ||
|
|
ae3d954766 | ||
|
|
52da7ad40f | ||
|
|
309e613c83 | ||
|
|
05857985f8 | ||
|
|
a7523bbdea | ||
|
|
54deec87d0 | ||
|
|
f0e084ef0e | ||
|
|
fa7bb53d58 | ||
|
|
6fc8cce8f5 | ||
|
|
2e597ef7d9 | ||
|
|
ff611fa8dc | ||
|
|
c920bf6a63 | ||
|
|
66ebfaf21b | ||
|
|
349fa7a761 | ||
|
|
81bd9d945d | ||
|
|
b205f8ea5d | ||
|
|
7b52c0c78c | ||
|
|
164650adc3 | ||
|
|
9e97e82990 | ||
|
|
cd5cef51e8 | ||
|
|
231159a6c6 | ||
|
|
a83031504f | ||
|
|
893fd0774c | ||
|
|
704188fe27 | ||
|
|
a621fd3b09 | ||
|
|
0c43c5d2b5 | ||
|
|
864331d371 | ||
|
|
f5ec759d99 | ||
|
|
b2e2590324 | ||
|
|
ae4a7ff943 | ||
|
|
a869bc58cd | ||
|
|
cfa07bab47 | ||
|
|
b664917147 | ||
|
|
b12392f0a9 | ||
|
|
b07d6ceeaa | ||
|
|
aff6d82321 | ||
|
|
91cecf8c1e | ||
|
|
702b52d13e | ||
|
|
bb3fddb08f | ||
|
|
7cc17b9ca5 | ||
|
|
f30887e3c0 | ||
|
|
0d7afc5c24 | ||
|
|
826f1378d2 | ||
|
|
6d8b22dccf | ||
|
|
26c3c8e6f0 | ||
|
|
0f6cc05089 | ||
|
|
08814f8c9a | ||
|
|
632eb98df9 | ||
|
|
909c983aec | ||
|
|
8642254175 | ||
|
|
7e81b0bb5a | ||
|
|
22a48cac33 | ||
|
|
20eaa7bc08 | ||
|
|
1605d2af07 | ||
|
|
abb94c9189 | ||
|
|
cadb6618ec | ||
|
|
594512404f | ||
|
|
aeb8655cc3 | ||
|
|
601d16b17c | ||
|
|
02616d3080 | ||
|
|
2bf5e90a77 | ||
|
|
75bc6d32ab | ||
|
|
3e0b551416 | ||
|
|
a038e35e45 | ||
|
|
6318e5514b | ||
|
|
392db944a2 | ||
|
|
b097c19c0a | ||
|
|
b46d3a3769 | ||
|
|
a2172329cd | ||
|
|
309b70c0f8 | ||
|
|
4b9ed8ee39 | ||
|
|
2599f61b32 | ||
|
|
9a4359e010 | ||
|
|
4d89f614e3 | ||
|
|
4fad0def1e | ||
|
|
c093783904 | ||
|
|
257855b43b | ||
|
|
55ec20be10 | ||
|
|
b0f355ba2f | ||
|
|
ceb8619552 | ||
|
|
6191ee6fba | ||
|
|
c9256c0020 | ||
|
|
592c9ed0b9 | ||
|
|
4a1decf359 | ||
|
|
ae42e87a64 | ||
|
|
5c330505ea | ||
|
|
c65d95c1ef | ||
|
|
2b366c8f23 | ||
|
|
e66dde2e64 | ||
|
|
f32a1921c5 | ||
|
|
0958d07f23 | ||
|
|
a222114d0a | ||
|
|
243b68cc37 | ||
|
|
2f30d85d32 | ||
|
|
ca07621de7 | ||
|
|
e5a1b504d7 | ||
|
|
20aac1ccd4 | ||
|
|
bda652f947 | ||
|
|
87912a9e07 | ||
|
|
0bf430e0c1 | ||
|
|
d2aaf84eff | ||
|
|
b5ebe48715 | ||
|
|
9a61a56732 | ||
|
|
81d6a856d9 | ||
|
|
344ca827e4 | ||
|
|
1c4ecdffbf | ||
|
|
831ee221f6 | ||
|
|
6409fb2dbe | ||
|
|
662f537a0d | ||
|
|
8e0bfe9d09 | ||
|
|
8930d2a1bf | ||
|
|
d9ec214e17 | ||
|
|
dfb5d33a56 | ||
|
|
b42a7b1b26 | ||
|
|
a468fe50df | ||
|
|
c1875132ef | ||
|
|
332e29be24 | ||
|
|
c93e2678f7 | ||
|
|
f8fe4be3ef | ||
|
|
689ca853c3 | ||
|
|
8310e8554b | ||
|
|
b56414ed0e | ||
|
|
5480fcbf5d | ||
|
|
26b9c030b5 | ||
|
|
aef528bea1 | ||
|
|
d5b9ad3452 | ||
|
|
5437fcdc89 | ||
|
|
b9653c5abd | ||
|
|
eabc78c84f | ||
|
|
033393880d | ||
|
|
6bcfb81c6c | ||
|
|
b2ac1fb593 | ||
|
|
8c6ae4f3a3 | ||
|
|
131efc544d | ||
|
|
5524ff7cae | ||
|
|
603e14913b | ||
|
|
160474f2b6 | ||
|
|
168738b23a | ||
|
|
133af365bd | ||
|
|
532551263d | ||
|
|
bdfd601dae | ||
|
|
9619abdad7 | ||
|
|
fd287e7be4 | ||
|
|
5afdbae83a | ||
|
|
7c96164770 | ||
|
|
60defd3cdf | ||
|
|
8978dd3a4b | ||
|
|
1e45da2410 | ||
|
|
2da2912c9c | ||
|
|
4d12a4f37b | ||
|
|
350e3d733a | ||
|
|
81602f17be | ||
|
|
df5fb963c1 | ||
|
|
0fc2fbaf09 | ||
|
|
a82d5cf764 | ||
|
|
2c1f76e6a4 | ||
|
|
d068477a93 | ||
|
|
4663f8c6ec | ||
|
|
dd371c72a2 | ||
|
|
6f91bece17 | ||
|
|
5c30961d3c | ||
|
|
edd5ef0ca0 | ||
|
|
6befe85656 | ||
|
|
27f8c8b438 | ||
|
|
fc0c796b68 | ||
|
|
482e8c9a11 | ||
|
|
7a664a9990 | ||
|
|
372ab5d9c8 | ||
|
|
de70dbb888 | ||
|
|
4d7ceb9efe | ||
|
|
bb792f228f | ||
|
|
017396197e | ||
|
|
216f013c96 | ||
|
|
05f1bf0a1f | ||
|
|
295fbae6f5 | ||
|
|
ca4c93ac92 | ||
|
|
13b1503bf2 | ||
|
|
2980397545 | ||
|
|
5612720342 | ||
|
|
4d3fa6eca5 | ||
|
|
05b4c58aa8 | ||
|
|
f290497b64 | ||
|
|
b4dd35eed2 | ||
|
|
ec21e28000 | ||
|
|
0aa707ebc9 | ||
|
|
f38a0fd8b6 | ||
|
|
a6b2daa77d | ||
|
|
7ae31496ac | ||
|
|
c62dd2ecf4 | ||
|
|
840b5ea229 | ||
|
|
d8a3015303 | ||
|
|
194b7863b8 | ||
|
|
f034695290 | ||
|
|
f896fe11a0 | ||
|
|
2603a9c869 | ||
|
|
fcd0dddfd5 | ||
|
|
3fb92259a8 | ||
|
|
54d7b01ac5 | ||
|
|
ca0ab1f97a | ||
|
|
f3733ca249 | ||
|
|
7442bf7347 | ||
|
|
6ac3cb2014 | ||
|
|
ca76e572a2 | ||
|
|
c3fb6f6a1c | ||
|
|
1796a8ff17 | ||
|
|
52c7839b9b | ||
|
|
d16a7b2089 | ||
|
|
9a00a67f71 | ||
|
|
6e651200ca | ||
|
|
29968e6026 | ||
|
|
8c61773280 | ||
|
|
29433ce963 | ||
|
|
eed3a91385 | ||
|
|
62006d584e | ||
|
|
bba872618a | ||
|
|
941dd14c72 | ||
|
|
f2a79d4d96 | ||
|
|
281b131c62 | ||
|
|
4bcdfc0786 | ||
|
|
9312e4967e | ||
|
|
6b44dfe9b2 | ||
|
|
ba58991d11 | ||
|
|
84abb33e54 | ||
|
|
07a4f045f1 | ||
|
|
f49cb81e49 | ||
|
|
b2b9d4e31a | ||
|
|
d40d1f30b6 | ||
|
|
9aaadb1f8b | ||
|
|
3969ef63c5 | ||
|
|
d8abe30c44 | ||
|
|
eaa10ce6a5 | ||
|
|
c434249616 | ||
|
|
b849a5f29a | ||
|
|
3dc6a64252 | ||
|
|
ebd636494a | ||
|
|
07caf55f79 | ||
|
|
73868b7947 | ||
|
|
af55fe5b82 | ||
|
|
de408347fc | ||
|
|
ea96039128 | ||
|
|
c49539258e | ||
|
|
64653a2bb1 | ||
|
|
732c6e3a78 | ||
|
|
66a4309fe5 | ||
|
|
57277eb1e3 | ||
|
|
148b2fc1be | ||
|
|
cf4f15a83c | ||
|
|
297f3f638c | ||
|
|
d2a9fa8632 | ||
|
|
a5251824ae | ||
|
|
cb31c5258d | ||
|
|
5540b02e35 | ||
|
|
e725b48c4c | ||
|
|
45c0915b59 | ||
|
|
1e03946df7 | ||
|
|
dd3e5e9c6b | ||
|
|
421c29c491 | ||
|
|
15b62aae04 | ||
|
|
181848290f | ||
|
|
b263b211a5 | ||
|
|
1753d2895b | ||
|
|
64ebb0ca38 | ||
|
|
bab982a0e6 | ||
|
|
c2c5178831 | ||
|
|
56e8e32965 | ||
|
|
47cd30a45e | ||
|
|
bd8f659272 | ||
|
|
82c719d786 | ||
|
|
dc22ff6aa3 | ||
|
|
c68682b084 | ||
|
|
aa8a7ee0a9 | ||
|
|
e95a917812 | ||
|
|
332e627007 | ||
|
|
a3201481f6 | ||
|
|
dae233dd05 | ||
|
|
9aa2cc269b | ||
|
|
434f202832 | ||
|
|
552d58848c | ||
|
|
bea1677d5d | ||
|
|
a2e0de23e1 | ||
|
|
ebb33c9cee | ||
|
|
22414096ad | ||
|
|
9db7434876 | ||
|
|
9fabfd539d | ||
|
|
54f6c3e019 | ||
|
|
5930ab1c9d | ||
|
|
3870cc1002 | ||
|
|
f880e1c9f1 | ||
|
|
9285a169dd | ||
|
|
95b7b57fc6 | ||
|
|
872928fb38 | ||
|
|
cb2f094e3d | ||
|
|
b11b423217 | ||
|
|
567827e2cb | ||
|
|
ec1bd6e19a | ||
|
|
d4cd827284 | ||
|
|
50f85fb6d0 | ||
|
|
9cc69e5b3d | ||
|
|
d9e8f43298 | ||
|
|
ad7cf52f21 | ||
|
|
398d45deae | ||
|
|
541ab1fe6e | ||
|
|
c0fddbce81 | ||
|
|
2284706e0c | ||
|
|
a4f72cbb40 | ||
|
|
d1c776b706 | ||
|
|
8ef315014c | ||
|
|
2d59e569df | ||
|
|
202eb0931f | ||
|
|
4cd1a8d656 | ||
|
|
01a363456e | ||
|
|
8f4da0638e | ||
|
|
3e6c3d725b | ||
|
|
95a18be5c5 | ||
|
|
8030aae37a | ||
|
|
0eaa81b503 | ||
|
|
c2b864a20f | ||
|
|
e00cb8926d | ||
|
|
afb2bce16d | ||
|
|
1033f502b1 | ||
|
|
ab18d94053 | ||
|
|
9afbe7fb71 | ||
|
|
5e0270e6a8 | ||
|
|
c6962b0992 | ||
|
|
9fdcd09089 | ||
|
|
338cf161d2 | ||
|
|
044ce6662a | ||
|
|
d574233f49 | ||
|
|
02c6545c94 | ||
|
|
c795cd3320 | ||
|
|
1ebde2e6a4 | ||
|
|
78ee141b26 | ||
|
|
d11ddd910f | ||
|
|
437446c49d | ||
|
|
7a603596c5 | ||
|
|
c2a91ed623 | ||
|
|
3dcd2b9a3e | ||
|
|
75622d4737 | ||
|
|
7a617d0aa4 | ||
|
|
ccca077df7 | ||
|
|
5c008adf16 | ||
|
|
4502f7ddf5 | ||
|
|
f9101f880b | ||
|
|
5ed0c3f2f3 | ||
|
|
9907775c0d | ||
|
|
ed9d4a5744 | ||
|
|
c1aea2795e | ||
|
|
3a8996aee2 | ||
|
|
e67aefe48b | ||
|
|
602c38dbeb | ||
|
|
f1c232cef9 | ||
|
|
3d4b56b233 | ||
|
|
d8994ca65b | ||
|
|
18514f0180 | ||
|
|
001786dd97 | ||
|
|
225539d2e7 | ||
|
|
1b18ec45be | ||
|
|
7b6bbcec48 | ||
|
|
56276a19d1 | ||
|
|
c00abc3b92 | ||
|
|
301dadaa02 | ||
|
|
559bd6d892 | ||
|
|
18b45c749d | ||
|
|
2c00f982d8 | ||
|
|
54200427ab | ||
|
|
f8996ad767 | ||
|
|
9838ff4da5 | ||
|
|
192e00c717 | ||
|
|
43ca4a28e4 | ||
|
|
16e9fd6bd9 | ||
|
|
16f547bce0 | ||
|
|
60a482dce6 | ||
|
|
9540cb158c | ||
|
|
1984aced9d | ||
|
|
ca2949da71 | ||
|
|
eb8449fd79 | ||
|
|
547140bafb | ||
|
|
d245bca445 | ||
|
|
5f899a5510 | ||
|
|
432645431c | ||
|
|
30087548b0 | ||
|
|
d93cfff172 | ||
|
|
e5053bad15 | ||
|
|
1519db1637 | ||
|
|
b0326c640c | ||
|
|
7e4164da26 | ||
|
|
fad607c6e8 | ||
|
|
d6b56262ce | ||
|
|
c409d8a6ba | ||
|
|
4274b8a737 | ||
|
|
60c1babd93 | ||
|
|
ec6ddd054d | ||
|
|
76c200a56c | ||
|
|
a44be363a6 | ||
|
|
304926260f | ||
|
|
462fca7328 | ||
|
|
884b2ed913 | ||
|
|
af77453bfe | ||
|
|
fa45de6586 | ||
|
|
b4e8458076 | ||
|
|
979b1b0ad8 | ||
|
|
2bee58166b | ||
|
|
3597a89da3 | ||
|
|
f406962dfd | ||
|
|
ce31a0b3fd | ||
|
|
fc2ae594cb | ||
|
|
58c14376d6 | ||
|
|
91c2d4efbe | ||
|
|
e4c12b2c77 | ||
|
|
75d8d0b397 | ||
|
|
f1f7d7dd14 | ||
|
|
06e44b6e2b | ||
|
|
41c07d5b71 | ||
|
|
d198729222 | ||
|
|
4a3e02c1f0 | ||
|
|
074d85b40f | ||
|
|
3ff85e167c | ||
|
|
2e198dbe5c | ||
|
|
dc428b7de2 | ||
|
|
06a55ef91e | ||
|
|
ed0ede645a | ||
|
|
79b839c024 | ||
|
|
02797d9abc | ||
|
|
97d035eee9 | ||
|
|
9799e05ce4 | ||
|
|
98c8f519a6 | ||
|
|
6197a97dc1 | ||
|
|
6a85c37b48 | ||
|
|
a1e4374ada | ||
|
|
58835ef81f | ||
|
|
16751d7446 | ||
|
|
e95710d599 | ||
|
|
b366f04743 | ||
|
|
f3c74bd718 | ||
|
|
8e1a1043a5 | ||
|
|
1664896062 | ||
|
|
ec474e2b4c | ||
|
|
84ee5a2192 | ||
|
|
a24db0ca6d | ||
|
|
56c8e90700 | ||
|
|
e9d438f8cf | ||
|
|
41e769d681 | ||
|
|
d8b6d87ade | ||
|
|
506c5ac27a | ||
|
|
c6ba9df18a | ||
|
|
4229d8dda4 | ||
|
|
3b157a8c66 | ||
|
|
b8c2047379 | ||
|
|
28461de7bc | ||
|
|
c51840e760 | ||
|
|
a21d19bdcd | ||
|
|
6c4d9ccbf7 | ||
|
|
d56afda274 | ||
|
|
b8bfd7ff4c | ||
|
|
d1a3defef0 | ||
|
|
08f36243e9 | ||
|
|
e4887362ec | ||
|
|
290d06e2c4 | ||
|
|
9260319ac1 | ||
|
|
78ab90f469 | ||
|
|
34767a14d5 | ||
|
|
d7388f20e6 | ||
|
|
8f488d7701 | ||
|
|
7f56e98009 | ||
|
|
a840905166 | ||
|
|
3757db28f4 | ||
|
|
d31589ba99 | ||
|
|
45b6d8d571 | ||
|
|
11b2d0e1d2 | ||
|
|
d7fc9cde57 | ||
|
|
b162fb6e99 | ||
|
|
2f6e34d878 | ||
|
|
a47ab55cdd | ||
|
|
dd4cfebe75 | ||
|
|
818268482e | ||
|
|
8431a82f2c | ||
|
|
2444158bbb | ||
|
|
003005f295 | ||
|
|
731427255e | ||
|
|
468d20ee57 | ||
|
|
d994379130 | ||
|
|
cd806b19f7 | ||
|
|
e17a2eff4a | ||
|
|
690b25a6f5 | ||
|
|
e31c828f35 | ||
|
|
cdd97b142f | ||
|
|
b2f815617c | ||
|
|
11d358133e | ||
|
|
0e77d5ab94 | ||
|
|
51152ef026 | ||
|
|
f5dc8aa1c9 | ||
|
|
ceaa0fcf5c | ||
|
|
cc372ba89b | ||
|
|
526eb84b71 | ||
|
|
14e54ff41a | ||
|
|
aa76ae4ddc | ||
|
|
f1b7d731bd | ||
|
|
e3587fb346 | ||
|
|
e5c649aba3 | ||
|
|
4a3b64b497 | ||
|
|
54e2f83b17 | ||
|
|
a95233041e | ||
|
|
5165cac4e2 | ||
|
|
d31c4fa37c | ||
|
|
084e72968a | ||
|
|
6ab8cb1d7c | ||
|
|
6589653667 | ||
|
|
c3753478f2 | ||
|
|
b63fc5b508 | ||
|
|
3d2cb879b0 | ||
|
|
8366e57512 | ||
|
|
1c369e5503 | ||
|
|
83f40401be | ||
|
|
19456e9b30 | ||
|
|
7d2c64ce63 | ||
|
|
3f790bc334 | ||
|
|
164e1108e5 | ||
|
|
8fe20251f3 | ||
|
|
a121363dd2 | ||
|
|
7ec777c9dd | ||
|
|
77aa58a0a3 | ||
|
|
1e8bc553b8 | ||
|
|
6df08f6b9a | ||
|
|
5e9e2996d7 | ||
|
|
6f8aa1cbc0 | ||
|
|
b22e70804b | ||
|
|
5789e9a8a4 | ||
|
|
6c55a40606 | ||
|
|
b4f90730cc | ||
|
|
50317da185 | ||
|
|
631e36f4d5 | ||
|
|
a400fc9c65 | ||
|
|
5f9962b6ba | ||
|
|
d6dc71436a | ||
|
|
b6f99958fd | ||
|
|
9a89f06bf0 | ||
|
|
843845a825 | ||
|
|
0b93ba3dde | ||
|
|
bd36145ad6 | ||
|
|
88ccf5b869 | ||
|
|
5866293a25 | ||
|
|
d2711889de | ||
|
|
82af43f598 | ||
|
|
7a36f5edac | ||
|
|
480d21f555 | ||
|
|
2e7133d619 | ||
|
|
85f707af8a | ||
|
|
970a119f23 | ||
|
|
7faebbb197 | ||
|
|
08d505b308 | ||
|
|
1b0649d0cf | ||
|
|
e5c16439e1 | ||
|
|
151d8f8c5c | ||
|
|
08563e9298 | ||
|
|
b51f0821cb | ||
|
|
339d84736e | ||
|
|
7ea1de2a92 | ||
|
|
be373e278f | ||
|
|
61eab6fd93 | ||
|
|
c2b0714b4a | ||
|
|
5c1079e04b | ||
|
|
257f65bd1b | ||
|
|
96ff346e54 | ||
|
|
076b6143ce | ||
|
|
1e3262d691 | ||
|
|
94af32fb82 | ||
|
|
1f63ea10a0 | ||
|
|
fa60c17dbc | ||
|
|
b4c7fb574c | ||
|
|
83fa0059de | ||
|
|
d97957e558 | ||
|
|
9d16790f5b | ||
|
|
b14ab6b1c1 | ||
|
|
b029fe113e | ||
|
|
6ea4655fd8 | ||
|
|
477c99b4de | ||
|
|
eb70e619c9 | ||
|
|
41e4135f71 | ||
|
|
1ce5cf6c00 | ||
|
|
f7441df895 | ||
|
|
69443d95d5 | ||
|
|
11e923453e | ||
|
|
b03eab897a | ||
|
|
25ff78e295 | ||
|
|
6e2b1773a3 | ||
|
|
f3e05742b5 | ||
|
|
001f10f74e | ||
|
|
712aebb864 | ||
|
|
0ae0178b4c | ||
|
|
1d4211a5ce | ||
|
|
28115e6b1d | ||
|
|
68fa0e6576 | ||
|
|
8d8da0986a | ||
|
|
e0e748a0bc | ||
|
|
da785500cc | ||
|
|
02654a256d | ||
|
|
552c6e6cf9 | ||
|
|
86dc57c2cc | ||
|
|
11eb08e031 | ||
|
|
4a4acc5c01 | ||
|
|
899663350d | ||
|
|
689a1fdbd2 | ||
|
|
cec5f33870 | ||
|
|
bd9ef50e94 | ||
|
|
68d579b629 | ||
|
|
0404618c24 | ||
|
|
9b5ce83e8b | ||
|
|
7379398d22 | ||
|
|
d1106dd984 | ||
|
|
b775c2f60e | ||
|
|
407a7c01aa | ||
|
|
bb9331904e | ||
|
|
64d068659f | ||
|
|
e33d7b756f | ||
|
|
283e272b99 | ||
|
|
31d08d532c | ||
|
|
5acd51fdd3 | ||
|
|
6369e160b8 | ||
|
|
5e09d56871 | ||
|
|
0e79e8d670 | ||
|
|
941a25ec9d | ||
|
|
2210d3de12 | ||
|
|
ae01f2cdb9 | ||
|
|
e8e980509f | ||
|
|
b2cd992f92 | ||
|
|
7c44c5ea75 | ||
|
|
b1446d366e | ||
|
|
9bfd5eb17e | ||
|
|
fb555027fd | ||
|
|
05974de4d5 | ||
|
|
9c9bbb81de | ||
|
|
ef7da53806 | ||
|
|
a26ebb375b | ||
|
|
c8bbefb2bb | ||
|
|
a485d9f4f9 | ||
|
|
f8be36d229 | ||
|
|
28f0c3eac4 | ||
|
|
e8f5fc1a8a | ||
|
|
a014b5cc2b | ||
|
|
84f1d94ad6 | ||
|
|
8565dbce8b | ||
|
|
72d1282651 | ||
|
|
d474f2ec8f | ||
|
|
252b42ee57 | ||
|
|
0dfaf376c0 | ||
|
|
2a05b89cc8 | ||
|
|
576c94f83c | ||
|
|
5331127204 | ||
|
|
57f9c439f2 | ||
|
|
c14017c244 | ||
|
|
82cd5986a0 | ||
|
|
032a991b8f | ||
|
|
200f589252 | ||
|
|
3405c7e313 | ||
|
|
30bd81064c | ||
|
|
924a607183 | ||
|
|
f1460d169d | ||
|
|
f5e2afaa0a | ||
|
|
228d07ca66 | ||
|
|
3294bbf9b4 | ||
|
|
a849f35469 | ||
|
|
104383d31e | ||
|
|
1dd9bcbbe0 | ||
|
|
05d57a8af7 | ||
|
|
630ecfb148 | ||
|
|
d545734072 | ||
|
|
c903b759bb | ||
|
|
579854f5a5 | ||
|
|
6b032839ce | ||
|
|
be1d9a045a | ||
|
|
8bc19e3893 | ||
|
|
f9740ff545 | ||
|
|
2b2ca99a2b | ||
|
|
641ee1f8a6 | ||
|
|
52448571ea | ||
|
|
7bba4112b9 | ||
|
|
efd64300c4 | ||
|
|
1f3c208f95 | ||
|
|
4330b08c04 | ||
|
|
1c80118117 | ||
|
|
65fd6ac191 | ||
|
|
291fae1744 | ||
|
|
c458ed8b0c | ||
|
|
7ec62401e7 | ||
|
|
be83c99334 | ||
|
|
7c8dbd370f | ||
|
|
604f37bd17 | ||
|
|
9d6ee0d08f | ||
|
|
7dc2e6cb5f | ||
|
|
fb5fd5a279 | ||
|
|
d3bf80342d | ||
|
|
77502efce7 | ||
|
|
ca34f7a78a | ||
|
|
eae8b8835b | ||
|
|
58c6b4edb1 | ||
|
|
86252a22a0 | ||
|
|
964a1716d7 | ||
|
|
06862240f0 | ||
|
|
3119510ef4 | ||
|
|
b4a8ed8828 | ||
|
|
c182664167 | ||
|
|
4bba24801c | ||
|
|
274e556989 | ||
|
|
74758818e7 | ||
|
|
69a191d4e2 | ||
|
|
f9d949f90c | ||
|
|
130d3e7b16 | ||
|
|
f6e519d779 | ||
|
|
ca807583df | ||
|
|
e6df2d5d40 | ||
|
|
82c1f29eba | ||
|
|
fc78a51235 | ||
|
|
28b3eb9585 | ||
|
|
e9e9214910 | ||
|
|
03a1f9b9b1 | ||
|
|
bee529b7fa | ||
|
|
6e9615261e | ||
|
|
1fad30a43a | ||
|
|
3d5e6152cd | ||
|
|
24f7d88a5c | ||
|
|
d6f42dc88c | ||
|
|
42c28e6590 | ||
|
|
6d8d01058b | ||
|
|
2efe715aa0 | ||
|
|
4c4916a661 | ||
|
|
cf8fbe2224 | ||
|
|
573fd69c95 | ||
|
|
71f502f508 | ||
|
|
f4a9152d8f | ||
|
|
319668d384 | ||
|
|
101e791add | ||
|
|
088eef9728 | ||
|
|
aa592c7369 | ||
|
|
b67749bcdc | ||
|
|
b05105bfdf | ||
|
|
6a10020e9b | ||
|
|
9f85074876 | ||
|
|
45bf41db4c | ||
|
|
06f4907053 | ||
|
|
4f2ee129fd | ||
|
|
373cb912d8 | ||
|
|
f284d67843 | ||
|
|
75172f9e8d | ||
|
|
48a1b9489a | ||
|
|
2e0cb5050f | ||
|
|
6ddbb10b5a | ||
|
|
802e12cf7b | ||
|
|
82b43948b4 | ||
|
|
36cf003ed6 | ||
|
|
2286ea751e | ||
|
|
deb19f2625 | ||
|
|
83fd1ab0ca | ||
|
|
f00a1ca092 | ||
|
|
152b407cb7 | ||
|
|
5c5e736776 | ||
|
|
dc71a582fc | ||
|
|
fc92e2655c | ||
|
|
abe253bc31 | ||
|
|
0559f3c4d6 | ||
|
|
ae2bad5ab4 | ||
|
|
55df79a79c | ||
|
|
32c32a7e7a | ||
|
|
d7ca3a0f1c | ||
|
|
e8489e55a1 | ||
|
|
5c90c3aa97 | ||
|
|
b5e739620d | ||
|
|
a328a95c01 | ||
|
|
11b3ac67b0 | ||
|
|
b8e7122452 | ||
|
|
a6bd323a0e | ||
|
|
4bec449a26 | ||
|
|
2176482e4f | ||
|
|
9c7092292b | ||
|
|
46eeb65ff0 | ||
|
|
dd79a3a78a | ||
|
|
fef9e51c9a | ||
|
|
c27589e8c2 | ||
|
|
1ace011ad2 | ||
|
|
c269a3d363 | ||
|
|
387be846f1 | ||
|
|
a788660efe | ||
|
|
73c8643218 | ||
|
|
cd7b65395f | ||
|
|
1c467d71c7 | ||
|
|
a641dfbfc8 | ||
|
|
268b188133 | ||
|
|
4692d7ef2a | ||
|
|
3b9201fb91 | ||
|
|
6e0f18b200 | ||
|
|
dfee6873da | ||
|
|
50e7311390 | ||
|
|
1c4b88d014 | ||
|
|
0935a9c193 | ||
|
|
8a99bd1d51 | ||
|
|
be1a12821e | ||
|
|
bc9bc84f23 | ||
|
|
e5bb58cd91 | ||
|
|
074b425ee0 | ||
|
|
59e599a952 | ||
|
|
3f523a8b58 | ||
|
|
b4667c92e7 | ||
|
|
2ce488c03c | ||
|
|
e1448859c9 | ||
|
|
8abd041f36 | ||
|
|
dabd4a4a4e | ||
|
|
6ac274a706 | ||
|
|
3d2b672feb | ||
|
|
e621e02f92 | ||
|
|
e3a594f3e7 | ||
|
|
5982f86db4 | ||
|
|
b071b8c2d9 | ||
|
|
185178a91e | ||
|
|
9ca31c10ae | ||
|
|
8784efd063 | ||
|
|
c828e3b0d9 | ||
|
|
45c081990a | ||
|
|
51b2dc7c23 | ||
|
|
9f54e60056 | ||
|
|
5151f50d49 | ||
|
|
9b08d67ea7 | ||
|
|
b002d687c0 | ||
|
|
1d2b697742 | ||
|
|
ac52802caa | ||
|
|
ef3ab72082 | ||
|
|
aede590af0 | ||
|
|
c229c11bdf | ||
|
|
8356860945 | ||
|
|
dd5fa3bfff | ||
|
|
7b29d43c66 | ||
|
|
8d56478187 | ||
|
|
60740973d7 | ||
|
|
453f11dcc4 | ||
|
|
a090e44403 | ||
|
|
a68effe4e7 | ||
|
|
2fb091939f | ||
|
|
71248f0adf | ||
|
|
ca80b6372b | ||
|
|
e306425428 | ||
|
|
f86a115c6a | ||
|
|
ddaadf81d6 | ||
|
|
f65af0067d | ||
|
|
5109443346 | ||
|
|
29a2c78b3f | ||
|
|
9ee661d44c | ||
|
|
ea2fa3be15 | ||
|
|
d7ec7a42ba | ||
|
|
722aed5148 | ||
|
|
17100ad56a | ||
|
|
a76032f668 | ||
|
|
d8d244541a | ||
|
|
ba5d4f2f5d | ||
|
|
dce80c4611 | ||
|
|
eae9c4d78a | ||
|
|
3f606cd953 | ||
|
|
ae581c2da7 | ||
|
|
0fbbd8dae7 | ||
|
|
f4ef5af63b | ||
|
|
3244c968b5 | ||
|
|
dd0689c13f | ||
|
|
e327a39eac | ||
|
|
e2b908ed8b | ||
|
|
aac9ee3ba7 | ||
|
|
1cd776f660 | ||
|
|
427b7492dc | ||
|
|
627e22a2e6 | ||
|
|
7bf8b74693 | ||
|
|
c7f4dc9045 | ||
|
|
f8ed70c5f2 | ||
|
|
94f34aada6 | ||
|
|
2472a52fed | ||
|
|
172915b5be | ||
|
|
ae276a2a59 | ||
|
|
ae115216f6 | ||
|
|
5691b3a8db | ||
|
|
c9815be0c7 | ||
|
|
1814407bfd | ||
|
|
40f2fa432b | ||
|
|
e10732c058 | ||
|
|
cdb00a76ce | ||
|
|
efc5f37850 | ||
|
|
ba1181e8ff | ||
|
|
6023e65f7d | ||
|
|
eff978e5f6 | ||
|
|
daf32b8ac4 | ||
|
|
5228e0f3d6 | ||
|
|
9fc47f55b8 | ||
|
|
435edd53f2 | ||
|
|
c36fb7e809 | ||
|
|
e74a418405 | ||
|
|
7814499b87 | ||
|
|
b62f4ef911 | ||
|
|
b32c2bb994 | ||
|
|
dd9e540ca3 | ||
|
|
272ba3f74e | ||
|
|
d87fc4c717 | ||
|
|
c189ad759b | ||
|
|
f3a7a9c342 | ||
|
|
51d554ab14 | ||
|
|
cb97ff0dc7 | ||
|
|
7b5a425913 | ||
|
|
44d08d6aa9 | ||
|
|
e0e1085c73 | ||
|
|
67df9dbf6b | ||
|
|
2e7dd6f212 | ||
|
|
ed2837f1db | ||
|
|
d45e9e63e6 | ||
|
|
4f0c1894a3 | ||
|
|
a3032fc62a | ||
|
|
6eeaf66e2c | ||
|
|
7f82549e23 | ||
|
|
2bb8f707eb | ||
|
|
37176aa022 | ||
|
|
ad302fb5c2 | ||
|
|
da4ec3e1b5 | ||
|
|
ebedb97fae | ||
|
|
ddd4c2ad3d | ||
|
|
007242e341 | ||
|
|
0932b38364 | ||
|
|
5c0ba566e0 | ||
|
|
67b97dbefd | ||
|
|
4d2f72a814 | ||
|
|
9d1108c2f4 | ||
|
|
cd75bb843a | ||
|
|
fb6393ad8f | ||
|
|
1ba2800a30 | ||
|
|
9d78ad70e6 | ||
|
|
98c675792e | ||
|
|
39b50d05ec | ||
|
|
a6182e2def | ||
|
|
efdb3623e1 | ||
|
|
eef6102088 | ||
|
|
9fe55cb729 | ||
|
|
13870f3ae8 | ||
|
|
ca9670e832 | ||
|
|
29494b71fa | ||
|
|
f2c3b3f165 | ||
|
|
4e402b6378 | ||
|
|
6a22fbbf78 | ||
|
|
27f2217139 | ||
|
|
038bb803db | ||
|
|
67b85e5708 | ||
|
|
a21b1f7df5 | ||
|
|
eb6e66cbf2 | ||
|
|
778fe718ed | ||
|
|
ef080cd80e | ||
|
|
22a4a1824a | ||
|
|
56163f66d8 | ||
|
|
73a7e438ec | ||
|
|
27f4e226f3 | ||
|
|
7357029a28 | ||
|
|
accfd6fa14 | ||
|
|
77dcc37b33 | ||
|
|
5df4b3e7df | ||
|
|
997141efea | ||
|
|
6fe0f56e41 | ||
|
|
8c3b7b518f | ||
|
|
6996f6516c | ||
|
|
60cc071031 | ||
|
|
fe5ab0d8da | ||
|
|
0939d032a5 | ||
|
|
d21391e8ba | ||
|
|
0651dc28c8 | ||
|
|
5b8fea9378 | ||
|
|
eda055acca | ||
|
|
7fb3918773 | ||
|
|
4e38f614f2 | ||
|
|
c7d8cb6d33 | ||
|
|
e211fb891b | ||
|
|
05f3e8f433 | ||
|
|
b6949e12b1 | ||
|
|
0772952e71 | ||
|
|
dc4d5c6953 | ||
|
|
9d45f4d534 | ||
|
|
2b8a9a74be | ||
|
|
d226af5314 | ||
|
|
be5a13fbb1 | ||
|
|
94b43021ff | ||
|
|
0b901af0f0 | ||
|
|
5ead5e9c90 | ||
|
|
1cdaa1d727 | ||
|
|
2c38bca1b5 | ||
|
|
7c45ca220b | ||
|
|
bdb2115c16 | ||
|
|
e23bf72006 | ||
|
|
7c63b78bbb | ||
|
|
b611ebcccb | ||
|
|
722d17b211 | ||
|
|
afbfb810fd | ||
|
|
1d3ae4f2c8 | ||
|
|
9bf784f64e | ||
|
|
116c0e19b2 | ||
|
|
7939187916 | ||
|
|
9d40e0903b | ||
|
|
320adad154 | ||
|
|
c52df5b286 | ||
|
|
30a25c0e8c | ||
|
|
95035afe38 | ||
|
|
62559dd2b4 | ||
|
|
a6473695eb | ||
|
|
edd60d3331 | ||
|
|
c9e4819f3f | ||
|
|
7cf321b24a | ||
|
|
3b96efc04d | ||
|
|
8a17a90b1a | ||
|
|
4da3a87772 | ||
|
|
ab9b92112d | ||
|
|
161e11a8dd | ||
|
|
967bd45a63 | ||
|
|
e1b80b513d | ||
|
|
6abe0bdaec | ||
|
|
7b5069f1b9 | ||
|
|
4429c5e8b2 | ||
|
|
5136824844 | ||
|
|
918e9ed408 | ||
|
|
8e8c97f7f9 | ||
|
|
d86fb7ed23 | ||
|
|
819db2583b | ||
|
|
089fb25da7 | ||
|
|
3d01947f3d | ||
|
|
19d94471d9 | ||
|
|
8d26f583e9 | ||
|
|
12723d4941 | ||
|
|
0455cb96ca | ||
|
|
532c5d1b9f | ||
|
|
565bb55b13 | ||
|
|
744d85ec4c | ||
|
|
5e60b96cd6 | ||
|
|
8b6f708b7c | ||
|
|
5096e2d68d | ||
|
|
b0325983a1 | ||
|
|
7cd6651895 | ||
|
|
4ec376b296 | ||
|
|
8558533a91 | ||
|
|
de4a953bb7 | ||
|
|
26a41a0672 | ||
|
|
a1d38dc05f | ||
|
|
222841f09b | ||
|
|
fce9de7372 | ||
|
|
8332b77fcc | ||
|
|
f4f1315715 | ||
|
|
5d423c9e63 | ||
|
|
895be02237 | ||
|
|
95475f7b52 | ||
|
|
c3da264cfe | ||
|
|
89c4b969d1 | ||
|
|
9dbc04678c | ||
|
|
ed9e524e03 | ||
|
|
c2d75c7030 | ||
|
|
de84419035 | ||
|
|
d9e0854bb7 | ||
|
|
558b779944 | ||
|
|
628b45efeb | ||
|
|
92cf4c16e3 | ||
|
|
3cad16d2b7 | ||
|
|
e7503c3c7a | ||
|
|
db8e643c62 | ||
|
|
a1337df44f | ||
|
|
ee73eaee5c | ||
|
|
94f3b99ad0 | ||
|
|
d0c4d5616a | ||
|
|
38f36841e3 | ||
|
|
340f3bcf8c | ||
|
|
cd1e03c033 | ||
|
|
ba002a1683 | ||
|
|
457e378d1e | ||
|
|
9781674849 | ||
|
|
d9660e66a8 | ||
|
|
25f4f3900e | ||
|
|
83e904c9f7 | ||
|
|
9bbdb1b3b9 | ||
|
|
f6cdc0575b | ||
|
|
2017bc9cf6 | ||
|
|
7e8e28fc90 | ||
|
|
30c883c85d | ||
|
|
16568c11f1 | ||
|
|
f90982347a | ||
|
|
bd5647351e | ||
|
|
ec77e47cd6 | ||
|
|
565866c529 | ||
|
|
e4a262eb7b | ||
|
|
a3f2fa1b16 | ||
|
|
e0ef3e9984 | ||
|
|
bf30c1a3d7 | ||
|
|
c2c573902f | ||
|
|
d874ebf1b0 | ||
|
|
8ef6032570 | ||
|
|
b32a6951da | ||
|
|
b7bc347323 | ||
|
|
07e49e53c5 | ||
|
|
b87db2a82b | ||
|
|
c150d559c7 | ||
|
|
5dce0db661 | ||
|
|
27514d32de | ||
|
|
fe718ef67f | ||
|
|
e132723475 | ||
|
|
72fc9db38d | ||
|
|
1374e08cd4 | ||
|
|
03e48927a3 | ||
|
|
bbf05fa6fd | ||
|
|
6dad29cae7 | ||
|
|
52afba5a86 | ||
|
|
913a53e436 | ||
|
|
4fd68a4153 | ||
|
|
fae58078f8 | ||
|
|
1d319e001c | ||
|
|
927e6fe23a | ||
|
|
b85eb98303 | ||
|
|
643f124e8b | ||
|
|
6fe4027de5 | ||
|
|
f9d79ba5a6 | ||
|
|
2382f526b2 | ||
|
|
1581e08594 | ||
|
|
37ca78913c | ||
|
|
df3b97c5dd | ||
|
|
953e3f5ba6 | ||
|
|
74b73c6446 | ||
|
|
bc80fb71df | ||
|
|
b0279025d0 | ||
|
|
a45712198b | ||
|
|
704a0fce08 | ||
|
|
d6c708e6ee | ||
|
|
1f24ca9ba2 | ||
|
|
c482db8c89 | ||
|
|
c356639ce9 | ||
|
|
8b0572add1 | ||
|
|
61b1adfb3d | ||
|
|
2f5ea4b305 | ||
|
|
ccc321be8a | ||
|
|
b68861c175 | ||
|
|
2ffcba78cc | ||
|
|
855226d01a | ||
|
|
b8e548d1df | ||
|
|
095f1df947 | ||
|
|
4bd91a811d | ||
|
|
c3b45a62ca | ||
|
|
7b354eec0f | ||
|
|
677ed371a9 | ||
|
|
987caa632b | ||
|
|
3df581152d | ||
|
|
f0ca931dfc | ||
|
|
52541f18f1 | ||
|
|
4ee200e9f6 | ||
|
|
47ef9f74a7 | ||
|
|
92478d0e4f | ||
|
|
0fc73b2bbb | ||
|
|
909c6a8bdf | ||
|
|
be387ccf35 | ||
|
|
6f73afe265 | ||
|
|
65d548d4f9 | ||
|
|
682b27fdd8 | ||
|
|
d213d65a24 | ||
|
|
36780d53c2 | ||
|
|
5a3bbd928a | ||
|
|
69854a8e0c | ||
|
|
78667ce08b | ||
|
|
0ef5749925 | ||
|
|
218104e6e2 | ||
|
|
38b7d44e3a | ||
|
|
332cb64b71 | ||
|
|
f1360d8792 | ||
|
|
269c24a398 | ||
|
|
bad427bfba | ||
|
|
4256546115 | ||
|
|
67fb2e1f59 | ||
|
|
8fab2ae8f0 | ||
|
|
2f80477f7d | ||
|
|
71bb3ccc40 | ||
|
|
4d89dbfaa3 | ||
|
|
2b9d6dc9c4 | ||
|
|
75fb18bcec | ||
|
|
44bf843797 | ||
|
|
37cedafa8f | ||
|
|
09adbf8717 | ||
|
|
56b619b777 | ||
|
|
96e7a3ad8c | ||
|
|
859665fbd0 | ||
|
|
d6f3bf112b | ||
|
|
67c02dcc40 | ||
|
|
4fccc86b03 | ||
|
|
a5d041926a | ||
|
|
c971d3fafe | ||
|
|
7c153d5e76 | ||
|
|
7071b812b6 | ||
|
|
a0a2977b7f | ||
|
|
a63cc0759f | ||
|
|
4c10eed3b1 | ||
|
|
827b3cc5f6 | ||
|
|
ac34bfdad2 | ||
|
|
72ce20224d | ||
|
|
609bd557c5 | ||
|
|
87fe3669a1 | ||
|
|
6df6fc2361 | ||
|
|
48eaab89ba | ||
|
|
a0b0fa48bb | ||
|
|
6534dbf47b | ||
|
|
f4dff676d6 | ||
|
|
77ae3aa387 | ||
|
|
99bed23b95 | ||
|
|
5b012a33c3 | ||
|
|
28f26cce72 | ||
|
|
23b091ea82 | ||
|
|
e92b5e2c05 | ||
|
|
4d60b19194 |
57
.github/CONTRIBUTING.md
vendored
Normal file
@@ -0,0 +1,57 @@
|
||||
# Contributing
|
||||
|
||||
Before you start working on a PR, contact us via IRC in #froxlor on Freenode or
|
||||
the forum at https://forum.froxlor.org to get a clue whether someone else isn't
|
||||
already working on it or if we don not want/need this certain change.
|
||||
Of course, bugfixes are always welcome.
|
||||
However, at this stage of the 0.9.x branch, we are not looking for new
|
||||
features or refactoring, especially not the kind which requires changes to a
|
||||
lot of files.
|
||||
Please focus on our API based version 0.10.x (current master).
|
||||
|
||||
|
||||
|
||||
|
||||
## Checklist
|
||||
|
||||
General rules for PRs are:
|
||||
* Please save us all some trouble and unnecessary round-trips by _testing_ your
|
||||
changes.
|
||||
|
||||
* Re-write your commit history to provide a CLEAN history!
|
||||
|
||||
* i.e. do not provide PRs which contain a commit that changes something,
|
||||
the next changes it back, a third one changes it again, only a little
|
||||
differently...
|
||||
|
||||
|
||||
Thanks!
|
||||
|
||||
|
||||
|
||||
|
||||
### Webserver changes
|
||||
If you make changes to the functionality of webserver configuration, please
|
||||
make sure your implementation covers all supported webservers.
|
||||
|
||||
|
||||
|
||||
|
||||
### l10n
|
||||
|
||||
If you add new language strings, please make sure you add the english fallback
|
||||
strings in
|
||||
|
||||
* `lng/english.lng.php`
|
||||
* `install/lng/english.lng.php` (if applicable)
|
||||
|
||||
|
||||
|
||||
|
||||
### New settings and database-layout changnes
|
||||
If you add new settings or layout changes, please make sure you add these to
|
||||
|
||||
* `install/froxlor.sql`
|
||||
* and handle the update (see `install/updates/froxlor/0.10/update_0.10.inc.php`)
|
||||
* if you have any question on how update-process works, please contact us
|
||||
|
||||
64
.github/ISSUE_TEMPLATE.md
vendored
Normal file
@@ -0,0 +1,64 @@
|
||||
# Bug report vs. support request
|
||||
If you're unsure of whether your problem is a bug or a configuration error
|
||||
* contact us via IRC in #froxlor on freenode
|
||||
* or post a thread in our forum at https://forum.froxlor.org
|
||||
|
||||
As a rule of thumb: before reporting an issue
|
||||
* see if it hasn't been [reported](https://github.com/Froxlor/froxlor/issues) (and possibly already been [fixed](https://github.com/Froxlor/froxlor/issues?utf8=✓&q=is:issue%20is:closed)) first
|
||||
* try with the git master
|
||||
|
||||
|
||||
|
||||
|
||||
|
||||
# Summary
|
||||
|
||||
Please provide a concise summary of the problem you're experiencing...
|
||||
|
||||
|
||||
|
||||
|
||||
# System information
|
||||
* Froxlor version: $version/$gitSHA1
|
||||
* Web server: apache2/nginx/lighttpd
|
||||
* DNS server: Bind/PowerDNS (standalone)/PowerDNS (Bind-backend)
|
||||
* POP/IMAP server: Courier/Dovecot
|
||||
* SMTP server: postfix/exim
|
||||
* FTP server: proftpd/pureftpd
|
||||
* OS/Version: ...
|
||||
|
||||
|
||||
|
||||
|
||||
# Steps to reproduce
|
||||
|
||||
1.
|
||||
2.
|
||||
3.
|
||||
|
||||
|
||||
|
||||
|
||||
# Expected behavior
|
||||
|
||||
1.
|
||||
2.
|
||||
3.
|
||||
|
||||
|
||||
|
||||
|
||||
# Actual behavior
|
||||
|
||||
1.
|
||||
2.
|
||||
3.
|
||||
|
||||
|
||||
|
||||
|
||||
# Log files/log entries
|
||||
syslog:
|
||||
<pre>
|
||||
example
|
||||
</pre>
|
||||
38
.github/PULL_REQUEST_TEMPLATE.md
vendored
Normal file
@@ -0,0 +1,38 @@
|
||||
# Description
|
||||
|
||||
Please include a summary of the change and which issue is fixed if any. Please also include relevant motivation and context. List any dependencies that are required for this change.
|
||||
|
||||
Fixes # (issue)
|
||||
|
||||
## Type of change
|
||||
|
||||
Please delete options that are not relevant.
|
||||
|
||||
- [ ] Bug fix (non-breaking change which fixes an issue)
|
||||
- [ ] New feature (non-breaking change which adds functionality)
|
||||
- [ ] Breaking change (fix or feature that would cause existing functionality to not work as expected)
|
||||
- [ ] This change requires a documentation update
|
||||
|
||||
# How Has This Been Tested?
|
||||
|
||||
Please describe the tests that you ran to verify your changes. Provide instructions so we can reproduce. Please also list any relevant details for your test configuration
|
||||
|
||||
- [ ] Test A
|
||||
- [ ] Test B
|
||||
|
||||
**Test Configuration**:
|
||||
|
||||
* Distribution:
|
||||
* Webserver:
|
||||
* PHP:
|
||||
* etc.etc.:
|
||||
|
||||
# Checklist:
|
||||
|
||||
- [ ] I have performed a self-review of my own code
|
||||
- [ ] I have commented my code, particularly in hard-to-understand areas
|
||||
- [ ] I have made corresponding changes to the documentation
|
||||
- [ ] My changes generate no new warnings
|
||||
- [ ] I have added tests that prove my fix is effective or that my feature works
|
||||
- [ ] New and existing unit tests pass locally with my changes
|
||||
|
||||
15
.gitignore
vendored
@@ -1,8 +1,19 @@
|
||||
templates/*
|
||||
logs/*
|
||||
install/update.log
|
||||
templates/*
|
||||
lib/userdata.inc.php
|
||||
logs/*
|
||||
!logs/index.html
|
||||
.buildpath
|
||||
.project
|
||||
.settings/
|
||||
*.diff
|
||||
*~
|
||||
.well-known
|
||||
.idea
|
||||
*.iml
|
||||
|
||||
!templates/Froxlor/
|
||||
!templates/Sparkle/
|
||||
!templates/misc/
|
||||
templates/Froxlor/assets/img/logo_custom.png
|
||||
vendor/
|
||||
|
||||
60
.travis.yml
Normal file
@@ -0,0 +1,60 @@
|
||||
language: php
|
||||
|
||||
php:
|
||||
# - "5.4"
|
||||
# - "5.6"
|
||||
# - "7.0"
|
||||
- "7.1"
|
||||
# - "7.2"
|
||||
|
||||
branches:
|
||||
only:
|
||||
- master
|
||||
- namespaces
|
||||
|
||||
matrix:
|
||||
include:
|
||||
# - php: 5.6
|
||||
# env: deps=highest
|
||||
# - php: 5.4
|
||||
# env: deps=lowest
|
||||
- php: 7.1
|
||||
env: deps=highest
|
||||
|
||||
mysql:
|
||||
database: froxlor010
|
||||
username: root
|
||||
encoding: utf8
|
||||
|
||||
addons:
|
||||
apt:
|
||||
update: true
|
||||
|
||||
# build.xml includes that
|
||||
#install:
|
||||
# - composer install
|
||||
|
||||
service:
|
||||
- mysql
|
||||
|
||||
before_script:
|
||||
- mysql -e 'CREATE DATABASE IF NOT EXISTS froxlor010'
|
||||
- echo "USE mysql;\nUPDATE user SET password=PASSWORD('fr0xl0r.TravisCI') WHERE user='root';\nFLUSH PRIVILEGES;\n" | mysql -u root
|
||||
- mysql -u root -pfr0xl0r.TravisCI froxlor010 < install/froxlor.sql
|
||||
- mysql -u root -pfr0xl0r.TravisCI -e "CREATE USER 'froxlor010'@'localhost' IDENTIFIED BY 'fr0xl0r.TravisCI';"
|
||||
- mysql -u root -pfr0xl0r.TravisCI -e "GRANT ALL ON froxlor010.* TO 'froxlor010'@'localhost';"
|
||||
|
||||
script:
|
||||
# sufficient for travis
|
||||
- ant phpunit-no-coverage
|
||||
# - ant full-build-parallel
|
||||
# -Dpdepend=$(pwd)/vendor/bin/pdepend
|
||||
# -Dphpmd=$(pwd)/vendor/bin/phpmd
|
||||
# -Dphpcpd=$(pwd)/vendor/bin/phpcpd
|
||||
# -Dphpcs=$(pwd)/vendor/bin/phpcs
|
||||
# -Dphploc=$(pwd)/vendor/bin/phploc
|
||||
# -Dphpdox=$(pwd)/vendor/bin/phpdox
|
||||
# -Dphpunit=$(pwd)/vendor/bin/phpunit
|
||||
|
||||
notifications:
|
||||
irc: "irc.freenode.org#froxlor"
|
||||
90
2fa.php
Normal file
@@ -0,0 +1,90 @@
|
||||
<?php
|
||||
if (! defined('AREA')) {
|
||||
header("Location: index.php");
|
||||
exit();
|
||||
}
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
|
||||
if (Settings::Get('2fa.enabled') != '1') {
|
||||
\Froxlor\UI\Response::dynamic_error("2FA not activated");
|
||||
}
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2018 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2018-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
* @since 0.10.0
|
||||
*
|
||||
*/
|
||||
|
||||
// This file is being included in admin_index and customer_index
|
||||
// and therefore does not need to require lib/init.php
|
||||
if (AREA == 'admin') {
|
||||
$upd_stmt = Database::prepare("UPDATE `" . TABLE_PANEL_ADMINS . "` SET `type_2fa` = :t2fa, `data_2fa` = :d2fa WHERE adminid = :id");
|
||||
$uid = $userinfo['adminid'];
|
||||
} elseif (AREA == 'customer') {
|
||||
$upd_stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `type_2fa` = :t2fa, `data_2fa` = :d2fa WHERE customerid = :id");
|
||||
$uid = $userinfo['customerid'];
|
||||
}
|
||||
$success_message = "";
|
||||
|
||||
$tfa = new \Froxlor\FroxlorTwoFactorAuth('Froxlor');
|
||||
|
||||
// do the delete and then just show a success-message
|
||||
if ($action == 'delete') {
|
||||
Database::pexecute($upd_stmt, array(
|
||||
't2fa' => 0,
|
||||
'd2fa' => "",
|
||||
'id' => $uid
|
||||
));
|
||||
\Froxlor\UI\Response::standard_success($lng['2fa']['2fa_removed']);
|
||||
} elseif ($action == 'add') {
|
||||
$type = isset($_POST['type_2fa']) ? $_POST['type_2fa'] : '0';
|
||||
|
||||
if ($type == 0 || $type == 1) {
|
||||
$data = "";
|
||||
}
|
||||
if ($type == 2) {
|
||||
// generate secret for TOTP
|
||||
$data = $tfa->createSecret();
|
||||
}
|
||||
Database::pexecute($upd_stmt, array(
|
||||
't2fa' => $type,
|
||||
'd2fa' => $data,
|
||||
'id' => $uid
|
||||
));
|
||||
\Froxlor\UI\Response::standard_success(sprintf($lng['2fa']['2fa_added'], $filename, $s));
|
||||
}
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed 2fa::overview");
|
||||
|
||||
if ($userinfo['type_2fa'] == '0') {
|
||||
|
||||
// available types
|
||||
$type_select_values = array(
|
||||
0 => '-',
|
||||
1 => 'E-Mail',
|
||||
2 => 'Authenticator'
|
||||
);
|
||||
asort($type_select_values);
|
||||
$type_select = "";
|
||||
foreach ($type_select_values as $_val => $_type) {
|
||||
$type_select .= \Froxlor\UI\HTML::makeoption($_type, $_val);
|
||||
}
|
||||
} elseif ($userinfo['type_2fa'] == '1') {
|
||||
// email 2fa enabled
|
||||
} elseif ($userinfo['type_2fa'] == '2') {
|
||||
// authenticator 2fa enabled
|
||||
$ga_qrcode = $tfa->getQRCodeImageAsDataUri($userinfo['loginname'], $userinfo['data_2fa']);
|
||||
}
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("2fa/overview", true) . "\";");
|
||||
26
README.md
@@ -1,3 +1,5 @@
|
||||
[](https://travis-ci.com/Froxlor/Froxlor)
|
||||
|
||||
# Froxlor
|
||||
|
||||
The server administration software for your needs.
|
||||
@@ -11,13 +13,13 @@ Developed by experienced server administrators, this panel simplifies the effort
|
||||
3. Point your browser to http://[ip-of-webserver]/froxlor
|
||||
4. Follow the installer
|
||||
5. Login as administrator
|
||||
6. Adjust "Server > Settings" according to your needs
|
||||
7. Choose your distribution under "Server > Configuration"
|
||||
6. Adjust "System > Settings" according to your needs
|
||||
7. Choose your distribution under "System > Configuration"
|
||||
8. Follow the steps for your services
|
||||
9. Have fun!
|
||||
|
||||
### Detailed installation
|
||||
http://redmine.froxlor.org/projects/froxlor/wiki/Installationtarball
|
||||
https://github.com/Froxlor/Froxlor/wiki/Install-froxlor-from-tarball
|
||||
|
||||
## Help
|
||||
|
||||
@@ -30,12 +32,12 @@ irc://chat.freenode.net/froxlor
|
||||
|
||||
### Forum
|
||||
|
||||
The community is located on http://forum.froxlor.org
|
||||
The community is located on https://forum.froxlor.org/
|
||||
|
||||
### Wiki
|
||||
|
||||
More documentation may be found in the froxlor - wiki:
|
||||
http://redmine.froxlor.org/projects/froxlor/wiki
|
||||
https://github.com/Froxlor/Froxlor/wiki
|
||||
|
||||
## License
|
||||
|
||||
@@ -44,17 +46,21 @@ May be found in COPYING
|
||||
## Downloads
|
||||
|
||||
### Tarball
|
||||
http://files.froxlor.org/releases/froxlor-latest.tar.gz [MD5](http://files.froxlor.org/releases/froxlor-latest.tar.gz.md5) [SHA1](http://files.froxlor.org/releases/froxlor-latest.tar.gz.sha1)
|
||||
https://files.froxlor.org/releases/froxlor-latest.tar.gz [MD5](https://files.froxlor.org/releases/froxlor-latest.tar.gz.md5) [SHA1](https://files.froxlor.org/releases/froxlor-latest.tar.gz.sha1)
|
||||
|
||||
### Debian repository
|
||||
|
||||
[HowTo](http://redmine.froxlor.org/projects/froxlor/wiki/Installationdebian)
|
||||
[HowTo](https://github.com/Froxlor/Froxlor/wiki/Install-froxlor-on-debian)
|
||||
|
||||
/etc/apt/sources.list.d/froxlor.list
|
||||
> deb http://debian.froxlor.org [squeeze|wheezy] main
|
||||
> deb http://debian.froxlor.org {wheezy|jessie|stretch} main
|
||||
|
||||
### Gentoo repository
|
||||
|
||||
[HowTo](http://redmine.froxlor.org/projects/froxlor/wiki/Installationgentoo)
|
||||
[HowTo](https://github.com/Froxlor/Froxlor/wiki/Install-froxlor-on-gentoo)
|
||||
|
||||
http://files.froxlor.org/gentoo/repositories.xml
|
||||
https://files.froxlor.org/gentoo/repositories.xml
|
||||
|
||||
## Contributing
|
||||
|
||||
[see here](.github/CONTRIBUTING.md)
|
||||
|
||||
@@ -1,72 +0,0 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2003-2009 the SysCP Team (see authors).
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'version' => array(
|
||||
'fields' => array(
|
||||
'panel_version' => array(
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'version',
|
||||
'type' => 'hidden',
|
||||
'default' => '',
|
||||
),
|
||||
'panel_frontend' => array(
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'frontend',
|
||||
'type' => 'hidden',
|
||||
'default' => '',
|
||||
),
|
||||
'system_last_tasks_run' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'last_tasks_run',
|
||||
'type' => 'hidden',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'system_last_traffic_run' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'last_traffic_run',
|
||||
'type' => 'hidden',
|
||||
'default' => '',
|
||||
),
|
||||
'system_lastcronrun' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'lastcronrun',
|
||||
'type' => 'hidden',
|
||||
'default' => '',
|
||||
),
|
||||
'system_lastguid' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'lastguid',
|
||||
'type' => 'hidden',
|
||||
'default' => 9999,
|
||||
),
|
||||
'system_lastaccountnumber' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'lastaccountnumber',
|
||||
'type' => 'hidden',
|
||||
'default' => 0,
|
||||
),
|
||||
),
|
||||
),
|
||||
),
|
||||
);
|
||||
|
||||
?>
|
||||
@@ -16,31 +16,42 @@
|
||||
* @package Language
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'panel' => array(
|
||||
'title' => $lng['admin']['panelsettings'],
|
||||
'fields' => array(
|
||||
'panel_standardlanguage' => array(
|
||||
'label' => array('title' => $lng['login']['language'], 'description' => $lng['serversettings']['language']['description']),
|
||||
'label' => array(
|
||||
'title' => $lng['login']['language'],
|
||||
'description' => $lng['serversettings']['language']['description']
|
||||
),
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'standardlanguage',
|
||||
'type' => 'option',
|
||||
'default' => 'English',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getLanguages',
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\User',
|
||||
'getLanguages'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_default_theme' => array(
|
||||
'label' => array('title' => $lng['panel']['theme'], 'description' => $lng['serversettings']['default_theme']),
|
||||
'label' => array(
|
||||
'title' => $lng['panel']['theme'],
|
||||
'description' => $lng['serversettings']['default_theme']
|
||||
),
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'default_theme',
|
||||
'type' => 'option',
|
||||
'default' => 'Froxlor',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getThemes',
|
||||
'save_method' => 'storeSettingDefaultTheme',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\UI\\Template',
|
||||
'getThemes'
|
||||
),
|
||||
'save_method' => 'storeSettingDefaultTheme'
|
||||
),
|
||||
'panel_allow_theme_change_customer' => array(
|
||||
'label' => $lng['serversettings']['panel_allow_theme_change_customer'],
|
||||
@@ -48,7 +59,7 @@ return array(
|
||||
'varname' => 'allow_theme_change_customer',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_allow_theme_change_admin' => array(
|
||||
'label' => $lng['serversettings']['panel_allow_theme_change_admin'],
|
||||
@@ -64,15 +75,15 @@ return array(
|
||||
'varname' => 'natsorting',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_no_robots' => array(
|
||||
'label' => $lng['serversettings']['no_robots'],
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'no_robots',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_paging' => array(
|
||||
'label' => $lng['serversettings']['paging'],
|
||||
@@ -81,7 +92,7 @@ return array(
|
||||
'type' => 'int',
|
||||
'int_min' => 0,
|
||||
'default' => 0,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_pathedit' => array(
|
||||
'label' => $lng['serversettings']['pathedit'],
|
||||
@@ -90,8 +101,11 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 'Manual',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array('Manual' => $lng['serversettings']['manual'], 'Dropdown' => $lng['serversettings']['dropdown']),
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options' => array(
|
||||
'Manual' => $lng['serversettings']['manual'],
|
||||
'Dropdown' => $lng['serversettings']['dropdown']
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_adminmail' => array(
|
||||
'label' => $lng['serversettings']['adminmail'],
|
||||
@@ -101,7 +115,7 @@ return array(
|
||||
'string_type' => 'mail',
|
||||
'string_emptyallowed' => false,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_adminmail_defname' => array(
|
||||
'label' => $lng['serversettings']['adminmail_defname'],
|
||||
@@ -109,7 +123,7 @@ return array(
|
||||
'varname' => 'adminmail_defname',
|
||||
'type' => 'string',
|
||||
'default' => 'Froxlor Administrator',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_adminmail_return' => array(
|
||||
'label' => $lng['serversettings']['adminmail_return'],
|
||||
@@ -119,7 +133,7 @@ return array(
|
||||
'string_type' => 'mail',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_decimal_places' => array(
|
||||
'label' => $lng['serversettings']['decimal_places'],
|
||||
@@ -129,7 +143,7 @@ return array(
|
||||
'int_min' => 0,
|
||||
'int_max' => 15,
|
||||
'default' => 4,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_phpmyadmin_url' => array(
|
||||
'label' => $lng['serversettings']['phpmyadmin_url'],
|
||||
@@ -139,7 +153,7 @@ return array(
|
||||
'string_type' => 'url',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_webmail_url' => array(
|
||||
'label' => $lng['serversettings']['webmail_url'],
|
||||
@@ -149,7 +163,7 @@ return array(
|
||||
'string_type' => 'url',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_webftp_url' => array(
|
||||
'label' => $lng['serversettings']['webftp_url'],
|
||||
@@ -159,7 +173,7 @@ return array(
|
||||
'string_type' => 'url',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'admin_show_version_login' => array(
|
||||
'label' => $lng['admin']['show_version_login'],
|
||||
@@ -167,7 +181,7 @@ return array(
|
||||
'varname' => 'show_version_login',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'admin_show_version_footer' => array(
|
||||
'label' => $lng['admin']['show_version_footer'],
|
||||
@@ -175,23 +189,23 @@ return array(
|
||||
'varname' => 'show_version_footer',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'admin_show_news_feed' => array(
|
||||
'label' => $lng['admin']['show_news_feed'],
|
||||
'settinggroup' => 'admin',
|
||||
'varname' => 'show_news_feed',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'customer_show_news_feed' => array(
|
||||
'label' => $lng['admin']['customer_show_news_feed'],
|
||||
'settinggroup' => 'customer',
|
||||
'varname' => 'show_news_feed',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'customer_news_feed_url' => array(
|
||||
'label' => $lng['admin']['customer_news_feed_url'],
|
||||
@@ -201,7 +215,7 @@ return array(
|
||||
'string_type' => 'url',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_allow_domain_change_admin' => array(
|
||||
'label' => $lng['serversettings']['panel_allow_domain_change_admin'],
|
||||
@@ -209,7 +223,7 @@ return array(
|
||||
'varname' => 'allow_domain_change_admin',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_allow_domain_change_customer' => array(
|
||||
'label' => $lng['serversettings']['panel_allow_domain_change_customer'],
|
||||
@@ -217,7 +231,7 @@ return array(
|
||||
'varname' => 'allow_domain_change_customer',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_phpconfigs_hidestdsubdomain' => array(
|
||||
'label' => $lng['serversettings']['panel_phpconfigs_hidestdsubdomain'],
|
||||
@@ -225,11 +239,36 @@ return array(
|
||||
'varname' => 'phpconfigs_hidestdsubdomain',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_customer_hide_options' => array(
|
||||
'label' => $lng['serversettings']['panel_customer_hide_options'],
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'customer_hide_options',
|
||||
'type' => 'option',
|
||||
'default' => '',
|
||||
'option_mode' => 'multiple',
|
||||
'option_emptyallowed' => true,
|
||||
'option_options' => array(
|
||||
'email' => $lng['menue']['email']['email'],
|
||||
'mysql' => $lng['menue']['mysql']['mysql'],
|
||||
'domains' => $lng['menue']['domains']['domains'],
|
||||
'ftp' => $lng['menue']['ftp']['ftp'],
|
||||
'extras' => $lng['menue']['extras']['extras'],
|
||||
'extras.directoryprotection' => $lng['menue']['extras']['extras'] . " / " . $lng['menue']['extras']['directoryprotection'],
|
||||
'extras.pathoptions' => $lng['menue']['extras']['extras'] . " / " . $lng['menue']['extras']['pathoptions'],
|
||||
'extras.logger' => $lng['menue']['extras']['extras'] . " / " . $lng['menue']['logger']['logger'],
|
||||
'extras.backup' => $lng['menue']['extras']['extras'] . " / " . $lng['menue']['extras']['backup'],
|
||||
'traffic' => $lng['menue']['traffic']['traffic'],
|
||||
'traffic.http' => $lng['menue']['traffic']['traffic'] . " / HTTP",
|
||||
'traffic.ftp' => $lng['menue']['traffic']['traffic'] . " / FTP",
|
||||
'traffic.mail' => $lng['menue']['traffic']['traffic'] . " / Mail"
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'accounts' => array(
|
||||
@@ -28,7 +27,7 @@ return array(
|
||||
'varname' => 'sessiontimeout',
|
||||
'type' => 'int',
|
||||
'default' => 600,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'session_allow_multiple_login' => array(
|
||||
'label' => $lng['serversettings']['session_allow_multiple_login'],
|
||||
@@ -36,7 +35,7 @@ return array(
|
||||
'varname' => 'allow_multiple_login',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'login_domain_login' => array(
|
||||
'label' => $lng['serversettings']['login_domain_login'],
|
||||
@@ -44,7 +43,7 @@ return array(
|
||||
'varname' => 'domain_login',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'login_maxloginattempts' => array(
|
||||
'label' => $lng['serversettings']['maxloginattempts'],
|
||||
@@ -52,7 +51,7 @@ return array(
|
||||
'varname' => 'maxloginattempts',
|
||||
'type' => 'int',
|
||||
'default' => 3,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'login_deactivatetime' => array(
|
||||
'label' => $lng['serversettings']['deactivatetime'],
|
||||
@@ -60,7 +59,15 @@ return array(
|
||||
'varname' => 'deactivatetime',
|
||||
'type' => 'int',
|
||||
'default' => 900,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'2fa_enabled' => array(
|
||||
'label' => $lng['2fa']['2fa_enabled'],
|
||||
'settinggroup' => '2fa',
|
||||
'varname' => 'enabled',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_password_min_length' => array(
|
||||
'label' => $lng['serversettings']['panel_password_min_length'],
|
||||
@@ -68,7 +75,7 @@ return array(
|
||||
'varname' => 'password_min_length',
|
||||
'type' => 'int',
|
||||
'default' => 0,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_password_alpha_lower' => array(
|
||||
'label' => $lng['serversettings']['panel_password_alpha_lower'],
|
||||
@@ -76,7 +83,7 @@ return array(
|
||||
'varname' => 'password_alpha_lower',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_password_alpha_upper' => array(
|
||||
'label' => $lng['serversettings']['panel_password_alpha_upper'],
|
||||
@@ -84,7 +91,7 @@ return array(
|
||||
'varname' => 'password_alpha_upper',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_password_numeric' => array(
|
||||
'label' => $lng['serversettings']['panel_password_numeric'],
|
||||
@@ -92,7 +99,7 @@ return array(
|
||||
'varname' => 'password_numeric',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_password_special_char_required' => array(
|
||||
'label' => $lng['serversettings']['panel_password_special_char_required'],
|
||||
@@ -100,15 +107,15 @@ return array(
|
||||
'varname' => 'password_special_char_required',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_password_special_char' => array(
|
||||
'label' => $lng['serversettings']['panel_password_special_char'],
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'password_special_char',
|
||||
'type' => 'string',
|
||||
'default' => '!?<>§$%&+#=@',
|
||||
'save_method' => 'storeSettingField',
|
||||
'default' => '!?<>§$%+#=@',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_password_regex' => array(
|
||||
'label' => $lng['serversettings']['panel_password_regex'],
|
||||
@@ -116,8 +123,7 @@ return array(
|
||||
'varname' => 'password_regex',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
/* 'plausibility_check_method' => 'checkValidRegEx', */
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'customer_accountprefix' => array(
|
||||
'label' => $lng['serversettings']['accountprefix'],
|
||||
@@ -125,8 +131,11 @@ return array(
|
||||
'varname' => 'accountprefix',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'plausibility_check_method' => 'checkUsername',
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkUsername'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'customer_mysqlprefix' => array(
|
||||
'label' => $lng['serversettings']['mysqlprefix'],
|
||||
@@ -134,8 +143,11 @@ return array(
|
||||
'varname' => 'mysqlprefix',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'plausibility_check_method' => 'checkUsername',
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkUsername'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'customer_ftpprefix' => array(
|
||||
'label' => $lng['serversettings']['ftpprefix'],
|
||||
@@ -143,7 +155,7 @@ return array(
|
||||
'varname' => 'ftpprefix',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'customer_ftpatdomain' => array(
|
||||
'label' => $lng['serversettings']['ftpdomain'],
|
||||
@@ -151,7 +163,7 @@ return array(
|
||||
'varname' => 'ftpatdomain',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_allow_preset' => array(
|
||||
'label' => $lng['serversettings']['allow_password_reset'],
|
||||
@@ -164,7 +176,7 @@ return array(
|
||||
'fieldname' => 'panel_allow_preset_admin',
|
||||
'fielddata' => array(
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'allow_preset_admin',
|
||||
'varname' => 'allow_preset_admin'
|
||||
),
|
||||
'onlyif' => 0
|
||||
)
|
||||
@@ -180,14 +192,22 @@ return array(
|
||||
'fieldname' => 'panel_allow_preset',
|
||||
'fielddata' => array(
|
||||
'settinggroup' => 'panel',
|
||||
'varname' => 'allow_preset',
|
||||
'varname' => 'allow_preset'
|
||||
),
|
||||
'onlyif' => 1
|
||||
)
|
||||
),
|
||||
),
|
||||
),
|
||||
),
|
||||
'system_backupenabled' => array(
|
||||
'label' => $lng['serversettings']['backupenabled'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'backupenabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'cronmodule' => 'froxlor/backup',
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'system' => array(
|
||||
@@ -30,7 +29,10 @@ return array(
|
||||
'string_type' => 'dir',
|
||||
'default' => '/var/customers/webs/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => 'checkPathConflicts'
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkPathConflicts'
|
||||
)
|
||||
),
|
||||
'system_documentroot_use_default_value' => array(
|
||||
'label' => $lng['serversettings']['documentroot_use_default_value'],
|
||||
@@ -38,7 +40,7 @@ return array(
|
||||
'varname' => 'documentroot_use_default_value',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_ipaddress' => array(
|
||||
'label' => $lng['serversettings']['ipaddress'],
|
||||
@@ -46,19 +48,38 @@ return array(
|
||||
'varname' => 'ipaddress',
|
||||
'type' => 'option',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getIpAddresses',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\Domain\\IpAddr',
|
||||
'getIpAddresses'
|
||||
),
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingIpAddress',
|
||||
'save_method' => 'storeSettingIpAddress'
|
||||
),
|
||||
'system_defaultip' => array(
|
||||
'label' => $lng['serversettings']['defaultip'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'defaultip',
|
||||
'type' => 'option',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getIpPortCombinations',
|
||||
'option_mode' => 'multiple',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\Domain\\IpAddr',
|
||||
'getIpPortCombinations'
|
||||
),
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingDefaultIp',
|
||||
'save_method' => 'storeSettingDefaultIp'
|
||||
),
|
||||
'system_defaultsslip' => array(
|
||||
'label' => $lng['serversettings']['defaultsslip'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'defaultsslip',
|
||||
'type' => 'option',
|
||||
'option_mode' => 'multiple',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\Domain\\IpAddr',
|
||||
'getSslIpPortCombinations'
|
||||
),
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingDefaultSslIp'
|
||||
),
|
||||
'system_hostname' => array(
|
||||
'label' => $lng['serversettings']['hostname'],
|
||||
@@ -67,15 +88,18 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingHostname',
|
||||
'plausibility_check_method' => 'checkHostname',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkHostname'
|
||||
)
|
||||
),
|
||||
'system_froxlordirectlyviahostname' => array(
|
||||
'label' => $lng['serversettings']['froxlordirectlyviahostname'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'froxlordirectlyviahostname',
|
||||
'api_enabled' => array(
|
||||
'label' => $lng['serversettings']['enable_api'],
|
||||
'settinggroup' => 'api',
|
||||
'varname' => 'enabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_validatedomain' => array(
|
||||
'label' => $lng['serversettings']['validate_domain'],
|
||||
@@ -83,7 +107,7 @@ return array(
|
||||
'varname' => 'validate_domain',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_stdsubdomain' => array(
|
||||
'label' => $lng['serversettings']['stdsubdomainhost'],
|
||||
@@ -91,7 +115,7 @@ return array(
|
||||
'varname' => 'stdsubdomain',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingHostname',
|
||||
'save_method' => 'storeSettingHostname'
|
||||
),
|
||||
'system_mysql_access_host' => array(
|
||||
'label' => $lng['serversettings']['mysql_access_host'],
|
||||
@@ -99,8 +123,19 @@ return array(
|
||||
'varname' => 'mysql_access_host',
|
||||
'type' => 'string',
|
||||
'default' => '127.0.0.1,localhost',
|
||||
'plausibility_check_method' => 'checkMysqlAccessHost',
|
||||
'save_method' => 'storeSettingMysqlAccessHost',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkMysqlAccessHost'
|
||||
),
|
||||
'save_method' => 'storeSettingMysqlAccessHost'
|
||||
),
|
||||
'system_nssextrausers' => array(
|
||||
'label' => $lng['serversettings']['nssextrausers'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'nssextrausers',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_index_file_extension' => array(
|
||||
'label' => $lng['serversettings']['index_file_extension'],
|
||||
@@ -109,7 +144,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_regexp' => '/^[a-zA-Z0-9]{1,6}$/',
|
||||
'default' => 'html',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_store_index_file_subs' => array(
|
||||
'label' => $lng['serversettings']['system_store_index_file_subs'],
|
||||
@@ -117,19 +152,19 @@ return array(
|
||||
'varname' => 'store_index_file_subs',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_httpuser' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'httpuser',
|
||||
'type' => 'hidden',
|
||||
'default' => 'www-data',
|
||||
'default' => 'www-data'
|
||||
),
|
||||
'system_httpgroup' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'httpgroup',
|
||||
'type' => 'hidden',
|
||||
'default' => 'www-data',
|
||||
'default' => 'www-data'
|
||||
),
|
||||
'system_report_enable' => array(
|
||||
'label' => $lng['serversettings']['report']['report'],
|
||||
@@ -138,29 +173,88 @@ return array(
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'cronmodule' => 'froxlor/reports',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_report_webmax' => array(
|
||||
'label' => $lng['serversettings']['report']['webmax'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'report_webmax',
|
||||
'type' => 'int',
|
||||
'int_min' => 1,
|
||||
'int_min' => 0,
|
||||
'int_max' => 150,
|
||||
'default' => 90,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_report_trafficmax' => array(
|
||||
'label' => $lng['serversettings']['report']['trafficmax'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'report_trafficmax',
|
||||
'type' => 'int',
|
||||
'int_min' => 1,
|
||||
'int_min' => 0,
|
||||
'int_max' => 150,
|
||||
'default' => 90,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
|
||||
'system_mail_use_smtp' => array(
|
||||
'label' => $lng['serversettings']['mail_use_smtp'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mail_use_smtp',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_smtp_host' => array(
|
||||
'label' => $lng['serversettings']['mail_smtp_host'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mail_smtp_host',
|
||||
'type' => 'string',
|
||||
'default' => 'localhost',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_smtp_port' => array(
|
||||
'label' => $lng['serversettings']['mail_smtp_port'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mail_smtp_port',
|
||||
'type' => 'int',
|
||||
'int_min' => 1,
|
||||
'int_max' => 65535,
|
||||
'default' => 25,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_smtp_usetls' => array(
|
||||
'label' => $lng['serversettings']['mail_smtp_usetls'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mail_smtp_usetls',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_smtp_auth' => array(
|
||||
'label' => $lng['serversettings']['mail_smtp_auth'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mail_smtp_auth',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_smtp_user' => array(
|
||||
'label' => $lng['serversettings']['mail_smtp_user'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mail_smtp_user',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_smtp_passwd' => array(
|
||||
'label' => $lng['serversettings']['mail_smtp_passwd'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mail_smtp_passwd',
|
||||
'type' => 'hiddenString',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
247
actions/admin/settings/122.froxlorvhost.php
Normal file
@@ -0,0 +1,247 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2016 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2016-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package \Froxlor\Settings
|
||||
*
|
||||
*/
|
||||
return array(
|
||||
'groups' => array(
|
||||
'froxlorvhost' => array(
|
||||
'title' => $lng['admin']['froxlorvhost'] . (call_user_func(array('\Froxlor\Settings\FroxlorVhostSettings', 'hasVhostContainerEnabled')) == false ? $lng['admin']['novhostcontainer'] : ''),
|
||||
'fields' => array(
|
||||
/**
|
||||
* Webserver-Vhost
|
||||
*/
|
||||
'system_froxlordirectlyviahostname' => array(
|
||||
'label' => $lng['serversettings']['froxlordirectlyviahostname'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'froxlordirectlyviahostname',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_froxloraliases' => array(
|
||||
'label' => $lng['serversettings']['froxloraliases'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'froxloraliases',
|
||||
'type' => 'string',
|
||||
'string_regexp' => '/^(([a-z0-9\-\._]+, ?)*[a-z0-9\-\._]+)?$/i',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
/**
|
||||
* SSL / Let's Encrypt
|
||||
*/
|
||||
'system_le_froxlor_enabled' => array(
|
||||
'label' => $lng['serversettings']['le_froxlor_enabled'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'le_froxlor_enabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingClearCertificates',
|
||||
'visible' => \Froxlor\Settings::Get('system.leenabled') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
), true)
|
||||
),
|
||||
'system_le_froxlor_redirect' => array(
|
||||
'label' => $lng['serversettings']['le_froxlor_redirect'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'le_froxlor_redirect',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
), true)
|
||||
),
|
||||
'system_hsts_maxage' => array(
|
||||
'label' => $lng['admin']['domain_hsts_maxage'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'hsts_maxage',
|
||||
'type' => 'int',
|
||||
'int_min' => 0,
|
||||
'int_max' => 94608000, // 3-years
|
||||
'default' => 0,
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
), true)
|
||||
),
|
||||
'system_hsts_incsub' => array(
|
||||
'label' => $lng['admin']['domain_hsts_incsub'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'hsts_incsub',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
), true)
|
||||
),
|
||||
'system_hsts_preload' => array(
|
||||
'label' => $lng['admin']['domain_hsts_preload'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'hsts_preload',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('system.use_ssl') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
), true)
|
||||
),
|
||||
/**
|
||||
* FCGID
|
||||
*/
|
||||
'system_mod_fcgid_enabled_ownvhost' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid_ownvhost'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_ownvhost',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
),
|
||||
'visible' => \Froxlor\Settings::Get('system.mod_fcgid') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
'system_mod_fcgid_httpuser' => array(
|
||||
'label' => $lng['admin']['mod_fcgid_user'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_httpuser',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingWebserverFcgidFpmUser',
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
),
|
||||
'visible' => \Froxlor\Settings::Get('system.mod_fcgid') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
'system_mod_fcgid_httpgroup' => array(
|
||||
'label' => $lng['admin']['mod_fcgid_group'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_httpgroup',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
),
|
||||
'visible' => \Froxlor\Settings::Get('system.mod_fcgid') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
'system_mod_fcgid_defaultini_ownvhost' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_defaultini_ownvhost',
|
||||
'type' => 'option',
|
||||
'default' => '2',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\Http\\PhpConfig',
|
||||
'getPhpConfigs'
|
||||
),
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
),
|
||||
'visible' => \Froxlor\Settings::Get('system.mod_fcgid') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
/**
|
||||
* php-fpm
|
||||
*/
|
||||
'system_phpfpm_enabled_ownvhost' => array(
|
||||
'label' => $lng['phpfpm']['ownvhost'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'enabled_ownvhost',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('phpfpm.enabled') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
'system_phpfpm_httpuser' => array(
|
||||
'label' => $lng['phpfpm']['vhost_httpuser'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'vhost_httpuser',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingWebserverFcgidFpmUser',
|
||||
'visible' => \Froxlor\Settings::Get('phpfpm.enabled') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
'system_phpfpm_httpgroup' => array(
|
||||
'label' => $lng['phpfpm']['vhost_httpgroup'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'vhost_httpgroup',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('phpfpm.enabled') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
'system_phpfpm_defaultini_ownvhost' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'vhost_defaultini',
|
||||
'type' => 'option',
|
||||
'default' => '2',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\Http\\PhpConfig',
|
||||
'getPhpConfigs'
|
||||
),
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('phpfpm.enabled') && call_user_func(array(
|
||||
'\Froxlor\Settings\FroxlorVhostSettings',
|
||||
'hasVhostContainerEnabled'
|
||||
))
|
||||
),
|
||||
/**
|
||||
* DNS
|
||||
*/
|
||||
'system_dns_createhostnameentry' => array(
|
||||
'label' => $lng['serversettings']['dns_createhostnameentry'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'dns_createhostnameentry',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('system.bind_enable')
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
@@ -14,7 +14,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'crond' => array(
|
||||
@@ -27,23 +26,15 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'file',
|
||||
'default' => '/etc/cron.d/froxlor',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'system_send_cron_errors' => array(
|
||||
'label' => $lng['serversettings']['system_send_cron_errors'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'send_cron_errors',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_croncmdline' => array(
|
||||
'label' => $lng['serversettings']['system_croncmdline'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'croncmdline',
|
||||
'type' => 'string',
|
||||
'default' => '/usr/bin/nice -n 5 /usr/bin/php5 -q',
|
||||
'save_method' => 'storeSettingField',
|
||||
'default' => '/usr/bin/nice -n 5 /usr/bin/php -q',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_crondreload' => array(
|
||||
'label' => $lng['serversettings']['system_crondreload'],
|
||||
@@ -51,7 +42,7 @@ return array(
|
||||
'varname' => 'crondreload',
|
||||
'type' => 'string',
|
||||
'default' => '/etc/init.d/cron reload',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_cron_allowautoupdate' => array(
|
||||
'label' => $lng['serversettings']['system_cron_allowautoupdate'],
|
||||
@@ -59,7 +50,7 @@ return array(
|
||||
'varname' => 'cron_allowautoupdate',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_debug_cron' => array(
|
||||
'label' => $lng['serversettings']['cron']['debug'],
|
||||
@@ -67,7 +58,7 @@ return array(
|
||||
'varname' => 'debug_cron',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
|
||||
@@ -13,10 +13,9 @@
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Settings
|
||||
* @package \Froxlor\Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'webserver' => array(
|
||||
@@ -29,9 +28,16 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 'apache2',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array('apache2' => 'Apache 2', 'lighttpd' => 'ligHTTPd', 'nginx' => 'Nginx'),
|
||||
'option_options' => array(
|
||||
'apache2' => 'Apache 2',
|
||||
'lighttpd' => 'ligHTTPd',
|
||||
'nginx' => 'Nginx'
|
||||
),
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => 'checkPhpInterfaceSetting',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkPhpInterfaceSetting'
|
||||
),
|
||||
'overview_option' => true
|
||||
),
|
||||
'system_apache_24' => array(
|
||||
@@ -41,7 +47,45 @@ return array(
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_apache_itksupport' => array(
|
||||
'label' => $lng['serversettings']['apache_itksupport'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'apacheitksupport',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => (\Froxlor\Settings::Get('system.mod_fcgid') == 0 && \Froxlor\Settings::Get('phpfpm.enabled') == 0),
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_http2_support' => array(
|
||||
'label' => $lng['serversettings']['http2_support'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'http2_support',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2',
|
||||
'nginx'
|
||||
),
|
||||
'visible' => \Froxlor\Settings::Get('system.use_ssl')
|
||||
),
|
||||
'system_dhparams_file' => array(
|
||||
'label' => $lng['serversettings']['dhparams_file'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'dhparams_file',
|
||||
'type' => 'string',
|
||||
'string_type' => 'file',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => \Froxlor\Settings::Get('system.use_ssl')
|
||||
),
|
||||
'system_httpuser' => array(
|
||||
'label' => $lng['admin']['webserver_user'],
|
||||
@@ -49,7 +93,7 @@ return array(
|
||||
'varname' => 'httpuser',
|
||||
'type' => 'string',
|
||||
'default' => 'www-data',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingWebserverFcgidFpmUser'
|
||||
),
|
||||
'system_httpgroup' => array(
|
||||
'label' => $lng['admin']['webserver_group'],
|
||||
@@ -57,7 +101,7 @@ return array(
|
||||
'varname' => 'httpgroup',
|
||||
'type' => 'string',
|
||||
'default' => 'www-data',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_apacheconf_vhost' => array(
|
||||
'label' => $lng['serversettings']['apacheconf_vhost'],
|
||||
@@ -66,7 +110,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'filedir',
|
||||
'default' => '/etc/apache2/sites-enabled/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_apacheconf_diroptions' => array(
|
||||
'label' => $lng['serversettings']['apacheconf_diroptions'],
|
||||
@@ -75,7 +119,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'filedir',
|
||||
'default' => '/etc/apache2/sites-enabled/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_apacheconf_htpasswddir' => array(
|
||||
'label' => $lng['serversettings']['apacheconf_htpasswddir'],
|
||||
@@ -84,7 +128,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'confdir',
|
||||
'default' => '/etc/apache2/htpasswd/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_logfiles_directory' => array(
|
||||
'label' => $lng['serversettings']['logfiles_directory'],
|
||||
@@ -93,7 +137,82 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/var/customers/logs/',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_logfiles_script' => array(
|
||||
'label' => $lng['serversettings']['logfiles_script'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'logfiles_script',
|
||||
'type' => 'string',
|
||||
'string_type' => '',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_logfiles_piped' => array(
|
||||
'label' => $lng['serversettings']['logfiles_piped'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'logfiles_piped',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_logfiles_format' => array(
|
||||
'label' => $lng['serversettings']['logfiles_format'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'logfiles_format',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'string_emptyallowed' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2',
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'system_logfiles_type' => array(
|
||||
'label' => $lng['serversettings']['logfiles_type'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'logfiles_type',
|
||||
'type' => 'option',
|
||||
'default' => '1',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
'1' => 'combined',
|
||||
'2' => 'vhost_combined'
|
||||
),
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_errorlog_level' => array(
|
||||
'label' => $lng['serversettings']['errorlog_level'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'errorlog_level',
|
||||
'type' => 'option',
|
||||
'default' => (\Froxlor\Settings::Get('system.webserver') == 'nginx' ? 'error' : 'warn'),
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
'emerg' => 'emerg',
|
||||
'alert' => 'alert',
|
||||
'crit' => 'crit',
|
||||
'error' => 'error',
|
||||
'warn' => 'warn',
|
||||
'notice' => 'notice',
|
||||
'info' => 'info',
|
||||
'debug' => 'debug'
|
||||
),
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array(
|
||||
'apache2',
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'system_customersslpath' => array(
|
||||
'label' => $lng['serversettings']['customerssl_directory'],
|
||||
@@ -102,7 +221,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'confdir',
|
||||
'default' => '/etc/ssl/froxlor-custom/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpappendopenbasedir' => array(
|
||||
'label' => $lng['serversettings']['phpappendopenbasedir'],
|
||||
@@ -111,7 +230,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_deactivateddocroot' => array(
|
||||
'label' => $lng['serversettings']['deactivateddocroot'],
|
||||
@@ -121,7 +240,7 @@ return array(
|
||||
'string_type' => 'dir',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_default_vhostconf' => array(
|
||||
'label' => $lng['serversettings']['default_vhostconf'],
|
||||
@@ -129,7 +248,19 @@ return array(
|
||||
'varname' => 'default_vhostconf',
|
||||
'type' => 'text',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_apache_globaldiropt' => array(
|
||||
'label' => $lng['serversettings']['apache_globaldiropt'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'apacheglobaldiropt',
|
||||
'type' => 'text',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'visible' => (\Froxlor\Settings::Get('system.mod_fcgid') == 0 && \Froxlor\Settings::Get('phpfpm.enabled') == 0),
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_apachereload_command' => array(
|
||||
'label' => $lng['serversettings']['apachereload_command'],
|
||||
@@ -137,7 +268,7 @@ return array(
|
||||
'varname' => 'apachereload_command',
|
||||
'type' => 'string',
|
||||
'default' => '/etc/init.d/apache2 reload',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpreload_command' => array(
|
||||
'label' => $lng['serversettings']['phpreload_command'],
|
||||
@@ -146,7 +277,9 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('nginx')
|
||||
'websrv_avail' => array(
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'system_nginx_php_backend' => array(
|
||||
'label' => $lng['serversettings']['nginx_php_backend'],
|
||||
@@ -155,7 +288,9 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => '127.0.0.1:8888',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('nginx')
|
||||
'websrv_avail' => array(
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'nginx_fastcgiparams' => array(
|
||||
'label' => $lng['serversettings']['nginx_fastcgiparams'],
|
||||
@@ -165,7 +300,9 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'default' => '/etc/nginx/fastcgi_params',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('nginx')
|
||||
'websrv_avail' => array(
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'defaultwebsrverrhandler_enabled' => array(
|
||||
'label' => $lng['serversettings']['defaultwebsrverrhandler_enabled'],
|
||||
@@ -173,7 +310,7 @@ return array(
|
||||
'varname' => 'enabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'defaultwebsrverrhandler_err401' => array(
|
||||
'label' => $lng['serversettings']['defaultwebsrverrhandler_err401'],
|
||||
@@ -182,7 +319,10 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2', 'nginx')
|
||||
'websrv_avail' => array(
|
||||
'apache2',
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'defaultwebsrverrhandler_err403' => array(
|
||||
'label' => $lng['serversettings']['defaultwebsrverrhandler_err403'],
|
||||
@@ -191,7 +331,10 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2', 'nginx')
|
||||
'websrv_avail' => array(
|
||||
'apache2',
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'defaultwebsrverrhandler_err404' => array(
|
||||
'label' => $lng['serversettings']['defaultwebsrverrhandler_err404'],
|
||||
@@ -199,7 +342,7 @@ return array(
|
||||
'varname' => 'err404',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'defaultwebsrverrhandler_err500' => array(
|
||||
'label' => $lng['serversettings']['defaultwebsrverrhandler_err500'],
|
||||
@@ -208,7 +351,10 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2', 'nginx')
|
||||
'websrv_avail' => array(
|
||||
'apache2',
|
||||
'nginx'
|
||||
)
|
||||
),
|
||||
'customredirect_enabled' => array(
|
||||
'label' => $lng['serversettings']['customredirect_enabled'],
|
||||
@@ -216,8 +362,7 @@ return array(
|
||||
'varname' => 'enabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2', 'lighttpd')
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'customredirect_default' => array(
|
||||
'label' => $lng['serversettings']['customredirect_default'],
|
||||
@@ -226,9 +371,8 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => '1',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getRedirectCodes',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2', 'lighttpd')
|
||||
'option_options_method' => array('\\Froxlor\\Domain\\Domain', 'getRedirectCodes'),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
|
||||
@@ -13,10 +13,9 @@
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Settings
|
||||
* @package \Froxlor\Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'ssl' => array(
|
||||
@@ -31,14 +30,29 @@ return array(
|
||||
'save_method' => 'storeSettingField',
|
||||
'overview_option' => true
|
||||
),
|
||||
'system_ssl_protocols' => array(
|
||||
'label' => $lng['serversettings']['ssl']['ssl_protocols'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'ssl_protocols',
|
||||
'type' => 'option',
|
||||
'default' => 'TLSv1,TLSv1.2',
|
||||
'option_mode' => 'multiple',
|
||||
'option_options' => array(
|
||||
'TLSv1' => 'TLSv1',
|
||||
'TLSv1.1' => 'TLSv1.1',
|
||||
'TLSv1.2' => 'TLSv1.2',
|
||||
'TLSv1.3' => 'TLSv1.3'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_ssl_cipher_list' => array(
|
||||
'label' => $lng['serversettings']['ssl']['ssl_cipher_list'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'ssl_cipher_list',
|
||||
'type' => 'string',
|
||||
'string_emptyallowed' => false,
|
||||
'default' => 'ECDHE-RSA-AES128-SHA256:AES128-GCM-SHA256:RC4:HIGH:!MD5:!aNULL:!EDH',
|
||||
'save_method' => 'storeSettingField',
|
||||
'default' => 'ECDH+AESGCM:ECDH+AES256:!aNULL:!MD5:!DSS:!DH:!AES128',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_ssl_cert_file' => array(
|
||||
'label' => $lng['serversettings']['ssl']['ssl_cert_file'],
|
||||
@@ -48,7 +62,7 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '/etc/apache2/apache2.pem',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_ssl_key_file' => array(
|
||||
'label' => $lng['serversettings']['ssl']['ssl_key_file'],
|
||||
@@ -58,7 +72,7 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '/etc/apache2/apache2.key',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_ssl_cert_chainfile' => array(
|
||||
'label' => $lng['admin']['ipsandports']['ssl_cert_chainfile'],
|
||||
@@ -68,7 +82,7 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_ssl_ca_file' => array(
|
||||
'label' => $lng['serversettings']['ssl']['ssl_ca_file'],
|
||||
@@ -78,7 +92,116 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_apache24_ocsp_cache_path' => array(
|
||||
'label' => $lng['serversettings']['ssl']['apache24_ocsp_cache_path'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'apache24_ocsp_cache_path',
|
||||
'type' => 'string',
|
||||
'string_type' => 'string',
|
||||
'string_emptyallowed' => false,
|
||||
'default' => 'shmcb:/var/run/apache2/ocsp-stapling.cache(131072)',
|
||||
'visible' => \Froxlor\Settings::Get('system.webserver') == "apache2" && \Froxlor\Settings::Get('system.apache24') == 1,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_leenabled' => array(
|
||||
'label' => $lng['serversettings']['leenabled'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'leenabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'cronmodule' => 'froxlor/letsencrypt',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_letsencryptacmeconf' => array(
|
||||
'label' => $lng['serversettings']['letsencryptacmeconf'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'letsencryptacmeconf',
|
||||
'type' => 'string',
|
||||
'string_type' => 'file',
|
||||
'default' => '/etc/apache2/conf-enabled/acme.conf',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_leapiversion' => array(
|
||||
'label' => $lng['serversettings']['leapiversion'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'leapiversion',
|
||||
'type' => 'option',
|
||||
'default' => '1',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
'1' => 'ACME v1',
|
||||
'2' => 'ACME v2'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_letsencryptca' => array(
|
||||
'label' => $lng['serversettings']['letsencryptca'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'letsencryptca',
|
||||
'type' => 'option',
|
||||
'default' => 'testing',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
'testing' => 'https://acme-staging' . (\Froxlor\Settings::Get('system.leapiversion') == '2' ? '-v02' : '') . '.api.letsencrypt.org (Test)',
|
||||
'production' => 'https://acme-v0' . \Froxlor\Settings::Get('system.leapiversion') . '.api.letsencrypt.org (Live)'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_letsencryptchallengepath' => array(
|
||||
'label' => $lng['serversettings']['letsencryptchallengepath'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'letsencryptchallengepath',
|
||||
'type' => 'string',
|
||||
'string_emptyallowed' => false,
|
||||
'default' => \Froxlor\Froxlor::getInstallDir(),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_letsencryptkeysize' => array(
|
||||
'label' => $lng['serversettings']['letsencryptkeysize'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'letsencryptkeysize',
|
||||
'type' => 'option',
|
||||
'default' => '2048',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
'2048' => '2048',
|
||||
'3072' => '3072',
|
||||
'4096' => '4096',
|
||||
'8192' => '8192'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_leecc' => array(
|
||||
'label' => $lng['serversettings']['letsencryptecc'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'leecc',
|
||||
'type' => 'option',
|
||||
'default' => '0',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
'0' => '-',
|
||||
'256' => 'ec-256',
|
||||
'384' => 'ec-384'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_letsencryptreuseold' => array(
|
||||
'label' => $lng['serversettings']['letsencryptreuseold'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'letsencryptreuseold',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_disable_le_selfcheck' => array(
|
||||
'label' => $lng['serversettings']['disable_le_selfcheck'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'disable_le_selfcheck',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
|
||||
@@ -14,12 +14,14 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'fcgid' => array(
|
||||
'title' => $lng['admin']['fcgid_settings'],
|
||||
'websrv_avail' => array('apache2', 'lighttpd'),
|
||||
'websrv_avail' => array(
|
||||
'apache2',
|
||||
'lighttpd'
|
||||
),
|
||||
'fields' => array(
|
||||
'system_mod_fcgid_enabled' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid'],
|
||||
@@ -28,7 +30,10 @@ return array(
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => 'checkFcgidPhpFpm',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkFcgidPhpFpm'
|
||||
),
|
||||
'overview_option' => true
|
||||
),
|
||||
'system_mod_fcgid_configdir' => array(
|
||||
@@ -38,8 +43,11 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'confdir',
|
||||
'default' => '/var/www/php-fcgi-scripts/',
|
||||
'plausibility_check_method' => 'checkPathConflicts',
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkPathConflicts'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mod_fcgid_tmpdir' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['tmpdir'],
|
||||
@@ -48,7 +56,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/var/customers/tmp/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mod_fcgid_peardir' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['peardir'],
|
||||
@@ -59,17 +67,22 @@ return array(
|
||||
'string_delimiter' => ':',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '/usr/share/php/:/usr/share/php5/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mod_fcgid_wrapper' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['wrapper'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_wrapper',
|
||||
'type' => 'option',
|
||||
'option_options' => array(0 => 'ScriptAlias', 1=> 'FcgidWrapper'),
|
||||
'option_options' => array(
|
||||
0 => 'ScriptAlias',
|
||||
1 => 'FcgidWrapper'
|
||||
),
|
||||
'default' => 1,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_mod_fcgid_starter' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['starter'],
|
||||
@@ -77,7 +90,7 @@ return array(
|
||||
'varname' => 'mod_fcgid_starter',
|
||||
'type' => 'int',
|
||||
'default' => 0,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mod_fcgid_maxrequests' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['maxrequests'],
|
||||
@@ -85,7 +98,7 @@ return array(
|
||||
'varname' => 'mod_fcgid_maxrequests',
|
||||
'type' => 'int',
|
||||
'default' => 250,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mod_fcgid_defaultini' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
|
||||
@@ -94,46 +107,10 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => '1',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getPhpConfigs',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'system_mod_fcgid_enabled_ownvhost' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid_ownvhost'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_ownvhost',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
),
|
||||
'system_mod_fcgid_httpuser' => array(
|
||||
'label' => $lng['admin']['mod_fcgid_user'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_httpuser',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
),
|
||||
'system_mod_fcgid_httpgroup' => array(
|
||||
'label' => $lng['admin']['mod_fcgid_group'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_httpgroup',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
),
|
||||
'system_mod_fcgid_defaultini_ownvhost' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mod_fcgid_defaultini_ownvhost',
|
||||
'type' => 'option',
|
||||
'default' => '2',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getPhpConfigs',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\Http\\PhpConfig',
|
||||
'getPhpConfigs'),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mod_fcgid_idle_timeout' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['idle_timeout'],
|
||||
@@ -142,7 +119,7 @@ return array(
|
||||
'type' => 'int',
|
||||
'default' => 30,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
|
||||
@@ -11,10 +11,9 @@
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Settings
|
||||
* @package \Froxlor\Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'phpfpm' => array(
|
||||
@@ -27,33 +26,12 @@ return array(
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => 'checkFcgidPhpFpm',
|
||||
'plausibility_check_method' => array(
|
||||
'\\Froxlor\\Validate\\Check',
|
||||
'checkFcgidPhpFpm'
|
||||
),
|
||||
'overview_option' => true
|
||||
),
|
||||
'system_phpfpm_enabled_ownvhost' => array(
|
||||
'label' => $lng['phpfpm']['ownvhost'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'enabled_ownvhost',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_httpuser' => array(
|
||||
'label' => $lng['phpfpm']['vhost_httpuser'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'vhost_httpuser',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_httpgroup' => array(
|
||||
'label' => $lng['phpfpm']['vhost_httpgroup'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'vhost_httpgroup',
|
||||
'type' => 'string',
|
||||
'default' => 'froxlorlocal',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_defaultini' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['defaultini'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
@@ -61,26 +39,10 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => '1',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getPhpConfigs',
|
||||
'save_method' => 'storeSettingField'
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\Http\\PhpConfig',
|
||||
'getPhpConfigs'
|
||||
),
|
||||
'system_phpfpm_defaultini_ownvhost' => array(
|
||||
'label' => $lng['serversettings']['mod_fcgid']['defaultini_ownvhost'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'vhost_defaultini',
|
||||
'type' => 'option',
|
||||
'default' => '2',
|
||||
'option_mode' => 'one',
|
||||
'option_options_method' => 'getPhpConfigs',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_configdir' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['configdir'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'configdir',
|
||||
'type' => 'string',
|
||||
'string_type' => 'confdir',
|
||||
'default' => '/etc/php-fpm.d/',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_aliasconfigdir' => array(
|
||||
@@ -107,9 +69,22 @@ return array(
|
||||
'varname' => 'peardir',
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'string_delimiter' => ':',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '/usr/share/php/:/usr/share/php5/',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_envpath' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['envpath'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'envpath',
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'string_delimiter' => ':',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '/usr/local/bin:/usr/bin:/bin',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_fastcgi_ipcdir' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['ipcdir'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
@@ -119,82 +94,48 @@ return array(
|
||||
'default' => '/var/lib/apache2/fastcgi/',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_reload' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['reload'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'reload',
|
||||
'type' => 'string',
|
||||
'default' => '/etc/init.d/php-fpm restart',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_pm' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['pm'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'pm',
|
||||
'type' => 'option',
|
||||
'default' => 'static',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array('static' => 'static', 'dynamic' => 'dynamic', 'ondemand' => 'ondemand'),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_max_children' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['max_children'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'max_children',
|
||||
'type' => 'int',
|
||||
'default' => 1,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_start_servers' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['start_servers'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'start_servers',
|
||||
'type' => 'int',
|
||||
'default' => 20,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_min_spare_servers' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['min_spare_servers'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'min_spare_servers',
|
||||
'type' => 'int',
|
||||
'default' => 5,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_max_spare_servers' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['max_spare_servers'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'max_spare_servers',
|
||||
'type' => 'int',
|
||||
'default' => 35,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_max_requests' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['max_requests'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'max_requests',
|
||||
'type' => 'int',
|
||||
'default' => 0,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_idle_timeout' => array(
|
||||
'label' => $lng['serversettings']['phpfpm_settings']['idle_timeout'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'idle_timeout',
|
||||
'type' => 'int',
|
||||
'default' => 30,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_use_mod_proxy' => array(
|
||||
'label' => $lng['phpfpm']['use_mod_proxy'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'use_mod_proxy',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'visible' => Settings::Get('system.apache24'),
|
||||
'visible' => \Froxlor\Settings::Get('system.apache24'),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_ini_flags' => array(
|
||||
'label' => $lng['phpfpm']['ini_flags'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'ini_flags',
|
||||
'type' => 'text',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_ini_values' => array(
|
||||
'label' => $lng['phpfpm']['ini_values'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'ini_values',
|
||||
'type' => 'text',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_ini_admin_flags' => array(
|
||||
'label' => $lng['phpfpm']['ini_admin_flags'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'ini_admin_flags',
|
||||
'type' => 'text',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_phpfpm_ini_admin_values' => array(
|
||||
'label' => $lng['phpfpm']['ini_admin_values'],
|
||||
'settinggroup' => 'phpfpm',
|
||||
'varname' => 'ini_admin_values',
|
||||
'type' => 'text',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
@@ -14,7 +14,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'perl' => array(
|
||||
@@ -27,7 +26,9 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => '/usr/bin/perl',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('lighttpd')
|
||||
'websrv_avail' => array(
|
||||
'lighttpd'
|
||||
)
|
||||
),
|
||||
'system_perl_suexecworkaround' => array(
|
||||
'label' => $lng['serversettings']['perl']['suexecworkaround'],
|
||||
@@ -36,7 +37,9 @@ return array(
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'system_perl_suexeccgipath' => array(
|
||||
'label' => $lng['serversettings']['perl']['suexeccgipath'],
|
||||
@@ -46,7 +49,9 @@ return array(
|
||||
'string_type' => 'dir',
|
||||
'default' => '/var/www/cgi-bin/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('apache2')
|
||||
'websrv_avail' => array(
|
||||
'apache2'
|
||||
)
|
||||
),
|
||||
'perl_server' => array(
|
||||
'label' => $lng['serversettings']['perl_server'],
|
||||
@@ -55,11 +60,13 @@ return array(
|
||||
'type' => 'string',
|
||||
'default' => 'unix:/var/run/nginx/cgiwrap-dispatch.sock',
|
||||
'save_method' => 'storeSettingField',
|
||||
'websrv_avail' => array('nginx')
|
||||
),
|
||||
),
|
||||
),
|
||||
),
|
||||
'websrv_avail' => array(
|
||||
'nginx'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'statistics' => array(
|
||||
@@ -29,8 +28,12 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 2,
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(0 => $lng['admin']['webalizer']['normal'], 1 => $lng['admin']['webalizer']['quiet'], 2 => $lng['admin']['webalizer']['veryquiet']),
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options' => array(
|
||||
0 => $lng['admin']['webalizer']['normal'],
|
||||
1 => $lng['admin']['webalizer']['quiet'],
|
||||
2 => $lng['admin']['webalizer']['veryquiet']
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_awstats_enabled' => array(
|
||||
'label' => $lng['serversettings']['awstats_enabled'],
|
||||
@@ -38,7 +41,7 @@ return array(
|
||||
'varname' => 'awstats_enabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_awstats_path' => array(
|
||||
'label' => $lng['serversettings']['awstats_path'],
|
||||
@@ -47,7 +50,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/usr/bin/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_awstats_awstatspath' => array(
|
||||
'label' => $lng['serversettings']['awstats_awstatspath'],
|
||||
@@ -56,7 +59,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/usr/bin/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_awstats_conf' => array(
|
||||
'label' => $lng['serversettings']['awstats_conf'],
|
||||
@@ -65,7 +68,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/etc/awstats/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_awstats_icons' => array(
|
||||
'label' => $lng['serversettings']['awstats_icons'],
|
||||
@@ -74,7 +77,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/usr/share/awstats/icon/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'mail' => array(
|
||||
@@ -30,7 +29,7 @@ return array(
|
||||
'default' => 2000,
|
||||
'int_min' => 1,
|
||||
'int_max' => 65535,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_vmail_gid' => array(
|
||||
'label' => $lng['serversettings']['vmail_gid'],
|
||||
@@ -40,7 +39,7 @@ return array(
|
||||
'default' => 2000,
|
||||
'int_min' => 1,
|
||||
'int_max' => 65535,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_vmail_homedir' => array(
|
||||
'label' => $lng['serversettings']['vmail_homedir'],
|
||||
@@ -49,7 +48,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/var/customers/mail/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_vmail_maildirname' => array(
|
||||
'label' => $lng['serversettings']['vmail_maildirname'],
|
||||
@@ -59,7 +58,7 @@ return array(
|
||||
'string_type' => 'dir',
|
||||
'default' => 'Maildir',
|
||||
'string_emptyallowed' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'panel_sendalternativemail' => array(
|
||||
'label' => $lng['serversettings']['sendalternativemail'],
|
||||
@@ -67,7 +66,7 @@ return array(
|
||||
'varname' => 'sendalternativemail',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_quota_enabled' => array(
|
||||
'label' => $lng['serversettings']['mail_quota_enabled'],
|
||||
@@ -75,7 +74,7 @@ return array(
|
||||
'varname' => 'mail_quota_enabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mail_quota' => array(
|
||||
'label' => $lng['serversettings']['mail_quota'],
|
||||
@@ -83,7 +82,7 @@ return array(
|
||||
'varname' => 'mail_quota',
|
||||
'type' => 'int',
|
||||
'default' => 100,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_catchall_enabled' => array(
|
||||
'label' => $lng['serversettings']['catchall_enabled'],
|
||||
@@ -91,7 +90,7 @@ return array(
|
||||
'varname' => 'catchall_enabled',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingResetCatchall',
|
||||
'save_method' => 'storeSettingResetCatchall'
|
||||
),
|
||||
'system_mailtraffic_enabled' => array(
|
||||
'label' => $lng['serversettings']['mailtraffic_enabled'],
|
||||
@@ -99,7 +98,7 @@ return array(
|
||||
'varname' => 'mailtraffic_enabled',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mdaserver' => array(
|
||||
'label' => $lng['serversettings']['mdaserver'],
|
||||
@@ -108,8 +107,11 @@ return array(
|
||||
'type' => 'option',
|
||||
'option_mode' => 'one',
|
||||
'default' => 'dovecot',
|
||||
'option_options' => array('courier' => 'Courier', 'dovecot' => 'Dovecot'),
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options' => array(
|
||||
'courier' => 'Courier',
|
||||
'dovecot' => 'Dovecot'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mdalog' => array(
|
||||
'label' => $lng['serversettings']['mdalog'],
|
||||
@@ -119,7 +121,7 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'default' => '/var/log/mail.log',
|
||||
'string_emptyallowed' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mtaserver' => array(
|
||||
'label' => $lng['serversettings']['mtaserver'],
|
||||
@@ -128,8 +130,11 @@ return array(
|
||||
'type' => 'option',
|
||||
'option_mode' => 'one',
|
||||
'default' => 'postfix',
|
||||
'option_options' => array('exim4' => 'Exim4', 'postfix' => 'Postfix'),
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options' => array(
|
||||
'exim4' => 'Exim4',
|
||||
'postfix' => 'Postfix'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mtalog' => array(
|
||||
'label' => $lng['serversettings']['mtalog'],
|
||||
@@ -139,11 +144,11 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'default' => '/var/log/mail.log',
|
||||
'string_emptyallowed' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
),
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'ftpserver' => array(
|
||||
@@ -29,11 +28,14 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 'proftpd',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array('proftpd' => 'Proftpd', 'pureftpd' => 'Pureftpd'),
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
'option_options' => array(
|
||||
'proftpd' => 'Proftpd',
|
||||
'pureftpd' => 'Pureftpd'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'nameserver' => array(
|
||||
@@ -31,6 +30,27 @@ return array(
|
||||
'save_method' => 'storeSettingField',
|
||||
'overview_option' => true
|
||||
),
|
||||
'system_dnsenabled' => array(
|
||||
'label' => $lng['serversettings']['dnseditorenable'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'dnsenabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_dns_server' => array(
|
||||
'label' => $lng['serversettings']['dns_server'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'dns_server',
|
||||
'type' => 'option',
|
||||
'default' => 'Bind',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
'Bind' => 'Bind9',
|
||||
'PowerDNS' => 'PowerDNS'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_bindconf_directory' => array(
|
||||
'label' => $lng['serversettings']['bindconf_directory'],
|
||||
'settinggroup' => 'system',
|
||||
@@ -38,7 +58,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/etc/bind/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_bindreload_command' => array(
|
||||
'label' => $lng['serversettings']['bindreload_command'],
|
||||
@@ -46,7 +66,7 @@ return array(
|
||||
'varname' => 'bindreload_command',
|
||||
'type' => 'string',
|
||||
'default' => '/etc/init.d/bind9 reload',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_nameservers' => array(
|
||||
'label' => $lng['serversettings']['nameservers'],
|
||||
@@ -56,7 +76,7 @@ return array(
|
||||
'string_regexp' => '/^(([a-z0-9\-\._]+, ?)*[a-z0-9\-\._]+)?$/i',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingFieldInsertBindTask',
|
||||
'save_method' => 'storeSettingFieldInsertBindTask'
|
||||
),
|
||||
'system_mxservers' => array(
|
||||
'label' => $lng['serversettings']['mxservers'],
|
||||
@@ -66,25 +86,17 @@ return array(
|
||||
'string_regexp' => '/^(([0-9]+ [a-z0-9\-\._]+, ?)*[0-9]+ [a-z0-9\-\._]+)?$/i',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_axfrservers' => array(
|
||||
'label' => $lng['serversettings']['axfrservers'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'axfrservers',
|
||||
'type' => 'string',
|
||||
'string_type' => 'validate_ip',
|
||||
'string_type' => 'validate_ip_incl_private',
|
||||
'string_delimiter' => ',',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'system_dns_createhostnameentry' => array(
|
||||
'label' => $lng['serversettings']['dns_createhostnameentry'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'dns_createhostnameentry',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_dns_createmailentry' => array(
|
||||
@@ -103,11 +115,9 @@ return array(
|
||||
'default' => 604800, /* 1 week */
|
||||
'int_min' => 3600, /* 1 hour */
|
||||
'int_max' => 2147483647, /* integer max */
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
),
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'logging' => array(
|
||||
@@ -38,8 +37,11 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 1,
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(1 => $lng['admin']['logger']['normal'], 2 => $lng['admin']['logger']['paranoid']),
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options' => array(
|
||||
1 => $lng['admin']['logger']['normal'],
|
||||
2 => $lng['admin']['logger']['paranoid']
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'logger_logtypes' => array(
|
||||
'label' => $lng['serversettings']['logger']['types'],
|
||||
@@ -48,8 +50,12 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 'syslog,mysql',
|
||||
'option_mode' => 'multiple',
|
||||
'option_options' => array('syslog' => 'syslog', 'file' => 'file', 'mysql' => 'mysql'),
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options' => array(
|
||||
'syslog' => 'syslog',
|
||||
'file' => 'file',
|
||||
'mysql' => 'mysql'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'logger_logfile' => array(
|
||||
'label' => $lng['serversettings']['logger']['logfile'],
|
||||
@@ -59,18 +65,24 @@ return array(
|
||||
'string_type' => 'file',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'logger_log_cron' => array(
|
||||
'label' => $lng['serversettings']['logger']['logcron'],
|
||||
'settinggroup' => 'logger',
|
||||
'varname' => 'log_cron',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
'type' => 'option',
|
||||
'default' => 0,
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(
|
||||
0 => $lng['serversettings']['logger']['logcronoption']['never'],
|
||||
1 => $lng['serversettings']['logger']['logcronoption']['once'],
|
||||
2 => $lng['serversettings']['logger']['logcronoption']['always']
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
|
||||
@@ -13,10 +13,9 @@
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Settings
|
||||
* @package \Froxlor\Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'dkim' => array(
|
||||
@@ -38,7 +37,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_type' => 'dir',
|
||||
'default' => '/etc/postfix/dkim/',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'dkim_domains' => array(
|
||||
'label' => $lng['dkim']['dkim_domains'],
|
||||
@@ -47,7 +46,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_regexp' => '/^[a-z0-9\._]+$/i',
|
||||
'default' => 'domains',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'dkim_dkimkeys' => array(
|
||||
'label' => $lng['dkim']['dkim_dkimkeys'],
|
||||
@@ -56,7 +55,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_regexp' => '/^[a-z0-9\._]+$/i',
|
||||
'default' => 'dkim-keys.conf',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'dkim_algorithm' => array(
|
||||
'label' => $lng['dkim']['dkim_algorithm'],
|
||||
@@ -65,8 +64,12 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 'all',
|
||||
'option_mode' => 'multiple',
|
||||
'option_options' => array('all' => 'All', 'sha1' => 'SHA1', 'sha256' => 'SHA256'),
|
||||
'save_method' => 'storeSettingFieldInsertBindTask',
|
||||
'option_options' => array(
|
||||
'all' => 'All',
|
||||
'sha1' => 'SHA1',
|
||||
'sha256' => 'SHA256'
|
||||
),
|
||||
'save_method' => 'storeSettingFieldInsertBindTask'
|
||||
),
|
||||
'dkim_servicetype' => array(
|
||||
'label' => $lng['dkim']['dkim_servicetype'],
|
||||
@@ -75,21 +78,27 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => '0',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array('0' => 'All', '1' => 'E-Mail'),
|
||||
'save_method' => 'storeSettingFieldInsertBindTask',
|
||||
'option_options' => array(
|
||||
'0' => 'All',
|
||||
'1' => 'E-Mail'
|
||||
),
|
||||
'save_method' => 'storeSettingFieldInsertBindTask'
|
||||
),
|
||||
'dkim_keylength' => array(
|
||||
'label' => array(
|
||||
'title' => $lng['dkim']['dkim_keylength']['title'],
|
||||
'description' => sprintf($lng['dkim']['dkim_keylength']['description'], Settings::Get('dkim.dkim_prefix'))
|
||||
'description' => sprintf($lng['dkim']['dkim_keylength']['description'], \Froxlor\Settings::Get('dkim.dkim_prefix'))
|
||||
),
|
||||
'settinggroup' => 'dkim',
|
||||
'varname' => 'dkim_keylength',
|
||||
'type' => 'option',
|
||||
'default' => '1024',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array('1024' => '1024 Bit', '2048' => '2048 Bit'),
|
||||
'save_method' => 'storeSettingFieldInsertBindTask',
|
||||
'option_options' => array(
|
||||
'1024' => '1024 Bit',
|
||||
'2048' => '2048 Bit'
|
||||
),
|
||||
'save_method' => 'storeSettingFieldInsertBindTask'
|
||||
),
|
||||
'dkim_notes' => array(
|
||||
'label' => $lng['dkim']['dkim_notes'],
|
||||
@@ -98,25 +107,7 @@ return array(
|
||||
'type' => 'string',
|
||||
'string_regexp' => '/^[a-z0-9\._]+$/i',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingFieldInsertBindTask',
|
||||
),
|
||||
'dkim_add_adsp' => array(
|
||||
'label' => $lng['dkim']['dkim_add_adsp'],
|
||||
'settinggroup' => 'dkim',
|
||||
'varname' => 'dkim_add_adsp',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingFieldInsertBindTask',
|
||||
),
|
||||
'dkim_add_adsppolicy' => array(
|
||||
'label' => $lng['dkim']['dkim_add_adsppolicy'],
|
||||
'settinggroup' => 'dkim',
|
||||
'varname' => 'dkim_add_adsppolicy',
|
||||
'type' => 'option',
|
||||
'default' => '1',
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array('0' => 'Unknown', '1' => 'All', '2' => 'Discardable'),
|
||||
'save_method' => 'storeSettingFieldInsertBindTask',
|
||||
'save_method' => 'storeSettingFieldInsertBindTask'
|
||||
),
|
||||
'dkimrestart_command' => array(
|
||||
'label' => $lng['dkim']['dkimrestart_command'],
|
||||
@@ -124,11 +115,11 @@ return array(
|
||||
'varname' => 'dkimrestart_command',
|
||||
'type' => 'string',
|
||||
'default' => '/etc/init.d/dkim-filter restart',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
),
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
|
||||
@@ -14,7 +14,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'spf' => array(
|
||||
@@ -34,7 +33,7 @@ return array(
|
||||
'settinggroup' => 'spf',
|
||||
'varname' => 'spf_entry',
|
||||
'type' => 'string',
|
||||
'default' => '@ IN TXT "v=spf1 a mx -all"',
|
||||
'default' => '"v=spf1 a mx -all"',
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
|
||||
@@ -1,144 +0,0 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2003-2009 the SysCP Team (see authors).
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'ticket' => array(
|
||||
'title' => $lng['admin']['ticketsettings'],
|
||||
'fields' => array(
|
||||
'ticket_enabled' => array(
|
||||
'label' => $lng['serversettings']['ticket']['enable'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'enabled',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'cronmodule' => 'froxlor/ticket',
|
||||
'save_method' => 'storeSettingField',
|
||||
'overview_option' => true
|
||||
),
|
||||
'ticket_noreply_email' => array(
|
||||
'label' => $lng['serversettings']['ticket']['noreply_email'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'noreply_email',
|
||||
'type' => 'string',
|
||||
'string_type' => 'mail',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_noreply_name' => array(
|
||||
'label' => $lng['serversettings']['ticket']['noreply_name'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'noreply_name',
|
||||
'type' => 'string',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_reset_cycle' => array(
|
||||
'label' => $lng['serversettings']['ticket']['reset_cycle'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'reset_cycle',
|
||||
'type' => 'option',
|
||||
'default' => 1,
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(0 => html_entity_decode($lng['admin']['tickets']['daily']), 1 => html_entity_decode($lng['admin']['tickets']['weekly']), 2 => html_entity_decode($lng['admin']['tickets']['monthly']), 3 => html_entity_decode($lng['admin']['tickets']['yearly'])),
|
||||
'save_method' => 'storeSettingField',
|
||||
'plausibility_check_method' => 'setCycleOfCronjob',
|
||||
),
|
||||
'ticket_concurrently_open' => array(
|
||||
'label' => $lng['serversettings']['ticket']['concurrentlyopen'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'concurrently_open',
|
||||
'type' => 'int',
|
||||
'default' => 5,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_archiving_days' => array(
|
||||
'label' => $lng['serversettings']['ticket']['archiving_days'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'archiving_days',
|
||||
'type' => 'int',
|
||||
'int_min' => 1,
|
||||
'int_max' => 99,
|
||||
'default' => 5,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_worktime_all' => array(
|
||||
'label' => $lng['serversettings']['ticket']['worktime_all'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'worktime_all',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_worktime_begin' => array(
|
||||
'label' => $lng['serversettings']['ticket']['worktime_begin'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'worktime_begin',
|
||||
'type' => 'string',
|
||||
'string_regexp' => '/^[012][0-9]:[0-6][0-9]$/',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_worktime_end' => array(
|
||||
'label' => $lng['serversettings']['ticket']['worktime_end'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'worktime_end',
|
||||
'type' => 'string',
|
||||
'string_regexp' => '/^[012][0-9]:[0-6][0-9]$/',
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_worktime_sat' => array(
|
||||
'label' => $lng['serversettings']['ticket']['worktime_sat'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'worktime_sat',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'ticket_worktime_sun' => array(
|
||||
'label' => $lng['serversettings']['ticket']['worktime_sun'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'worktime_sun',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
'system_last_archive_run' => array(
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'last_archive_run',
|
||||
'type' => 'hidden',
|
||||
'default' => '',
|
||||
),
|
||||
'ticket_default_priority' => array(
|
||||
'label' => $lng['serversettings']['ticket']['default_priority'],
|
||||
'settinggroup' => 'ticket',
|
||||
'varname' => 'default_priority',
|
||||
'type' => 'option',
|
||||
'default' => 2,
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(1 => $lng['ticket']['high'], 2 => $lng['ticket']['normal'], 3 => $lng['ticket']['low']),
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
),
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
@@ -16,7 +16,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'security' => array(
|
||||
@@ -28,15 +27,15 @@ return array(
|
||||
'varname' => 'unix_names',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_mailpwcleartext' => array(
|
||||
'label' => $lng['serversettings']['mailpwcleartext'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'mailpwcleartext',
|
||||
'type' => 'bool',
|
||||
'default' => true,
|
||||
'save_method' => 'storeSettingField',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_passwordcryptfunc' => array(
|
||||
'label' => $lng['serversettings']['passwordcryptfunc'],
|
||||
@@ -45,8 +44,11 @@ return array(
|
||||
'type' => 'option',
|
||||
'default' => 0,
|
||||
'option_mode' => 'one',
|
||||
'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
|
||||
'save_method' => 'storeSettingField',
|
||||
'option_options_method' => array(
|
||||
'\\Froxlor\\System\\Crypt',
|
||||
'getAvailablePasswordHashes'
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_allow_error_report_admin' => array(
|
||||
'label' => $lng['serversettings']['allow_error_report_admin'],
|
||||
@@ -54,7 +56,7 @@ return array(
|
||||
'varname' => 'allow_error_report_admin',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_allow_error_report_customer' => array(
|
||||
'label' => $lng['serversettings']['allow_error_report_customer'],
|
||||
@@ -62,7 +64,24 @@ return array(
|
||||
'varname' => 'allow_error_report_customer',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_allow_customer_shell' => array(
|
||||
'label' => $lng['serversettings']['allow_allow_customer_shell'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'allow_customer_shell',
|
||||
'type' => 'bool',
|
||||
'default' => false,
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'system_available_shells' => array(
|
||||
'label' => $lng['serversettings']['available_shells'],
|
||||
'settinggroup' => 'system',
|
||||
'varname' => 'available_shells',
|
||||
'type' => 'string',
|
||||
'string_emptyallowed' => true,
|
||||
'default' => '',
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
|
||||
@@ -13,7 +13,6 @@
|
||||
* @package Settings
|
||||
*
|
||||
*/
|
||||
|
||||
return array(
|
||||
'groups' => array(
|
||||
'diskquota' => array(
|
||||
@@ -34,7 +33,7 @@ return array(
|
||||
'varname' => 'diskquota_repquota_path',
|
||||
'type' => 'string',
|
||||
'default' => '/usr/sbin/repquota',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'diskquota_quotatool_path' => array(
|
||||
'label' => $lng['serversettings']['diskquota_quotatool_path']['description'],
|
||||
@@ -42,7 +41,7 @@ return array(
|
||||
'varname' => 'diskquota_quotatool_path',
|
||||
'type' => 'string',
|
||||
'default' => '/usr/bin/quotatool',
|
||||
'save_method' => 'storeSettingField',
|
||||
'save_method' => 'storeSettingField'
|
||||
),
|
||||
'diskquota_customer_partition' => array(
|
||||
'label' => $lng['serversettings']['diskquota_customer_partition']['description'],
|
||||
@@ -50,11 +49,11 @@ return array(
|
||||
'varname' => 'diskquota_customer_partition',
|
||||
'type' => 'string',
|
||||
'default' => '/dev/root',
|
||||
'save_method' => 'storeSettingField',
|
||||
),
|
||||
),
|
||||
),
|
||||
),
|
||||
'save_method' => 'storeSettingField'
|
||||
)
|
||||
)
|
||||
)
|
||||
)
|
||||
);
|
||||
|
||||
?>
|
||||
|
||||
769
admin_admins.php
@@ -16,23 +16,24 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\Admins as Admins;
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
$id = intval($_GET['id']);
|
||||
}
|
||||
|
||||
if ($page == 'admins'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
if ($page == 'admins' && $userinfo['change_serversettings'] == '1') {
|
||||
|
||||
if ($action == '') {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_admins");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed admin_admins");
|
||||
$fields = array(
|
||||
'loginname' => $lng['login']['username'],
|
||||
'name' => $lng['customer']['name'],
|
||||
@@ -42,7 +43,7 @@ if ($page == 'admins'
|
||||
'traffic_used' => $lng['customer']['traffic'] . ' (' . $lng['panel']['used'] . ')',
|
||||
'deactivated' => $lng['admin']['deactivated']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_ADMINS, $fields);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_ADMINS, $fields);
|
||||
$admins = '';
|
||||
$result_stmt = Database::query("SELECT * FROM `" . TABLE_PANEL_ADMINS . "` " . $paging->getSqlWhere(false) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
$numrows_admins = Database::num_rows();
|
||||
@@ -91,35 +92,38 @@ if ($page == 'admins'
|
||||
$traffic_percent = 100;
|
||||
}
|
||||
|
||||
$row = str_replace_array('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps subdomains tickets');
|
||||
$row = htmlentities_array($row);
|
||||
$row = \Froxlor\PhpHelper::strReplaceArray('-1', 'UL', $row, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps subdomains');
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
|
||||
$row['custom_notes'] = ($row['custom_notes'] != '') ? nl2br($row['custom_notes']) : '';
|
||||
|
||||
eval("\$admins.=\"" . getTemplate("admins/admins_admin") . "\";");
|
||||
eval("\$admins.=\"" . \Froxlor\UI\Template::getTemplate("admins/admins_admin") . "\";");
|
||||
$count ++;
|
||||
}
|
||||
$i ++;
|
||||
}
|
||||
|
||||
$admincount = $numrows_admins;
|
||||
eval("echo \"" . getTemplate("admins/admins") . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("admins/admins") . "\";");
|
||||
} elseif ($action == 'su') {
|
||||
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_ADMINS . "` WHERE `adminid` = :adminid
|
||||
");
|
||||
$result = Database::pexecute_first($result_stmt, array('adminid' => $id));
|
||||
try {
|
||||
$json_result = Admins::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
$destination_admin = $result['loginname'];
|
||||
|
||||
if ($destination_admin != ''
|
||||
&& $result['adminid'] != $userinfo['userid']
|
||||
) {
|
||||
if ($destination_admin != '' && $result['adminid'] != $userinfo['userid']) {
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_SESSIONS . "` WHERE `userid` = :userid
|
||||
");
|
||||
$result = Database::pexecute_first($result_stmt, array('userid' => $userinfo['userid']));
|
||||
$result = Database::pexecute_first($result_stmt, array(
|
||||
'userid' => $userinfo['userid']
|
||||
));
|
||||
|
||||
$s = md5(uniqid(microtime(), 1));
|
||||
$ins_stmt = Database::prepare("
|
||||
@@ -137,643 +141,116 @@ if ($page == 'admins'
|
||||
'lang' => $result['language']
|
||||
);
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "switched adminuser and is now '" . $destination_admin . "'");
|
||||
redirectTo('admin_index.php', array('s' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "switched adminuser and is now '" . $destination_admin . "'");
|
||||
\Froxlor\UI\Response::redirectTo('admin_index.php', array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
redirectTo('index.php', array('action' => 'login'));
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'action' => 'login'
|
||||
));
|
||||
}
|
||||
|
||||
} elseif ($action == 'delete'
|
||||
&& $id != 0
|
||||
) {
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_ADMINS . "` WHERE `adminid` = :adminid
|
||||
");
|
||||
$result = Database::pexecute_first($result_stmt, array('adminid' => $id));
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
try {
|
||||
$json_result = Admins::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if ($result['loginname'] != '') {
|
||||
if ($result['adminid'] == $userinfo['userid']) {
|
||||
standard_error('youcantdeleteyourself');
|
||||
exit;
|
||||
\Froxlor\UI\Response::standard_error('youcantdeleteyourself');
|
||||
}
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_ADMINS . "` WHERE `adminid` = :adminid
|
||||
");
|
||||
Database::pexecute($del_stmt, array('adminid' => $id));
|
||||
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_TRAFFIC_ADMINS . "` WHERE `adminid` = :adminid
|
||||
");
|
||||
Database::pexecute($del_stmt, array('adminid' => $id));
|
||||
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET
|
||||
`adminid` = :userid WHERE `adminid` = :adminid
|
||||
");
|
||||
Database::pexecute($upd_stmt, array('userid' => $userinfo['userid'], 'adminid' => $id));
|
||||
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
|
||||
`adminid` = :userid WHERE `adminid` = :adminid
|
||||
");
|
||||
Database::pexecute($upd_stmt, array('userid' => $userinfo['userid'], 'adminid' => $id));
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "deleted admin '" . $result['loginname'] . "'");
|
||||
updateCounters();
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
Admins::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->delete();
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_admin_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['loginname']);
|
||||
\Froxlor\UI\HTML::askYesNo('admin_admin_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['loginname']);
|
||||
}
|
||||
}
|
||||
|
||||
} elseif ($action == 'add') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$name = validate($_POST['name'], 'name');
|
||||
$email = $idna_convert->encode(validate($_POST['email'], 'email'));
|
||||
|
||||
$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
|
||||
$custom_notes_show = intval_ressource($_POST['custom_notes_show']);
|
||||
|
||||
$loginname = validate($_POST['loginname'], 'loginname');
|
||||
$password = validate($_POST['admin_password'], 'password');
|
||||
$password = validatePassword($password);
|
||||
$def_language = validate($_POST['def_language'], 'default language');
|
||||
|
||||
$customers = intval_ressource($_POST['customers']);
|
||||
if (isset($_POST['customers_ul'])) {
|
||||
$customers = -1;
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
Admins::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
$domains = intval_ressource($_POST['domains']);
|
||||
if (isset($_POST['domains_ul'])) {
|
||||
$domains = -1;
|
||||
}
|
||||
|
||||
$subdomains = intval_ressource($_POST['subdomains']);
|
||||
if (isset($_POST['subdomains_ul'])) {
|
||||
$subdomains = -1;
|
||||
}
|
||||
|
||||
$emails = intval_ressource($_POST['emails']);
|
||||
if (isset($_POST['emails_ul'])) {
|
||||
$emails = -1;
|
||||
}
|
||||
|
||||
$email_accounts = intval_ressource($_POST['email_accounts']);
|
||||
if (isset($_POST['email_accounts_ul'])) {
|
||||
$email_accounts = -1;
|
||||
}
|
||||
|
||||
$email_forwarders = intval_ressource($_POST['email_forwarders']);
|
||||
if (isset($_POST['email_forwarders_ul'])) {
|
||||
$email_forwarders = -1;
|
||||
}
|
||||
|
||||
if (Settings::Get('system.mail_quota_enabled') == '1') {
|
||||
|
||||
$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
|
||||
if (isset($_POST['email_quota_ul'])) {
|
||||
$email_quota = -1;
|
||||
}
|
||||
} else {
|
||||
$email_quota = -1;
|
||||
}
|
||||
|
||||
$ftps = intval_ressource($_POST['ftps']);
|
||||
if (isset($_POST['ftps_ul'])) {
|
||||
$ftps = -1;
|
||||
}
|
||||
|
||||
if (Settings::Get('ticket.enabled') == 1) {
|
||||
|
||||
$tickets = intval_ressource($_POST['tickets']);
|
||||
if (isset($_POST['tickets_ul'])) {
|
||||
$tickets = -1;
|
||||
}
|
||||
} else {
|
||||
$tickets = 0;
|
||||
}
|
||||
|
||||
$mysqls = intval_ressource($_POST['mysqls']);
|
||||
if (isset($_POST['mysqls_ul'])) {
|
||||
$mysqls = -1;
|
||||
}
|
||||
|
||||
$customers_see_all = 0;
|
||||
if (isset($_POST['customers_see_all'])) {
|
||||
$customers_see_all = intval($_POST['customers_see_all']);
|
||||
}
|
||||
|
||||
$domains_see_all = 0;
|
||||
if (isset($_POST['domains_see_all'])) {
|
||||
$domains_see_all = intval($_POST['domains_see_all']);
|
||||
}
|
||||
|
||||
$caneditphpsettings = 0;
|
||||
if (isset($_POST['caneditphpsettings'])) {
|
||||
$caneditphpsettings = intval($_POST['caneditphpsettings']);
|
||||
}
|
||||
|
||||
$change_serversettings = 0;
|
||||
if (isset($_POST['change_serversettings'])) {
|
||||
$change_serversettings = intval($_POST['change_serversettings']);
|
||||
}
|
||||
|
||||
$diskspace = intval_ressource($_POST['diskspace']);
|
||||
if (isset($_POST['diskspace_ul'])) {
|
||||
$diskspace = -1;
|
||||
}
|
||||
|
||||
$traffic = doubleval_ressource($_POST['traffic']);
|
||||
if (isset($_POST['traffic_ul'])) {
|
||||
$traffic = -1;
|
||||
}
|
||||
|
||||
$tickets_see_all = 0;
|
||||
if (isset($_POST['tickets_see_all'])) {
|
||||
$tickets_see_all = intval($_POST['tickets_see_all']);
|
||||
}
|
||||
|
||||
$diskspace = $diskspace * 1024;
|
||||
$traffic = $traffic * 1024 * 1024;
|
||||
$ipaddress = intval_ressource($_POST['ipaddress']);
|
||||
|
||||
// Check if the account already exists
|
||||
$loginname_check_stmt = Database::prepare("
|
||||
SELECT `loginname` FROM `" . TABLE_PANEL_CUSTOMERS . "` WHERE `loginname` = :login
|
||||
");
|
||||
$loginname_check = Database::pexecute_first($loginname_check_stmt, array('login' => $loginname));
|
||||
|
||||
$loginname_check_admin_stmt = Database::prepare("
|
||||
SELECT `loginname` FROM `" . TABLE_PANEL_ADMINS . "` WHERE `loginname` = :login
|
||||
");
|
||||
$loginname_check_admin = Database::pexecute_first($loginname_check_admin_stmt, array('login' => $loginname));
|
||||
|
||||
if ($loginname == '') {
|
||||
standard_error(array('stringisempty', 'myloginname'));
|
||||
}
|
||||
elseif (strtolower($loginname_check['loginname']) == strtolower($loginname)
|
||||
|| strtolower($loginname_check_admin['loginname']) == strtolower($loginname)
|
||||
) {
|
||||
standard_error('loginnameexists', $loginname);
|
||||
}
|
||||
// Accounts which match systemaccounts are not allowed, filtering them
|
||||
elseif (preg_match('/^' . preg_quote(Settings::Get('customer.accountprefix'), '/') . '([0-9]+)/', $loginname)) {
|
||||
standard_error('loginnameissystemaccount', Settings::Get('customer.accountprefix'));
|
||||
}
|
||||
elseif (!validateUsername($loginname)) {
|
||||
standard_error('loginnameiswrong', $loginname);
|
||||
}
|
||||
elseif ($name == '') {
|
||||
standard_error(array('stringisempty', 'myname'));
|
||||
}
|
||||
elseif ($email == '') {
|
||||
standard_error(array('stringisempty', 'emailadd'));
|
||||
}
|
||||
elseif ($password == '') {
|
||||
standard_error(array('stringisempty', 'mypassword'));
|
||||
}
|
||||
elseif (!validateEmail($email)) {
|
||||
standard_error('emailiswrong', $email);
|
||||
|
||||
} else {
|
||||
|
||||
if ($customers_see_all != '1') {
|
||||
$customers_see_all = '0';
|
||||
}
|
||||
|
||||
if ($domains_see_all != '1') {
|
||||
$domains_see_all = '0';
|
||||
}
|
||||
|
||||
if ($caneditphpsettings != '1') {
|
||||
$caneditphpsettings = '0';
|
||||
}
|
||||
|
||||
if ($change_serversettings != '1') {
|
||||
$change_serversettings = '0';
|
||||
}
|
||||
|
||||
if ($tickets_see_all != '1') {
|
||||
$tickets_see_all = '0';
|
||||
}
|
||||
|
||||
$_theme = Settings::Get('panel.default_theme');
|
||||
|
||||
$ins_data = array(
|
||||
'loginname' => $loginname,
|
||||
'password' => md5($password),
|
||||
'name' => $name,
|
||||
'email' => $email,
|
||||
'lang' => $def_language,
|
||||
'change_serversettings' => $change_serversettings,
|
||||
'customers' => $customers,
|
||||
'customers_see_all' => $customers_see_all,
|
||||
'domains' => $domains,
|
||||
'domains_see_all' => $domains_see_all,
|
||||
'caneditphpsettings' => $caneditphpsettings,
|
||||
'diskspace' => $diskspace,
|
||||
'traffic' => $traffic,
|
||||
'subdomains' => $subdomains,
|
||||
'emails' => $emails,
|
||||
'accounts' => $email_accounts,
|
||||
'forwarders' => $email_forwarders,
|
||||
'quota' => $email_quota,
|
||||
'ftps' => $ftps,
|
||||
'tickets' => $tickets,
|
||||
'tickets_see_all' => $tickets_see_all,
|
||||
'mysqls' => $mysqls,
|
||||
'ip' => $ipaddress,
|
||||
'theme' => $_theme,
|
||||
'custom_notes' => $custom_notes,
|
||||
'custom_notes_show' => $custom_notes_show
|
||||
);
|
||||
|
||||
$ins_stmt = Database::prepare("
|
||||
INSERT INTO `" . TABLE_PANEL_ADMINS . "` SET
|
||||
`loginname` = :loginname,
|
||||
`password` = :password,
|
||||
`name` = :name,
|
||||
`email` = :email,
|
||||
`def_language` = :lang,
|
||||
`change_serversettings` = :change_serversettings,
|
||||
`customers` = :customers,
|
||||
`customers_see_all` = :customers_see_all,
|
||||
`domains` = :domains,
|
||||
`domains_see_all` = :domains_see_all,
|
||||
`caneditphpsettings` = :caneditphpsettings,
|
||||
`diskspace` = :diskspace,
|
||||
`traffic` = :traffic,
|
||||
`subdomains` = :subdomains,
|
||||
`emails` = :emails,
|
||||
`email_accounts` = :accounts,
|
||||
`email_forwarders` = :forwarders,
|
||||
`email_quota` = :quota,
|
||||
`ftps` = :ftps,
|
||||
`tickets` = :tickets,
|
||||
`tickets_see_all` = :tickets_see_all,
|
||||
`mysqls` = :mysqls,
|
||||
`ip` = :ip,
|
||||
`theme` = :theme,
|
||||
`custom_notes` = :custom_notes,
|
||||
`custom_notes_show` = :custom_notes_show
|
||||
");
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
|
||||
$adminid = Database::lastInsertId();
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "added admin '" . $loginname . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$language_options = '';
|
||||
while (list($language_file, $language_name) = each($languages)) {
|
||||
$language_options.= makeoption($language_name, $language_file, $userinfo['language'], true);
|
||||
foreach ($languages as $language_file => $language_name) {
|
||||
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, $userinfo['language'], true);
|
||||
}
|
||||
|
||||
$ipaddress = makeoption($lng['admin']['allips'], "-1");
|
||||
$ips = array();
|
||||
$ipaddress = \Froxlor\UI\HTML::makeoption($lng['admin']['allips'], "-1");
|
||||
$ipsandports_stmt = Database::query("
|
||||
SELECT `id`, `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "` ORDER BY `ip`, `port` ASC
|
||||
SELECT `id`, `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "` GROUP BY `ip` ORDER BY `ip` ASC
|
||||
");
|
||||
|
||||
while ($row = $ipsandports_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if (filter_var($row['ip'], FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)) {
|
||||
$row['ip'] = '[' . $row['ip'] . ']';
|
||||
}
|
||||
if (!in_array($row['ip'], $ips)) {
|
||||
$ipaddress.= makeoption($row['ip'], $row['id']);
|
||||
$ips[] = $row['ip'];
|
||||
}
|
||||
$ipaddress .= \Froxlor\UI\HTML::makeoption($row['ip'], $row['id']);
|
||||
}
|
||||
|
||||
$customers_ul = makecheckbox('customers_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$diskspace_ul = makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$traffic_ul = makecheckbox('traffic_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$domains_ul = makecheckbox('domains_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$subdomains_ul = makecheckbox('subdomains_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$emails_ul = makecheckbox('emails_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$customers_ul = \Froxlor\UI\HTML::makecheckbox('customers_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$diskspace_ul = \Froxlor\UI\HTML::makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$traffic_ul = \Froxlor\UI\HTML::makecheckbox('traffic_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$domains_ul = \Froxlor\UI\HTML::makecheckbox('domains_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$subdomains_ul = \Froxlor\UI\HTML::makecheckbox('subdomains_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$emails_ul = \Froxlor\UI\HTML::makecheckbox('emails_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_accounts_ul = \Froxlor\UI\HTML::makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_forwarders_ul = \Froxlor\UI\HTML::makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_quota_ul = \Froxlor\UI\HTML::makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$ftps_ul = \Froxlor\UI\HTML::makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$mysqls_ul = \Froxlor\UI\HTML::makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
|
||||
$admin_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/admin/formfield.admin_add.php';
|
||||
$admin_add_form = htmlform::genHTMLForm($admin_add_data);
|
||||
$admin_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($admin_add_data);
|
||||
|
||||
$title = $admin_add_data['admin_add']['title'];
|
||||
$image = $admin_add_data['admin_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("admins/admins_add") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("admins/admins_add") . "\";");
|
||||
}
|
||||
|
||||
} elseif($action == 'edit'
|
||||
&& $id != 0
|
||||
) {
|
||||
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_ADMINS . "` WHERE `adminid` = :adminid
|
||||
");
|
||||
$result = Database::pexecute_first($result_stmt, array('adminid' => $id));
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
try {
|
||||
$json_result = Admins::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if ($result['loginname'] != '') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$name = validate($_POST['name'], 'name');
|
||||
$email = $idna_convert->encode(validate($_POST['email'], 'email'));
|
||||
|
||||
$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
|
||||
$custom_notes_show = intval_ressource($_POST['custom_notes_show']);
|
||||
|
||||
if ($result['adminid'] == $userinfo['userid']) {
|
||||
|
||||
$password = '';
|
||||
$def_language = $result['def_language'];
|
||||
$deactivated = $result['deactivated'];
|
||||
$customers = $result['customers'];
|
||||
$domains = $result['domains'];
|
||||
$subdomains = $result['subdomains'];
|
||||
$emails = $result['emails'];
|
||||
$email_accounts = $result['email_accounts'];
|
||||
$email_forwarders = $result['email_forwarders'];
|
||||
$email_quota = $result['email_quota'];
|
||||
$ftps = $result['ftps'];
|
||||
$tickets = $result['tickets'];
|
||||
$mysqls = $result['mysqls'];
|
||||
$tickets_see_all = $result['tickets_see_all'];
|
||||
$customers_see_all = $result['customers_see_all'];
|
||||
$domains_see_all = $result['domains_see_all'];
|
||||
$caneditphpsettings = $result['caneditphpsettings'];
|
||||
$change_serversettings = $result['change_serversettings'];
|
||||
$diskspace = $result['diskspace'];
|
||||
$traffic = $result['traffic'];
|
||||
$ipaddress = $result['ip'];
|
||||
|
||||
} else {
|
||||
|
||||
$password = validate($_POST['admin_password'], 'new password');
|
||||
$def_language = validate($_POST['def_language'], 'default language');
|
||||
$deactivated = isset($_POST['deactivated']) ? 1 : 0;
|
||||
|
||||
$customers = intval_ressource($_POST['customers']);
|
||||
if (isset($_POST['customers_ul'])) {
|
||||
$customers = -1;
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
Admins::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
$domains = intval_ressource($_POST['domains']);
|
||||
if (isset($_POST['domains_ul'])) {
|
||||
$domains = -1;
|
||||
}
|
||||
|
||||
$subdomains = intval_ressource($_POST['subdomains']);
|
||||
if (isset($_POST['subdomains_ul'])) {
|
||||
$subdomains = -1;
|
||||
}
|
||||
|
||||
$emails = intval_ressource($_POST['emails']);
|
||||
if (isset($_POST['emails_ul'])) {
|
||||
$emails = -1;
|
||||
}
|
||||
|
||||
$email_accounts = intval_ressource($_POST['email_accounts']);
|
||||
if (isset($_POST['email_accounts_ul'])) {
|
||||
$email_accounts = -1;
|
||||
}
|
||||
|
||||
$email_forwarders = intval_ressource($_POST['email_forwarders']);
|
||||
if (isset($_POST['email_forwarders_ul'])) {
|
||||
$email_forwarders = -1;
|
||||
}
|
||||
|
||||
if (Settings::Get('system.mail_quota_enabled') == '1') {
|
||||
$email_quota = validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array('0', ''));
|
||||
if (isset($_POST['email_quota_ul'])) {
|
||||
$email_quota = -1;
|
||||
}
|
||||
} else {
|
||||
$email_quota = -1;
|
||||
}
|
||||
|
||||
$ftps = intval_ressource($_POST['ftps']);
|
||||
if (isset($_POST['ftps_ul'])) {
|
||||
$ftps = -1;
|
||||
}
|
||||
|
||||
if (Settings::Get('ticket.enabled') == 1) {
|
||||
$tickets = intval_ressource($_POST['tickets']);
|
||||
if (isset($_POST['tickets_ul'])) {
|
||||
$tickets = -1;
|
||||
}
|
||||
} else {
|
||||
$tickets = 0;
|
||||
}
|
||||
|
||||
$mysqls = intval_ressource($_POST['mysqls']);
|
||||
if (isset($_POST['mysqls_ul'])) {
|
||||
$mysqls = -1;
|
||||
}
|
||||
|
||||
$customers_see_all = 0;
|
||||
if (isset($_POST['customers_see_all'])) {
|
||||
$customers_see_all = intval($_POST['customers_see_all']);
|
||||
}
|
||||
|
||||
$domains_see_all = 0;
|
||||
if (isset($_POST['domains_see_all'])) {
|
||||
$domains_see_all = intval($_POST['domains_see_all']);
|
||||
}
|
||||
|
||||
$caneditphpsettings = 0;
|
||||
if (isset($_POST['caneditphpsettings'])) {
|
||||
$caneditphpsettings = intval($_POST['caneditphpsettings']);
|
||||
}
|
||||
|
||||
$change_serversettings = 0;
|
||||
if (isset($_POST['change_serversettings'])) {
|
||||
$change_serversettings = isset($_POST['change_serversettings']) ? 1 : 0;
|
||||
}
|
||||
|
||||
$tickets_see_all = 0;
|
||||
if (isset($_POST['tickets_see_all'])) {
|
||||
$tickets_see_all = intval($_POST['tickets_see_all']);
|
||||
}
|
||||
|
||||
$diskspace = intval($_POST['diskspace']);
|
||||
if (isset($_POST['diskspace_ul'])) {
|
||||
$diskspace = -1;
|
||||
}
|
||||
|
||||
$traffic = doubleval_ressource($_POST['traffic']);
|
||||
if (isset($_POST['traffic_ul'])) {
|
||||
$traffic = -1;
|
||||
}
|
||||
|
||||
$diskspace = $diskspace * 1024;
|
||||
$traffic = $traffic * 1024 * 1024;
|
||||
$ipaddress = intval_ressource($_POST['ipaddress']);
|
||||
}
|
||||
|
||||
if ($name == '') {
|
||||
standard_error(array('stringisempty', 'myname'));
|
||||
} elseif($email == '') {
|
||||
standard_error(array('stringisempty', 'emailadd'));
|
||||
} elseif(!validateEmail($email)) {
|
||||
standard_error('emailiswrong', $email);
|
||||
} else {
|
||||
if ($password != '') {
|
||||
$password = validatePassword($password);
|
||||
$password = md5($password);
|
||||
} else {
|
||||
$password = $result['password'];
|
||||
}
|
||||
|
||||
if ($deactivated != '1') {
|
||||
$deactivated = '0';
|
||||
}
|
||||
|
||||
if ($customers_see_all != '1') {
|
||||
$customers_see_all = '0';
|
||||
}
|
||||
|
||||
if ($domains_see_all != '1') {
|
||||
$domains_see_all = '0';
|
||||
}
|
||||
|
||||
if ($caneditphpsettings != '1') {
|
||||
$caneditphpsettings = '0';
|
||||
}
|
||||
|
||||
if ($change_serversettings != '1') {
|
||||
$change_serversettings = '0';
|
||||
}
|
||||
|
||||
if ($tickets_see_all != '1') {
|
||||
$tickets_see_all = '0';
|
||||
}
|
||||
|
||||
// check if a resource was set to something lower
|
||||
// than actually used by the admin/reseller
|
||||
$res_warning = "";
|
||||
if ($customers != $result['customers'] && $customers != -1 && $customers < $result['customers_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'customers');
|
||||
}
|
||||
if ($domains != $result['domains'] && $domains != -1 && $domains < $result['domains_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'domains');
|
||||
}
|
||||
if ($diskspace != $result['diskspace'] && ($diskspace / 1024) != -1 && $diskspace < $result['diskspace_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'diskspace');
|
||||
}
|
||||
if ($traffic != $result['traffic'] && ($traffic / 1024 / 1024) != -1 && $traffic < $result['traffic_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'traffic');
|
||||
}
|
||||
if ($emails != $result['emails'] && $emails != -1 && $emails < $result['emails_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'emails');
|
||||
}
|
||||
if ($email_accounts != $result['email_accounts'] && $email_accounts != -1 && $email_accounts < $result['email_accounts_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email accounts');
|
||||
}
|
||||
if ($email_forwarders != $result['email_forwarders'] && $email_forwarders != -1 && $email_forwarders < $result['email_forwarders_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email forwarders');
|
||||
}
|
||||
if ($email_quota != $result['email_quota'] && $email_quota != -1 && $email_quota < $result['email_quota_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'email quota');
|
||||
}
|
||||
if ($ftps != $result['ftps'] && $ftps != -1 && $ftps < $result['ftps_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'ftps');
|
||||
}
|
||||
if ($tickets != $result['tickets'] && $tickets != -1 && $tickets < $result['tickets_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'tickets');
|
||||
}
|
||||
if ($mysqls != $result['mysqls'] && $mysqls != -1 && $mysqls < $result['mysqls_used']) {
|
||||
$res_warning .= sprintf($lng['error']['setlessthanalreadyused'], 'mysqls');
|
||||
}
|
||||
|
||||
if ($res_warning != "") {
|
||||
$link = '';
|
||||
$error = $res_warning;
|
||||
eval("echo \"" . getTemplate('misc/error', '1') . "\";");
|
||||
exit;
|
||||
}
|
||||
|
||||
$upd_data = array(
|
||||
'password' => $password,
|
||||
'name' => $name,
|
||||
'email' => $email,
|
||||
'lang' => $def_language,
|
||||
'change_serversettings' => $change_serversettings,
|
||||
'customers' => $customers,
|
||||
'customers_see_all' => $customers_see_all,
|
||||
'domains' => $domains,
|
||||
'domains_see_all' => $domains_see_all,
|
||||
'caneditphpsettings' => $caneditphpsettings,
|
||||
'diskspace' => $diskspace,
|
||||
'traffic' => $traffic,
|
||||
'subdomains' => $subdomains,
|
||||
'emails' => $emails,
|
||||
'accounts' => $email_accounts,
|
||||
'forwarders' => $email_forwarders,
|
||||
'quota' => $email_quota,
|
||||
'ftps' => $ftps,
|
||||
'tickets' => $tickets,
|
||||
'tickets_see_all' => $tickets_see_all,
|
||||
'mysqls' => $mysqls,
|
||||
'ip' => $ipaddress,
|
||||
'deactivated' => $deactivated,
|
||||
'custom_notes' => $custom_notes,
|
||||
'custom_notes_show' => $custom_notes_show,
|
||||
'adminid' => $id
|
||||
);
|
||||
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_ADMINS . "` SET
|
||||
`password` = :password,
|
||||
`name` = :name,
|
||||
`email` = :email,
|
||||
`def_language` = :lang,
|
||||
`change_serversettings` = :change_serversettings,
|
||||
`customers` = :customers,
|
||||
`customers_see_all` = :customers_see_all,
|
||||
`domains` = :domains,
|
||||
`domains_see_all` = :domains_see_all,
|
||||
`caneditphpsettings` = :caneditphpsettings,
|
||||
`diskspace` = :diskspace,
|
||||
`traffic` = :traffic,
|
||||
`subdomains` = :subdomains,
|
||||
`emails` = :emails,
|
||||
`email_accounts` = :accounts,
|
||||
`email_forwarders` = :forwarders,
|
||||
`email_quota` = :quota,
|
||||
`ftps` = :ftps,
|
||||
`tickets` = :tickets,
|
||||
`tickets_see_all` = :tickets_see_all,
|
||||
`mysqls` = :mysqls,
|
||||
`ip` = :ip,
|
||||
`deactivated` = :deactivated,
|
||||
`custom_notes` = :custom_notes,
|
||||
`custom_notes_show` = :custom_notes_show
|
||||
WHERE `adminid` = :adminid
|
||||
");
|
||||
Database::pexecute($upd_stmt, $upd_data);
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "edited admin '#" . $id . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$dec_places = Settings::Get('panel.decimal_places');
|
||||
@@ -781,96 +258,84 @@ if ($page == 'admins'
|
||||
$result['diskspace'] = round($result['diskspace'] / 1024, $dec_places);
|
||||
$result['email'] = $idna_convert->decode($result['email']);
|
||||
|
||||
$customers_ul = makecheckbox('customers_ul', $lng['customer']['unlimited'], '-1', false, $result['customers'], true, true);
|
||||
$customers_ul = \Froxlor\UI\HTML::makecheckbox('customers_ul', $lng['customer']['unlimited'], '-1', false, $result['customers'], true, true);
|
||||
if ($result['customers'] == '-1') {
|
||||
$result['customers'] = '';
|
||||
}
|
||||
|
||||
$diskspace_ul = makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, $result['diskspace'], true, true);
|
||||
$diskspace_ul = \Froxlor\UI\HTML::makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, $result['diskspace'], true, true);
|
||||
if ($result['diskspace'] == '-1') {
|
||||
$result['diskspace'] = '';
|
||||
}
|
||||
|
||||
$traffic_ul = makecheckbox('traffic_ul', $lng['customer']['unlimited'], '-1', false, $result['traffic'], true, true);
|
||||
$traffic_ul = \Froxlor\UI\HTML::makecheckbox('traffic_ul', $lng['customer']['unlimited'], '-1', false, $result['traffic'], true, true);
|
||||
if ($result['traffic'] == '-1') {
|
||||
$result['traffic'] = '';
|
||||
}
|
||||
|
||||
$domains_ul = makecheckbox('domains_ul', $lng['customer']['unlimited'], '-1', false, $result['domains'], true, true);
|
||||
$domains_ul = \Froxlor\UI\HTML::makecheckbox('domains_ul', $lng['customer']['unlimited'], '-1', false, $result['domains'], true, true);
|
||||
if ($result['domains'] == '-1') {
|
||||
$result['domains'] = '';
|
||||
}
|
||||
|
||||
$subdomains_ul = makecheckbox('subdomains_ul', $lng['customer']['unlimited'], '-1', false, $result['subdomains'], true, true);
|
||||
$subdomains_ul = \Froxlor\UI\HTML::makecheckbox('subdomains_ul', $lng['customer']['unlimited'], '-1', false, $result['subdomains'], true, true);
|
||||
if ($result['subdomains'] == '-1') {
|
||||
$result['subdomains'] = '';
|
||||
}
|
||||
|
||||
$emails_ul = makecheckbox('emails_ul', $lng['customer']['unlimited'], '-1', false, $result['emails'], true, true);
|
||||
$emails_ul = \Froxlor\UI\HTML::makecheckbox('emails_ul', $lng['customer']['unlimited'], '-1', false, $result['emails'], true, true);
|
||||
if ($result['emails'] == '-1') {
|
||||
$result['emails'] = '';
|
||||
}
|
||||
|
||||
$email_accounts_ul = makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, $result['email_accounts'], true, true);
|
||||
$email_accounts_ul = \Froxlor\UI\HTML::makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, $result['email_accounts'], true, true);
|
||||
if ($result['email_accounts'] == '-1') {
|
||||
$result['email_accounts'] = '';
|
||||
}
|
||||
|
||||
$email_forwarders_ul = makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, $result['email_forwarders'], true, true);
|
||||
$email_forwarders_ul = \Froxlor\UI\HTML::makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, $result['email_forwarders'], true, true);
|
||||
if ($result['email_forwarders'] == '-1') {
|
||||
$result['email_forwarders'] = '';
|
||||
}
|
||||
|
||||
$email_quota_ul = makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, $result['email_quota'], true, true);
|
||||
$email_quota_ul = \Froxlor\UI\HTML::makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, $result['email_quota'], true, true);
|
||||
if ($result['email_quota'] == '-1') {
|
||||
$result['email_quota'] = '';
|
||||
}
|
||||
|
||||
$ftps_ul = makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true);
|
||||
$ftps_ul = \Froxlor\UI\HTML::makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true);
|
||||
if ($result['ftps'] == '-1') {
|
||||
$result['ftps'] = '';
|
||||
}
|
||||
|
||||
$tickets_ul = makecheckbox('tickets_ul', $lng['customer']['unlimited'], '-1', false, $result['tickets'], true, true);
|
||||
if ($result['tickets'] == '-1') {
|
||||
$result['tickets'] = '';
|
||||
}
|
||||
|
||||
$mysqls_ul = makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, $result['mysqls'], true, true);
|
||||
$mysqls_ul = \Froxlor\UI\HTML::makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, $result['mysqls'], true, true);
|
||||
if ($result['mysqls'] == '-1') {
|
||||
$result['mysqls'] = '';
|
||||
}
|
||||
|
||||
$language_options = '';
|
||||
while (list($language_file, $language_name) = each($languages)) {
|
||||
$language_options.= makeoption($language_name, $language_file, $result['def_language'], true);
|
||||
foreach ($languages as $language_file => $language_name) {
|
||||
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, $result['def_language'], true);
|
||||
}
|
||||
|
||||
$ipaddress = makeoption($lng['admin']['allips'], "-1", $result['ip']);
|
||||
$ips = array();
|
||||
$ipaddress = \Froxlor\UI\HTML::makeoption($lng['admin']['allips'], "-1", $result['ip']);
|
||||
$ipsandports_stmt = Database::query("
|
||||
SELECT `id`, `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "` ORDER BY `ip`, `port` ASC
|
||||
SELECT `id`, `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "` GROUP BY `id`, `ip` ORDER BY `ip`, `port` ASC
|
||||
");
|
||||
|
||||
while ($row = $ipsandports_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if (filter_var($row['ip'], FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)) {
|
||||
$row['ip'] = '[' . $row['ip'] . ']';
|
||||
}
|
||||
if (!in_array($row['ip'], $ips)) {
|
||||
$ipaddress.= makeoption($row['ip'], $row['id'], $result['ip']);
|
||||
$ips[] = $row['ip'];
|
||||
}
|
||||
$ipaddress .= \Froxlor\UI\HTML::makeoption($row['ip'], $row['id'], $result['ip']);
|
||||
}
|
||||
|
||||
$result = htmlentities_array($result);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
|
||||
$admin_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/admin/formfield.admin_edit.php';
|
||||
$admin_edit_form = htmlform::genHTMLForm($admin_edit_data);
|
||||
$admin_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($admin_edit_data);
|
||||
|
||||
$title = $admin_edit_data['admin_edit']['title'];
|
||||
$image = $admin_edit_data['admin_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("admins/admins_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("admins/admins_edit") . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
440
admin_apcuinfo.php
Normal file
@@ -0,0 +1,440 @@
|
||||
<?php
|
||||
|
||||
/*
|
||||
* +----------------------------------------------------------------------+
|
||||
* | APC |
|
||||
* +----------------------------------------------------------------------+
|
||||
* | Copyright (c) 2006-2011 The PHP Group |
|
||||
* +----------------------------------------------------------------------+
|
||||
* | This source file is subject to version 3.01 of the PHP license, |
|
||||
* | that is bundled with this package in the file LICENSE, and is |
|
||||
* | available through the world-wide-web at the following url: |
|
||||
* | http://www.php.net/license/3_01.txt |
|
||||
* | If you did not receive a copy of the PHP license and are unable to |
|
||||
* | obtain it through the world-wide-web, please send a note to |
|
||||
* | license@php.net so we can mail you a copy immediately. |
|
||||
* +----------------------------------------------------------------------+
|
||||
* | Authors: Ralf Becker <beckerr@php.net> |
|
||||
* | Rasmus Lerdorf <rasmus@php.net> |
|
||||
* | Ilia Alshanetsky <ilia@prohost.org> |
|
||||
* +----------------------------------------------------------------------+
|
||||
*
|
||||
* All other licensing and usage conditions are those of the PHP Group.
|
||||
*
|
||||
* Based on https://github.com/krakjoe/apcu/blob/master/apc.php
|
||||
* Implemented into Froxlor: Janos Muzsi <muzsij@hypernics.hu>
|
||||
*
|
||||
*/
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
$horizontal_bar_size = 950; // 1280px window width
|
||||
|
||||
if ($action == 'delete' && function_exists('apcu_clear_cache') && $userinfo['change_serversettings'] == '1') {
|
||||
apcu_clear_cache();
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "cleared APCu cache");
|
||||
header('Location: ' . $linker->getLink(array(
|
||||
'section' => 'apcuinfo',
|
||||
'page' => 'showinfo'
|
||||
)));
|
||||
exit();
|
||||
}
|
||||
|
||||
if (! function_exists('apcu_cache_info') || ! function_exists('apcu_sma_info')) {
|
||||
\Froxlor\UI\Response::standard_error($lng['error']['no_apcuinfo']);
|
||||
}
|
||||
|
||||
if ($page == 'showinfo') {
|
||||
$cache = apcu_cache_info();
|
||||
$mem = apcu_sma_info();
|
||||
$time = time();
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed admin_apcuinfo");
|
||||
|
||||
$passtime = $time - $cache['start_time'] > 0 ? $time - $cache['start_time'] : 1; // zero division
|
||||
$mem_size = $mem['num_seg'] * $mem['seg_size'];
|
||||
$mem_avail = $mem['avail_mem'];
|
||||
$mem_used = $mem_size - $mem_avail;
|
||||
$seg_size = bsize($mem['seg_size']);
|
||||
$sharedmem = sprintf($lng['apcuinfo']['sharedmemval'], $mem['num_seg'], $seg_size, $cache['memory_type']);
|
||||
$req_rate_user = sprintf("%.2f", $cache['num_hits'] ? (($cache['num_hits'] + $cache['num_misses']) / $passtime) : 0);
|
||||
$hit_rate_user = sprintf("%.2f", $cache['num_hits'] ? (($cache['num_hits']) / $passtime) : 0);
|
||||
$miss_rate_user = sprintf("%.2f", $cache['num_misses'] ? (($cache['num_misses']) / $passtime) : 0);
|
||||
$insert_rate_user = sprintf("%.2f", $cache['num_inserts'] ? (($cache['num_inserts']) / $passtime) : 0);
|
||||
$apcversion = phpversion('apcu');
|
||||
$phpversion = phpversion();
|
||||
$number_vars = $cache['num_entries'];
|
||||
$starttime = date('Y-m-d H:i:s', $cache['start_time']);
|
||||
$uptime_duration = duration($cache['start_time']);
|
||||
$size_vars = bsize($cache['mem_size']);
|
||||
|
||||
// check for possible empty values that are used in the templates
|
||||
if (! isset($cache['file_upload_progress'])) {
|
||||
$cache['file_upload_progress'] = $lng['logger']['unknown'];
|
||||
}
|
||||
|
||||
if (! isset($cache['num_expunges'])) {
|
||||
$cache['num_expunges'] = $lng['logger']['unknown'];
|
||||
}
|
||||
|
||||
$runtimelines = '';
|
||||
foreach (ini_get_all('apcu') as $name => $v) {
|
||||
$value = $v['local_value'];
|
||||
eval("\$runtimelines.=\"" . \Froxlor\UI\Template::getTemplate("settings/apcuinfo/runtime_line") . "\";");
|
||||
}
|
||||
|
||||
$freemem = bsize($mem_avail) . sprintf(" (%.1f%%)", $mem_avail * 100 / $mem_size);
|
||||
$usedmem = bsize($mem_used) . sprintf(" (%.1f%%)", $mem_used * 100 / $mem_size);
|
||||
$hits = $cache['num_hits'] . @sprintf(" (%.1f%%)", $cache['num_hits'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
|
||||
$misses = $cache['num_misses'] . @sprintf(" (%.1f%%)", $cache['num_misses'] * 100 / ($cache['num_hits'] + $cache['num_misses']));
|
||||
|
||||
// Fragementation: (freeseg - 1) / total_seg
|
||||
$nseg = $freeseg = $fragsize = $freetotal = 0;
|
||||
for ($i = 0; $i < $mem['num_seg']; $i ++) {
|
||||
$ptr = 0;
|
||||
foreach ($mem['block_lists'][$i] as $block) {
|
||||
if ($block['offset'] != $ptr) {
|
||||
++ $nseg;
|
||||
}
|
||||
$ptr = $block['offset'] + $block['size'];
|
||||
/* Only consider blocks <5M for the fragmentation % */
|
||||
if ($block['size'] < (5 * 1024 * 1024))
|
||||
$fragsize += $block['size'];
|
||||
$freetotal += $block['size'];
|
||||
}
|
||||
$freeseg += count($mem['block_lists'][$i]);
|
||||
}
|
||||
|
||||
if ($freeseg > 1) {
|
||||
$frag = sprintf("%.2f%% (%s out of %s in %d fragments)", ($fragsize / $freetotal) * 100, bsize($fragsize), bsize($freetotal), $freeseg);
|
||||
} else {
|
||||
$frag = "0%";
|
||||
}
|
||||
|
||||
foreach (ini_get_all('apcu') as $name => $v) {
|
||||
$value = $v['local_value'];
|
||||
}
|
||||
|
||||
$img_src1 = '';
|
||||
$img_src2 = '';
|
||||
$img_src3 = '';
|
||||
if (graphics_avail()) {
|
||||
$img_src = $linker->getLink(array(
|
||||
'section' => 'apcuinfo',
|
||||
'page' => 'img1',
|
||||
'action' => mt_rand(0, 1000000)
|
||||
));
|
||||
eval("\$img_src1=\"" . \Froxlor\UI\Template::getTemplate("settings/apcuinfo/img_line") . "\";");
|
||||
$img_src = $linker->getLink(array(
|
||||
'section' => 'apcuinfo',
|
||||
'page' => 'img2',
|
||||
'action' => mt_rand(0, 1000000)
|
||||
));
|
||||
eval("\$img_src2=\"" . \Froxlor\UI\Template::getTemplate("settings/apcuinfo/img_line") . "\";");
|
||||
$img_src = $linker->getLink(array(
|
||||
'section' => 'apcuinfo',
|
||||
'page' => 'img3',
|
||||
'action' => mt_rand(0, 1000000)
|
||||
));
|
||||
eval("\$img_src3=\"" . \Froxlor\UI\Template::getTemplate("settings/apcuinfo/img_line") . "\";");
|
||||
}
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/apcuinfo/showinfo") . "\";");
|
||||
} elseif ($page == 'img1') {
|
||||
|
||||
$mem = apcu_sma_info();
|
||||
|
||||
$size = 460;
|
||||
$image = imagecreate($size + 5, $size + 5);
|
||||
|
||||
$col_white = imagecolorallocate($image, 0xFF, 0xFF, 0xFF);
|
||||
$col_red = imagecolorallocate($image, 0xD0, 0x60, 0x30);
|
||||
$col_green = imagecolorallocate($image, 0x60, 0xF0, 0x60);
|
||||
$col_black = imagecolorallocate($image, 0, 0, 0);
|
||||
|
||||
imagecolortransparent($image, $col_white);
|
||||
|
||||
$s = $mem['num_seg'] * $mem['seg_size'];
|
||||
$a = $mem['avail_mem'];
|
||||
$x = $y = $size / 2;
|
||||
$fuzz = 0.000001;
|
||||
|
||||
// This block of code creates the pie chart. It is a lot more complex than you
|
||||
// would expect because we try to visualize any memory fragmentation as well.
|
||||
$angle_from = 0;
|
||||
$string_placement = array();
|
||||
for ($i = 0; $i < $mem['num_seg']; $i ++) {
|
||||
$ptr = 0;
|
||||
$free = $mem['block_lists'][$i];
|
||||
uasort($free, 'block_sort');
|
||||
foreach ($free as $block) {
|
||||
if ($block['offset'] != $ptr) { // Used block
|
||||
$angle_to = $angle_from + ($block['offset'] - $ptr) / $s;
|
||||
if (($angle_to + $fuzz) > 1)
|
||||
$angle_to = 1;
|
||||
if (($angle_to * 360) - ($angle_from * 360) >= 1) {
|
||||
fill_arc($image, $x, $y, $size, $angle_from * 360, $angle_to * 360, $col_black, $col_red);
|
||||
if (($angle_to - $angle_from) > 0.05) {
|
||||
array_push($string_placement, array(
|
||||
$angle_from,
|
||||
$angle_to
|
||||
));
|
||||
}
|
||||
}
|
||||
$angle_from = $angle_to;
|
||||
}
|
||||
$angle_to = $angle_from + ($block['size']) / $s;
|
||||
if (($angle_to + $fuzz) > 1)
|
||||
$angle_to = 1;
|
||||
if (($angle_to * 360) - ($angle_from * 360) >= 1) {
|
||||
fill_arc($image, $x, $y, $size, $angle_from * 360, $angle_to * 360, $col_black, $col_green);
|
||||
if (($angle_to - $angle_from) > 0.05) {
|
||||
array_push($string_placement, array(
|
||||
$angle_from,
|
||||
$angle_to
|
||||
));
|
||||
}
|
||||
}
|
||||
$angle_from = $angle_to;
|
||||
$ptr = $block['offset'] + $block['size'];
|
||||
}
|
||||
if ($ptr < $mem['seg_size']) { // memory at the end
|
||||
$angle_to = $angle_from + ($mem['seg_size'] - $ptr) / $s;
|
||||
if (($angle_to + $fuzz) > 1)
|
||||
$angle_to = 1;
|
||||
fill_arc($image, $x, $y, $size, $angle_from * 360, $angle_to * 360, $col_black, $col_red);
|
||||
if (($angle_to - $angle_from) > 0.05) {
|
||||
array_push($string_placement, array(
|
||||
$angle_from,
|
||||
$angle_to
|
||||
));
|
||||
}
|
||||
}
|
||||
}
|
||||
foreach ($string_placement as $angle) {
|
||||
text_arc($image, $x, $y, $size, $angle[0] * 360, $angle[1] * 360, $col_black, bsize($s * ($angle[1] - $angle[0])));
|
||||
}
|
||||
|
||||
header("Content-type: image/png");
|
||||
imagepng($image);
|
||||
exit();
|
||||
} elseif ($page == 'img2') {
|
||||
|
||||
$cache = apcu_cache_info();
|
||||
|
||||
$size = $horizontal_bar_size;
|
||||
$image = imagecreate($size + 5, 140);
|
||||
|
||||
$col_white = imagecolorallocate($image, 0xFF, 0xFF, 0xFF);
|
||||
$col_red = imagecolorallocate($image, 0xD0, 0x60, 0x30);
|
||||
$col_green = imagecolorallocate($image, 0x60, 0xF0, 0x60);
|
||||
$col_black = imagecolorallocate($image, 0, 0, 0);
|
||||
|
||||
imagecolortransparent($image, $col_white);
|
||||
|
||||
$s = $cache['num_hits'] + $cache['num_misses'];
|
||||
$a = $cache['num_hits'];
|
||||
|
||||
fill_box($image, 1, 10, $s ? ($a * ($size - 21) / $s) : $size, 50, $col_black, $col_green /* , sprintf("%.1f%%", $s ? $cache['num_hits'] * 100 / $s : 0) */
|
||||
);
|
||||
fill_box($image, 1, 80, $s ? max(4, ($s - $a) * ($size - 21) / $s) : $size, 50, $col_black, $col_red /* , sprintf("%.1f%%", $s ? $cache['num_misses'] * 100 / $s : 0) */
|
||||
);
|
||||
|
||||
header("Content-type: image/png");
|
||||
imagepng($image);
|
||||
exit();
|
||||
} elseif ($page == 'img3') {
|
||||
|
||||
$mem = apcu_sma_info();
|
||||
|
||||
$size = $horizontal_bar_size;
|
||||
$image = imagecreate($size, 70);
|
||||
|
||||
$col_white = imagecolorallocate($image, 0xFF, 0xFF, 0xFF);
|
||||
$col_red = imagecolorallocate($image, 0xD0, 0x60, 0x30);
|
||||
$col_green = imagecolorallocate($image, 0x60, 0xF0, 0x60);
|
||||
$col_black = imagecolorallocate($image, 0, 0, 0);
|
||||
|
||||
imagecolortransparent($image, $col_white);
|
||||
|
||||
$s = $mem['num_seg'] * $mem['seg_size'];
|
||||
$a = $mem['avail_mem'];
|
||||
$x = 10;
|
||||
$y = 0;
|
||||
|
||||
// This block of code creates the bar chart. It is a lot more complex than you
|
||||
// would expect because we try to visualize any memory fragmentation as well.
|
||||
for ($i = 0; $i < $mem['num_seg']; $i ++) {
|
||||
$ptr = 0;
|
||||
$free = $mem['block_lists'][$i];
|
||||
uasort($free, 'block_sort');
|
||||
foreach ($free as $block) {
|
||||
if ($block['offset'] != $ptr) { // Used block
|
||||
$h = ($size - 5) * ($block['offset'] - $ptr) / $s;
|
||||
if ($h > 0) {
|
||||
fill_box($image, $y, $x, $h, 50, $col_black, $col_red);
|
||||
}
|
||||
$y += $h;
|
||||
}
|
||||
$h = ($size - 5) * ($block['size']) / $s;
|
||||
if ($h > 0) {
|
||||
fill_box($image, $y, $x, $h, 50, $col_black, $col_green);
|
||||
}
|
||||
$y += $h;
|
||||
$ptr = $block['offset'] + $block['size'];
|
||||
}
|
||||
if ($ptr < $mem['seg_size']) { // memory at the end
|
||||
$h = ($size - 5) * ($mem['seg_size'] - $ptr) / $s;
|
||||
if ($h > 0) {
|
||||
fill_box($image, $y, $x, $h, 50, $col_black, $col_red, bsize($mem['seg_size'] - $ptr), $j ++);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
header("Content-type: image/png");
|
||||
imagepng($image);
|
||||
exit();
|
||||
}
|
||||
|
||||
function graphics_avail()
|
||||
{
|
||||
return extension_loaded('gd');
|
||||
}
|
||||
|
||||
// pretty printer for byte values
|
||||
//
|
||||
function bsize($s)
|
||||
{
|
||||
foreach (array(
|
||||
'',
|
||||
'K',
|
||||
'M',
|
||||
'G'
|
||||
) as $i => $k) {
|
||||
if ($s < 1024)
|
||||
break;
|
||||
$s /= 1024;
|
||||
}
|
||||
return sprintf("%5.1f %sBytes", $s, $k);
|
||||
}
|
||||
|
||||
function duration($ts)
|
||||
{
|
||||
global $time;
|
||||
$years = (int) ((($time - $ts) / (7 * 86400)) / 52.177457);
|
||||
$rem = (int) (($time - $ts) - ($years * 52.177457 * 7 * 86400));
|
||||
$weeks = (int) (($rem) / (7 * 86400));
|
||||
$days = (int) (($rem) / 86400) - $weeks * 7;
|
||||
$hours = (int) (($rem) / 3600) - $days * 24 - $weeks * 7 * 24;
|
||||
$mins = (int) (($rem) / 60) - $hours * 60 - $days * 24 * 60 - $weeks * 7 * 24 * 60;
|
||||
$str = '';
|
||||
if ($years == 1)
|
||||
$str .= "$years year, ";
|
||||
if ($years > 1)
|
||||
$str .= "$years years, ";
|
||||
if ($weeks == 1)
|
||||
$str .= "$weeks week, ";
|
||||
if ($weeks > 1)
|
||||
$str .= "$weeks weeks, ";
|
||||
if ($days == 1)
|
||||
$str .= "$days day,";
|
||||
if ($days > 1)
|
||||
$str .= "$days days,";
|
||||
if ($hours == 1)
|
||||
$str .= " $hours hour and";
|
||||
if ($hours > 1)
|
||||
$str .= " $hours hours and";
|
||||
if ($mins == 1)
|
||||
$str .= " 1 minute";
|
||||
else
|
||||
$str .= " $mins minutes";
|
||||
return $str;
|
||||
}
|
||||
|
||||
function block_sort($array1, $array2)
|
||||
{
|
||||
if ($array1['offset'] > $array2['offset']) {
|
||||
return 1;
|
||||
} else {
|
||||
return - 1;
|
||||
}
|
||||
}
|
||||
|
||||
function fill_arc($im, $centerX, $centerY, $diameter, $start, $end, $color1, $color2, $text = '', $placeindex = 0)
|
||||
{
|
||||
$r = $diameter / 2;
|
||||
$w = deg2rad((360 + $start + ($end - $start) / 2) % 360);
|
||||
|
||||
if (function_exists("imagefilledarc")) {
|
||||
// exists only if GD 2.0.1 is available
|
||||
imagefilledarc($im, $centerX + 1, $centerY + 1, $diameter, $diameter, $start, $end, $color1, IMG_ARC_PIE);
|
||||
imagefilledarc($im, $centerX, $centerY, $diameter, $diameter, $start, $end, $color2, IMG_ARC_PIE);
|
||||
imagefilledarc($im, $centerX, $centerY, $diameter, $diameter, $start, $end, $color1, IMG_ARC_NOFILL | IMG_ARC_EDGED);
|
||||
} else {
|
||||
imagearc($im, $centerX, $centerY, $diameter, $diameter, $start, $end, $color2);
|
||||
imageline($im, $centerX, $centerY, $centerX + cos(deg2rad($start)) * $r, $centerY + sin(deg2rad($start)) * $r, $color2);
|
||||
imageline($im, $centerX, $centerY, $centerX + cos(deg2rad($start + 1)) * $r, $centerY + sin(deg2rad($start)) * $r, $color2);
|
||||
imageline($im, $centerX, $centerY, $centerX + cos(deg2rad($end - 1)) * $r, $centerY + sin(deg2rad($end)) * $r, $color2);
|
||||
imageline($im, $centerX, $centerY, $centerX + cos(deg2rad($end)) * $r, $centerY + sin(deg2rad($end)) * $r, $color2);
|
||||
imagefill($im, $centerX + $r * cos($w) / 2, $centerY + $r * sin($w) / 2, $color2);
|
||||
}
|
||||
if ($text) {
|
||||
if ($placeindex > 0) {
|
||||
imageline($im, $centerX + $r * cos($w) / 2, $centerY + $r * sin($w) / 2, $diameter, $placeindex * 12, $color1);
|
||||
imagestring($im, 4, $diameter, $placeindex * 12, $text, $color1);
|
||||
} else {
|
||||
imagestring($im, 4, $centerX + $r * cos($w) / 2, $centerY + $r * sin($w) / 2, $text, $color1);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
function text_arc($im, $centerX, $centerY, $diameter, $start, $end, $color1, $text, $placeindex = 0)
|
||||
{
|
||||
$r = $diameter / 2;
|
||||
$w = deg2rad((360 + $start + ($end - $start) / 2) % 360);
|
||||
|
||||
if ($placeindex > 0) {
|
||||
imageline($im, $centerX + $r * cos($w) / 2, $centerY + $r * sin($w) / 2, $diameter, $placeindex * 12, $color1);
|
||||
imagestring($im, 4, $diameter, $placeindex * 12, $text, $color1);
|
||||
} else {
|
||||
imagestring($im, 4, $centerX + $r * cos($w) / 2, $centerY + $r * sin($w) / 2, $text, $color1);
|
||||
}
|
||||
}
|
||||
|
||||
function fill_box($im, $x, $y, $w, $h, $color1, $color2, $text = '', $placeindex = '')
|
||||
{
|
||||
global $col_black;
|
||||
$x1 = $x + $w - 1;
|
||||
$y1 = $y + $h - 1;
|
||||
|
||||
imagerectangle($im, $x, $y1, $x1 + 1, $y + 1, $col_black);
|
||||
if ($y1 > $y)
|
||||
imagefilledrectangle($im, $x, $y, $x1, $y1, $color2);
|
||||
else
|
||||
imagefilledrectangle($im, $x, $y1, $x1, $y, $color2);
|
||||
imagerectangle($im, $x, $y1, $x1, $y, $color1);
|
||||
if ($text) {
|
||||
if ($placeindex > 0) {
|
||||
|
||||
if ($placeindex < 16) {
|
||||
$px = 5;
|
||||
$py = $placeindex * 12 + 6;
|
||||
imagefilledrectangle($im, $px + 90, $py + 3, $px + 90 - 4, $py - 3, $color2);
|
||||
imageline($im, $x, $y + $h / 2, $px + 90, $py, $color2);
|
||||
imagestring($im, 2, $px, $py - 6, $text, $color1);
|
||||
} else {
|
||||
if ($placeindex < 31) {
|
||||
$px = $x + 40 * 2;
|
||||
$py = ($placeindex - 15) * 12 + 6;
|
||||
} else {
|
||||
$px = $x + 40 * 2 + 100 * intval(($placeindex - 15) / 15);
|
||||
$py = ($placeindex % 15) * 12 + 6;
|
||||
}
|
||||
imagefilledrectangle($im, $px, $py + 3, $px - 4, $py - 3, $color2);
|
||||
imageline($im, $x + $w, $y + $h / 2, $px, $py, $color2);
|
||||
imagestring($im, 2, $px + 2, $py - 6, $text, $color1);
|
||||
}
|
||||
} else {
|
||||
imagestring($im, 4, $x + 5, $y1 - 16, $text, $color1);
|
||||
}
|
||||
}
|
||||
}
|
||||
220
admin_autoupdate.php
Normal file
@@ -0,0 +1,220 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2016 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Michael Kaufmann <mkaufmann@nutime.de>
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Frontend
|
||||
*
|
||||
* @since 0.9.35
|
||||
*
|
||||
*/
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Http\HttpClient;
|
||||
|
||||
// define update-uri
|
||||
define('UPDATE_URI', "https://version.froxlor.org/Froxlor/api/" . $version);
|
||||
define('RELEASE_URI', "https://autoupdate.froxlor.org/froxlor-{version}.zip");
|
||||
define('CHECKSUM_URI', "https://autoupdate.froxlor.org/froxlor-{version}.zip.sha256");
|
||||
|
||||
// check for archive-stuff
|
||||
if (! extension_loaded('zip')) {
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'error',
|
||||
'errno' => 2
|
||||
));
|
||||
}
|
||||
|
||||
// display initial version check
|
||||
if ($page == 'overview') {
|
||||
|
||||
// log our actions
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "checking auto-update");
|
||||
|
||||
// check for new version
|
||||
$latestversion = HttpClient::urlGet(UPDATE_URI);
|
||||
|
||||
$latestversion = explode('|', $latestversion);
|
||||
|
||||
if (is_array($latestversion) && count($latestversion) >= 1) {
|
||||
$_version = $latestversion[0];
|
||||
$_message = isset($latestversion[1]) ? $latestversion[1] : '';
|
||||
$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
|
||||
|
||||
// add the branding so debian guys are not gettings confused
|
||||
// about their version-number
|
||||
$version_label = $_version . $branding;
|
||||
$version_link = $_link;
|
||||
$message_addinfo = $_message;
|
||||
|
||||
// not numeric -> error-message
|
||||
if (! preg_match('/^((\d+\\.)(\d+\\.)(\d+\\.)?(\d+)?(\-(svn|dev|rc)(\d+))?)$/', $_version)) {
|
||||
// check for customized version to not output
|
||||
// "There is a newer version of froxlor" besides the error-message
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'error',
|
||||
'errno' => 3
|
||||
));
|
||||
} elseif (\Froxlor\Froxlor::versionCompare2($version, $_version) == - 1) {
|
||||
// there is a newer version - yay
|
||||
$isnewerversion = 1;
|
||||
} else {
|
||||
// nothing new
|
||||
$isnewerversion = 0;
|
||||
}
|
||||
|
||||
// anzeige über version-status mit ggfls. formular
|
||||
// zum update schritt #1 -> download
|
||||
if ($isnewerversion == 1) {
|
||||
$text = 'There is a newer version available. Update to version <b>' . $_version . '</b> now?<br/>(Your current version is: ' . $version . ')';
|
||||
$hiddenparams = '<input type="hidden" name="newversion" value="' . $_version . '" />';
|
||||
$yesfile = $filename . '?s=' . $s . '&page=getdownload';
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("misc/question_yesno", true) . "\";");
|
||||
exit();
|
||||
} elseif ($isnewerversion == 0) {
|
||||
// all good
|
||||
\Froxlor\UI\Response::standard_success('noupdatesavail');
|
||||
} else {
|
||||
\Froxlor\UI\Response::standard_error('customized_version');
|
||||
}
|
||||
}
|
||||
} // download the new archive
|
||||
elseif ($page == 'getdownload') {
|
||||
|
||||
// retrieve the new version from the form
|
||||
$newversion = isset($_POST['newversion']) ? $_POST['newversion'] : null;
|
||||
|
||||
// valid?
|
||||
if ($newversion !== null) {
|
||||
|
||||
// define files to get
|
||||
$toLoad = str_replace('{version}', $newversion, RELEASE_URI);
|
||||
$toCheck = str_replace('{version}', $newversion, CHECKSUM_URI);
|
||||
|
||||
// check for local destination folder
|
||||
if (! is_dir(\Froxlor\Froxlor::getInstallDir() . '/updates/')) {
|
||||
mkdir(\Froxlor\Froxlor::getInstallDir() . '/updates/');
|
||||
}
|
||||
|
||||
// name archive
|
||||
$localArchive = \Froxlor\Froxlor::getInstallDir() . '/updates/' . basename($toLoad);
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "Downloading " . $toLoad . " to " . $localArchive);
|
||||
|
||||
// remove old archive
|
||||
if (file_exists($localArchive)) {
|
||||
@unlink($localArchive);
|
||||
}
|
||||
|
||||
// get archive data
|
||||
try {
|
||||
HttpClient::fileGet($toLoad, $localArchive);
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'error',
|
||||
'errno' => 4
|
||||
));
|
||||
}
|
||||
|
||||
// validate the integrity of the downloaded file
|
||||
$_shouldsum = HttpClient::urlGet($toCheck);
|
||||
if (! empty($_shouldsum)) {
|
||||
$_t = explode(" ", $_shouldsum);
|
||||
$shouldsum = $_t[0];
|
||||
} else {
|
||||
$shouldsum = null;
|
||||
}
|
||||
$filesum = hash_file('sha256', $localArchive);
|
||||
|
||||
if ($filesum != $shouldsum) {
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'error',
|
||||
'errno' => 9
|
||||
));
|
||||
}
|
||||
|
||||
// to the next step
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'extract',
|
||||
'archive' => basename($localArchive)
|
||||
));
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'error',
|
||||
'errno' => 6
|
||||
));
|
||||
} // extract and install new version
|
||||
elseif ($page == 'extract') {
|
||||
|
||||
$toExtract = isset($_GET['archive']) ? $_GET['archive'] : null;
|
||||
$localArchive = \Froxlor\Froxlor::getInstallDir() . '/updates/' . $toExtract;
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// decompress from zip
|
||||
$zip = new ZipArchive();
|
||||
$res = $zip->open($localArchive);
|
||||
if ($res === true) {
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "Extracting " . $localArchive . " to " . \Froxlor\Froxlor::getInstallDir());
|
||||
$zip->extractTo(\Froxlor\Froxlor::getInstallDir());
|
||||
$zip->close();
|
||||
// success - remove unused archive
|
||||
@unlink($localArchive);
|
||||
} else {
|
||||
// error
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'error',
|
||||
'errno' => 8
|
||||
));
|
||||
}
|
||||
|
||||
// redirect to update-page?
|
||||
\Froxlor\UI\Response::redirectTo('admin_updates.php', array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
|
||||
if (! file_exists($localArchive)) {
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s,
|
||||
'page' => 'error',
|
||||
'errno' => 7
|
||||
));
|
||||
}
|
||||
|
||||
$text = 'Extract downloaded archive "' . $toExtract . '"?';
|
||||
$hiddenparams = '';
|
||||
$yesfile = $filename . '?s=' . $s . '&page=extract&archive=' . $toExtract;
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("misc/question_yesno", true) . "\";");
|
||||
} // display error
|
||||
elseif ($page == 'error') {
|
||||
|
||||
// retrieve error-number via url-parameter
|
||||
$errno = isset($_GET['errno']) ? (int) $_GET['errno'] : 0;
|
||||
|
||||
// 2 = no Zlib
|
||||
// 3 = custom version detected
|
||||
// 4 = could not store archive to local hdd
|
||||
// 5 = some weird value came from version.froxlor.org
|
||||
// 6 = download without valid version
|
||||
// 7 = local archive does not exist
|
||||
// 8 = could not extract archive
|
||||
// 9 = checksum mismatch
|
||||
\Froxlor\UI\Response::standard_error('autoupdate_' . $errno);
|
||||
}
|
||||
@@ -2,7 +2,6 @@
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2003-2009 the SysCP Team (see authors).
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
@@ -10,174 +9,258 @@
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
*
|
||||
* @since 0.9.34
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
$need_db_sql_data = true;
|
||||
require './lib/init.php';
|
||||
require './lib/configfiles_index.inc.php';
|
||||
|
||||
$distribution = '';
|
||||
$distributions_select = '';
|
||||
$service = '';
|
||||
$services_select = '';
|
||||
$daemon = '';
|
||||
$daemons_select = '';
|
||||
use Froxlor\Settings;
|
||||
|
||||
if($userinfo['change_serversettings'] == '1')
|
||||
{
|
||||
if(isset($_GET['distribution'])
|
||||
&& $_GET['distribution'] != ''
|
||||
&& isset($configfiles[$_GET['distribution']])
|
||||
&& is_array($configfiles[$_GET['distribution']]))
|
||||
{
|
||||
$distribution = $_GET['distribution'];
|
||||
if ($userinfo['change_serversettings'] == '1') {
|
||||
|
||||
if(isset($_GET['service'])
|
||||
&& $_GET['service'] != ''
|
||||
&& isset($configfiles[$distribution]['services'][$_GET['service']])
|
||||
&& is_array($configfiles[$distribution]['services'][$_GET['service']]))
|
||||
{
|
||||
$service = $_GET['service'];
|
||||
if ($action == 'setconfigured') {
|
||||
Settings::Set('panel.is_configured', '1', true);
|
||||
\Froxlor\UI\Response::redirectTo('admin_configfiles.php', array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
|
||||
if(isset($_GET['daemon'])
|
||||
&& $_GET['daemon'] != ''
|
||||
&& isset($configfiles[$distribution]['services'][$service]['daemons'][$_GET['daemon']])
|
||||
&& is_array($configfiles[$distribution]['services'][$service]['daemons'][$_GET['daemon']]))
|
||||
{
|
||||
$daemon = $_GET['daemon'];
|
||||
$customer_tmpdir = '/tmp/';
|
||||
if (Settings::Get('system.mod_fcgid') == '1' && Settings::Get('system.mod_fcgid_tmpdir') != '') {
|
||||
$customer_tmpdir = Settings::Get('system.mod_fcgid_tmpdir');
|
||||
} elseif (Settings::Get('phpfpm.enabled') == '1' && Settings::Get('phpfpm.tmpdir') != '') {
|
||||
$customer_tmpdir = Settings::Get('phpfpm.tmpdir');
|
||||
}
|
||||
else
|
||||
{
|
||||
foreach($configfiles[$distribution]['services'][$service]['daemons'] as $daemon_name => $daemon_details)
|
||||
{
|
||||
$daemons_select.= makeoption($daemon_details['label'], $daemon_name);
|
||||
|
||||
// try to convert namserver hosts to ip's
|
||||
$ns_ips = "";
|
||||
if (Settings::Get('system.nameservers') != '') {
|
||||
$nameservers = explode(',', Settings::Get('system.nameservers'));
|
||||
foreach ($nameservers as $nameserver) {
|
||||
$nameserver = trim($nameserver);
|
||||
$nameserver_ips = \Froxlor\PhpHelper::gethostbynamel6($nameserver);
|
||||
if (is_array($nameserver_ips) && count($nameserver_ips) > 0) {
|
||||
$ns_ips .= implode(",", $nameserver_ips);
|
||||
}
|
||||
}
|
||||
}
|
||||
else
|
||||
{
|
||||
foreach($configfiles[$distribution]['services'] as $service_name => $service_details)
|
||||
{
|
||||
$services_select.= makeoption($service_details['label'], $service_name);
|
||||
}
|
||||
}
|
||||
}
|
||||
else
|
||||
{
|
||||
foreach($configfiles as $distribution_name => $distribution_details)
|
||||
{
|
||||
$distributions_select.= makeoption($distribution_details['label'], $distribution_name);
|
||||
}
|
||||
}
|
||||
|
||||
if($distribution != ''
|
||||
&& $service != ''
|
||||
&& $daemon != '')
|
||||
{
|
||||
$replace_arr = Array(
|
||||
'<SQL_UNPRIVILEGED_USER>' => $sql['user'],
|
||||
'<SQL_UNPRIVILEGED_PASSWORD>' => 'MYSQL_PASSWORD',
|
||||
'<SQL_UNPRIVILEGED_PASSWORD>' => 'FROXLOR_MYSQL_PASSWORD',
|
||||
'<SQL_DB>' => $sql['db'],
|
||||
'<SQL_HOST>' => $sql['host'],
|
||||
'<SQL_SOCKET>' => isset($sql['socket']) ? $sql['socket'] : null,
|
||||
'<SERVERNAME>' => Settings::Get('system.hostname'),
|
||||
'<SERVERIP>' => Settings::Get('system.ipaddress'),
|
||||
'<NAMESERVERS>' => Settings::Get('system.nameservers'),
|
||||
'<NAMESERVERS_IP>' => $ns_ips,
|
||||
'<AXFRSERVERS>' => Settings::Get('system.axfrservers'),
|
||||
'<VIRTUAL_MAILBOX_BASE>' => Settings::Get('system.vmail_homedir'),
|
||||
'<VIRTUAL_UID_MAPS>' => Settings::Get('system.vmail_uid'),
|
||||
'<VIRTUAL_GID_MAPS>' => Settings::Get('system.vmail_gid'),
|
||||
'<SSLPROTOCOLS>' => (Settings::Get('system.use_ssl') == '1') ? 'imaps pop3s' : '',
|
||||
'<CUSTOMER_TMP>' => (Settings::Get('system.mod_fcgid_tmpdir') != '') ? makeCorrectDir(Settings::Get('system.mod_fcgid_tmpdir')) : '/tmp/',
|
||||
'<BASE_PATH>' => makeCorrectDir(FROXLOR_INSTALL_DIR),
|
||||
'<BIND_CONFIG_PATH>' => makeCorrectDir(Settings::Get('system.bindconf_directory')),
|
||||
'<CUSTOMER_TMP>' => \Froxlor\FileDir::makeCorrectDir($customer_tmpdir),
|
||||
'<BASE_PATH>' => \Froxlor\FileDir::makeCorrectDir(\Froxlor\Froxlor::getInstallDir()),
|
||||
'<BIND_CONFIG_PATH>' => \Froxlor\FileDir::makeCorrectDir(Settings::Get('system.bindconf_directory')),
|
||||
'<WEBSERVER_RELOAD_CMD>' => Settings::Get('system.apachereload_command'),
|
||||
'<CUSTOMER_LOGS>' => makeCorrectDir(Settings::Get('system.logfiles_directory')),
|
||||
'<FPM_IPCDIR>' => makeCorrectDir(Settings::Get('phpfpm.fastcgi_ipcdir')),
|
||||
'<CUSTOMER_LOGS>' => \Froxlor\FileDir::makeCorrectDir(Settings::Get('system.logfiles_directory')),
|
||||
'<FPM_IPCDIR>' => \Froxlor\FileDir::makeCorrectDir(Settings::Get('phpfpm.fastcgi_ipcdir')),
|
||||
'<WEBSERVER_GROUP>' => Settings::Get('system.httpgroup')
|
||||
);
|
||||
$files = '';
|
||||
|
||||
// get distro from URL param
|
||||
$distribution = (isset($_GET['distribution']) && $_GET['distribution'] != 'choose') ? $_GET['distribution'] : "";
|
||||
$service = (isset($_GET['service']) && $_GET['service'] != 'choose') ? $_GET['service'] : "";
|
||||
$daemon = (isset($_GET['daemon']) && $_GET['daemon'] != 'choose') ? $_GET['daemon'] : "";
|
||||
$distributions_select = "";
|
||||
$services_select = "";
|
||||
$daemons_select = "";
|
||||
|
||||
$configfiles = "";
|
||||
$services = "";
|
||||
$daemons = "";
|
||||
|
||||
$config_dir = \Froxlor\FileDir::makeCorrectDir(\Froxlor\Froxlor::getInstallDir() . '/lib/configfiles/');
|
||||
|
||||
if ($distribution != "") {
|
||||
|
||||
if (! file_exists($config_dir . '/' . $distribution . ".xml")) {
|
||||
trigger_error("Unknown distribution, are you playing around with the URL?");
|
||||
exit();
|
||||
}
|
||||
|
||||
// create configparser object
|
||||
$configfiles = new \Froxlor\Config\ConfigParser($config_dir . '/' . $distribution . ".xml");
|
||||
|
||||
// get distro-info
|
||||
$dist_display = getCompleteDistroName($configfiles);
|
||||
|
||||
// get all the services from the distro
|
||||
$services = $configfiles->getServices();
|
||||
|
||||
if ($service != "") {
|
||||
|
||||
if (! isset($services[$service])) {
|
||||
trigger_error("Unknown service, are you playing around with the URL?");
|
||||
exit();
|
||||
}
|
||||
|
||||
$daemons = $services[$service]->getDaemons();
|
||||
|
||||
if ($daemon == "") {
|
||||
foreach ($daemons as $di => $dd) {
|
||||
$title = $dd->title;
|
||||
if ($dd->default) {
|
||||
$title = $title . " (" . strtolower($lng['panel']['default']) . ")";
|
||||
}
|
||||
$daemons_select .= \Froxlor\UI\HTML::makeoption($title, $di);
|
||||
}
|
||||
}
|
||||
} else {
|
||||
foreach ($services as $si => $sd) {
|
||||
$services_select .= \Froxlor\UI\HTML::makeoption($sd->title, $si);
|
||||
}
|
||||
}
|
||||
} else {
|
||||
|
||||
// show list of available distro's
|
||||
$distros = glob($config_dir . '*.xml');
|
||||
// tmp array
|
||||
$distributions_select_data = array();
|
||||
// read in all the distros
|
||||
foreach ($distros as $_distribution) {
|
||||
// get configparser object
|
||||
$dist = new \Froxlor\Config\ConfigParser($_distribution);
|
||||
// get distro-info
|
||||
$dist_display = getCompleteDistroName($dist);
|
||||
// store in tmp array
|
||||
$distributions_select_data[$dist_display] = str_replace(".xml", "", strtolower(basename($_distribution)));
|
||||
}
|
||||
|
||||
// sort by distribution name
|
||||
ksort($distributions_select_data);
|
||||
|
||||
foreach ($distributions_select_data as $dist_display => $dist_index) {
|
||||
// create select-box-option
|
||||
$distributions_select .= \Froxlor\UI\HTML::makeoption($dist_display, $dist_index);
|
||||
}
|
||||
}
|
||||
|
||||
if ($distribution != "" && $service != "" && $daemon != "") {
|
||||
|
||||
if (! isset($daemons[$daemon])) {
|
||||
trigger_error("Unknown daemon, are you playing around with the URL?");
|
||||
exit();
|
||||
}
|
||||
|
||||
$confarr = $daemons[$daemon]->getConfig();
|
||||
|
||||
$configpage = '';
|
||||
foreach($configfiles[$distribution]['services'][$service]['daemons'][$daemon] as $action => $value)
|
||||
{
|
||||
if(substr($action, 0, 8) == 'commands')
|
||||
{
|
||||
|
||||
$distro_editor = $configfiles->distributionEditor;
|
||||
|
||||
$commands_pre = "";
|
||||
$commands_file = "";
|
||||
$commands_post = "";
|
||||
|
||||
$lasttype = '';
|
||||
$commands = '';
|
||||
|
||||
if(is_array($value))
|
||||
{
|
||||
$commands = implode("\n", $value);
|
||||
$commands = str_replace("\n\n", "\n", $commands);
|
||||
|
||||
if($commands != '')
|
||||
{
|
||||
eval("\$configpage.=\"" . getTemplate("configfiles/configfiles_commands") . "\";");
|
||||
foreach ($confarr as $_action) {
|
||||
if ($lasttype != '' && $lasttype != $_action['type']) {
|
||||
$commands = trim($commands);
|
||||
$numbrows = count(explode("\n", $commands));
|
||||
eval("\$configpage.=\"" . \Froxlor\UI\Template::getTemplate("configfiles/configfiles_commands") . "\";");
|
||||
$lasttype = '';
|
||||
$commands = '';
|
||||
}
|
||||
switch ($_action['type']) {
|
||||
case "install":
|
||||
$commands .= strtr($_action['content'], $replace_arr) . "\n";
|
||||
$lasttype = "install";
|
||||
break;
|
||||
case "command":
|
||||
$commands .= strtr($_action['content'], $replace_arr) . "\n";
|
||||
$lasttype = "command";
|
||||
break;
|
||||
case "file":
|
||||
if (array_key_exists('content', $_action)) {
|
||||
$commands_file = getFileContentContainer($_action['content'], $replace_arr, $_action['name'], $distro_editor);
|
||||
} elseif (array_key_exists('subcommands', $_action)) {
|
||||
foreach ($_action['subcommands'] as $fileaction) {
|
||||
if (array_key_exists('execute', $fileaction) && $fileaction['execute'] == "pre") {
|
||||
$commands_pre .= $fileaction['content'] . "\n";
|
||||
} elseif (array_key_exists('execute', $fileaction) && $fileaction['execute'] == "post") {
|
||||
$commands_post .= $fileaction['content'] . "\n";
|
||||
} elseif ($fileaction['type'] == 'file') {
|
||||
$commands_file = getFileContentContainer($fileaction['content'], $replace_arr, $_action['name'], $distro_editor);
|
||||
}
|
||||
}
|
||||
}
|
||||
elseif(substr($action, 0, 5) == 'files')
|
||||
{
|
||||
$files = '';
|
||||
$realname = $_action['name'];
|
||||
$commands = trim($commands_pre);
|
||||
if ($commands != "") {
|
||||
$numbrows = count(explode("\n", $commands));
|
||||
eval("\$commands_pre=\"" . \Froxlor\UI\Template::getTemplate("configfiles/configfiles_commands") . "\";");
|
||||
}
|
||||
$commands = trim($commands_post);
|
||||
if ($commands != "") {
|
||||
$numbrows = count(explode("\n", $commands));
|
||||
eval("\$commands_post=\"" . \Froxlor\UI\Template::getTemplate("configfiles/configfiles_commands") . "\";");
|
||||
}
|
||||
eval("\$configpage.=\"" . \Froxlor\UI\Template::getTemplate("configfiles/configfiles_subfileblock") . "\";");
|
||||
$commands = '';
|
||||
$commands_pre = '';
|
||||
$commands_post = '';
|
||||
break;
|
||||
}
|
||||
}
|
||||
$commands = trim($commands);
|
||||
if ($commands != '') {
|
||||
$numbrows = count(explode("\n", $commands));
|
||||
eval("\$configpage.=\"" . \Froxlor\UI\Template::getTemplate("configfiles/configfiles_commands") . "\";");
|
||||
}
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("configfiles/configfiles") . "\";");
|
||||
} else {
|
||||
$basedir = \Froxlor\Froxlor::getInstallDir();
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("configfiles/wizard") . "\";");
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::redirectTo('admin_index.php', array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
|
||||
if(is_array($value))
|
||||
// helper functions
|
||||
function getFileContentContainer($file_content, &$replace_arr, $realname, $distro_editor)
|
||||
{
|
||||
while(list($filename, $realname) = each($value))
|
||||
{
|
||||
$file_content = file_get_contents('./templates/misc/configfiles/' . $distribution . '/' . $daemon . '/' . $filename);
|
||||
$files = "";
|
||||
$file_content = trim($file_content);
|
||||
if ($file_content != '') {
|
||||
$file_content = strtr($file_content, $replace_arr);
|
||||
$file_content = htmlspecialchars($file_content);
|
||||
$numbrows = count(explode("\n", $file_content));
|
||||
eval("\$files.=\"" . getTemplate("configfiles/configfiles_file") . "\";");
|
||||
eval("\$files=\"" . \Froxlor\UI\Template::getTemplate("configfiles/configfiles_file") . "\";");
|
||||
}
|
||||
return $files;
|
||||
}
|
||||
|
||||
eval("\$configpage.=\"" . getTemplate("configfiles/configfiles_files") . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
if(isset($configfiles[$distribution]['services'][$service]['daemons'][$daemon]['restart'])
|
||||
&& is_array($configfiles[$distribution]['services'][$service]['daemons'][$daemon]['restart']))
|
||||
function getCompleteDistroName($cparser)
|
||||
{
|
||||
$restart = implode("\n", $configfiles[$distribution]['services'][$service]['daemons'][$daemon]['restart']);
|
||||
// get distro-info
|
||||
$dist_display = $cparser->distributionName;
|
||||
if ($cparser->distributionCodename != '') {
|
||||
$dist_display .= " " . $cparser->distributionCodename;
|
||||
}
|
||||
else
|
||||
{
|
||||
$restart = '';
|
||||
if ($cparser->distributionVersion != '') {
|
||||
$dist_display .= " (" . $cparser->distributionVersion . ")";
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("configfiles/configfiles") . "\";");
|
||||
if ($cparser->deprecated) {
|
||||
$dist_display .= " [deprecated]";
|
||||
}
|
||||
elseif($page == 'overview')
|
||||
{
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_configfiles");
|
||||
$distributions = '';
|
||||
foreach($configfiles as $distribution_name => $distribution_details)
|
||||
{
|
||||
$services = '';
|
||||
foreach($distribution_details['services'] as $service_name => $service_details)
|
||||
{
|
||||
$daemons = '';
|
||||
foreach($service_details['daemons'] as $daemon_name => $daemon_details)
|
||||
{
|
||||
eval("\$daemons.=\"" . getTemplate("configfiles/choose_daemon") . "\";");
|
||||
return $dist_display;
|
||||
}
|
||||
|
||||
eval("\$services.=\"" . getTemplate("configfiles/choose_service") . "\";");
|
||||
}
|
||||
|
||||
eval("\$distributions.=\"" . getTemplate("configfiles/choose_distribution") . "\";");
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("configfiles/choose") . "\";");
|
||||
}
|
||||
else
|
||||
{
|
||||
eval("echo \"" . getTemplate("configfiles/wizard") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
?>
|
||||
|
||||
@@ -14,10 +14,12 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Api\Commands\Cronjobs as Cronjobs;
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
@@ -26,14 +28,14 @@ if (isset($_POST['id'])) {
|
||||
|
||||
if ($page == 'cronjobs' || $page == 'overview') {
|
||||
if ($action == '') {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs');
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'viewed admin_cronjobs');
|
||||
|
||||
$fields = array(
|
||||
'c.lastrun' => $lng['cron']['lastrun'],
|
||||
'c.interval' => $lng['cron']['interval'],
|
||||
'c.isactive' => $lng['cron']['isactive']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_CRONRUNS, $fields);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_CRONRUNS, $fields);
|
||||
|
||||
$crons = '';
|
||||
$result_stmt = Database::prepare("SELECT `c`.* FROM `" . TABLE_PANEL_CRONRUNS . "` `c` ORDER BY `module` ASC, `cronfile` ASC");
|
||||
@@ -52,57 +54,49 @@ if ($page == 'cronjobs' || $page == 'overview') {
|
||||
if ($cmod != $row['module']) {
|
||||
$_mod = explode("/", $row['module']);
|
||||
$module = ucfirst($_mod[1]);
|
||||
eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjobmodule') . "\";");
|
||||
eval("\$crons.=\"" . \Froxlor\UI\Template::getTemplate('cronjobs/cronjobs_cronjobmodule') . "\";");
|
||||
$cmod = $row['module'];
|
||||
}
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$row = htmlentities_array($row);
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
|
||||
$row['lastrun'] = date('d.m.Y H:i', $row['lastrun']);
|
||||
$row['isactive'] = ((int) $row['isactive'] == 1) ? $lng['panel']['yes'] : $lng['panel']['no'];
|
||||
|
||||
$description = $lng['crondesc'][$row['desc_lng_key']];
|
||||
|
||||
eval("\$crons.=\"" . getTemplate('cronjobs/cronjobs_cronjob') . "\";");
|
||||
eval("\$crons.=\"" . \Froxlor\UI\Template::getTemplate('cronjobs/cronjobs_cronjob') . "\";");
|
||||
$count ++;
|
||||
}
|
||||
|
||||
$i ++;
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('cronjobs/cronjobs') . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('cronjobs/cronjobs') . "\";");
|
||||
} elseif ($action == 'new') {
|
||||
/*
|
||||
* @TODO later
|
||||
*/
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_CRONRUNS . "` WHERE `id`= :id");
|
||||
Database::pexecute($result_stmt, array('id' => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = Cronjobs::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
if ($result['cronfile'] != '') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$isactive = isset($_POST['isactive']) ? 1 : 0;
|
||||
$interval_value = validate($_POST['interval_value'], 'interval_value', '/^([0-9]+)$/Di', 'stringisempty');
|
||||
$interval_interval = validate($_POST['interval_interval'], 'interval_interval');
|
||||
|
||||
if ($isactive != 1) {
|
||||
$isactive = 0;
|
||||
try {
|
||||
Cronjobs::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
$interval = $interval_value . ' ' . strtoupper($interval_interval);
|
||||
|
||||
$upd = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_CRONRUNS . "`
|
||||
SET `isactive` = :isactive, `interval` = :int
|
||||
WHERE `id` = :id"
|
||||
);
|
||||
Database::pexecute($upd, array('isactive' => $isactive, 'int' => $interval, 'id' => $id));
|
||||
|
||||
// insert task to re-generate the cron.d-file
|
||||
inserttask('99');
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
// interval
|
||||
@@ -110,11 +104,11 @@ if ($page == 'cronjobs' || $page == 'overview') {
|
||||
$interval_value = $interval_nfo[0];
|
||||
|
||||
$interval_interval = '';
|
||||
$interval_interval .= makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
|
||||
$interval_interval .= makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
|
||||
$interval_interval .= makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
|
||||
$interval_interval .= makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
|
||||
$interval_interval .= makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
|
||||
$interval_interval .= \Froxlor\UI\HTML::makeoption($lng['cronmgmt']['minutes'], 'MINUTE', $interval_nfo[1]);
|
||||
$interval_interval .= \Froxlor\UI\HTML::makeoption($lng['cronmgmt']['hours'], 'HOUR', $interval_nfo[1]);
|
||||
$interval_interval .= \Froxlor\UI\HTML::makeoption($lng['cronmgmt']['days'], 'DAY', $interval_nfo[1]);
|
||||
$interval_interval .= \Froxlor\UI\HTML::makeoption($lng['cronmgmt']['weeks'], 'WEEK', $interval_nfo[1]);
|
||||
$interval_interval .= \Froxlor\UI\HTML::makeoption($lng['cronmgmt']['months'], 'MONTH', $interval_nfo[1]);
|
||||
// end of interval
|
||||
|
||||
$change_cronfile = false;
|
||||
@@ -123,16 +117,15 @@ if ($page == 'cronjobs' || $page == 'overview') {
|
||||
}
|
||||
|
||||
$cronjobs_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/cronjobs/formfield.cronjobs_edit.php';
|
||||
$cronjobs_edit_form = htmlform::genHTMLForm($cronjobs_edit_data);
|
||||
$cronjobs_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($cronjobs_edit_data);
|
||||
|
||||
$title = $cronjobs_edit_data['cronjobs_edit']['title'];
|
||||
$image = $cronjobs_edit_data['cronjobs_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate('cronjobs/cronjob_edit') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('cronjobs/cronjob_edit') . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
elseif ($action == 'delete' && $id != 0) {
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
/*
|
||||
* @TODO later
|
||||
*/
|
||||
|
||||
1630
admin_customers.php
1788
admin_domains.php
312
admin_index.php
@@ -16,33 +16,36 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\Froxlor as Froxlor;
|
||||
use Froxlor\Api\Commands\Admins as Admins;
|
||||
|
||||
if ($action == 'logout') {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "logged out");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "logged out");
|
||||
|
||||
$params = array('adminid' => (int)$userinfo['adminid']);
|
||||
$params = array(
|
||||
'adminid' => (int) $userinfo['adminid']
|
||||
);
|
||||
|
||||
if (Settings::Get('session.allow_multiple_login') == '1') {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_SESSIONS . "`
|
||||
WHERE `userid` = :adminid
|
||||
AND `adminsession` = '1'
|
||||
AND `hash` = :hash"
|
||||
);
|
||||
AND `hash` = :hash");
|
||||
$params['hash'] = $s;
|
||||
} else {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_SESSIONS . "`
|
||||
WHERE `userid` = :adminid
|
||||
AND `adminsession` = '1'"
|
||||
);
|
||||
AND `adminsession` = '1'");
|
||||
}
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
redirectTo('index.php');
|
||||
exit;
|
||||
\Froxlor\UI\Response::redirectTo('index.php');
|
||||
}
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
@@ -52,7 +55,8 @@ if (isset($_POST['id'])) {
|
||||
}
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_index");
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed admin_index");
|
||||
$overview_stmt = Database::prepare("SELECT COUNT(*) AS `number_customers`,
|
||||
SUM(`diskspace_used`) AS `diskspace_used`,
|
||||
SUM(`mysqls_used`) AS `mysqls_used`,
|
||||
@@ -61,11 +65,12 @@ if ($page == 'overview') {
|
||||
SUM(`email_forwarders_used`) AS `email_forwarders_used`,
|
||||
SUM(`email_quota_used`) AS `email_quota_used`,
|
||||
SUM(`ftps_used`) AS `ftps_used`,
|
||||
SUM(`tickets_used`) AS `tickets_used`,
|
||||
SUM(`subdomains_used`) AS `subdomains_used`,
|
||||
SUM(`traffic_used`) AS `traffic_used`
|
||||
FROM `" . TABLE_PANEL_CUSTOMERS . "`" . ($userinfo['customers_see_all'] ? '' : " WHERE `adminid` = :adminid "));
|
||||
$overview = Database::pexecute_first($overview_stmt, array('adminid' => $userinfo['adminid']));
|
||||
$overview = Database::pexecute_first($overview_stmt, array(
|
||||
'adminid' => $userinfo['adminid']
|
||||
));
|
||||
|
||||
$dec_places = Settings::Get('panel.decimal_places');
|
||||
$overview['traffic_used'] = round($overview['traffic_used'] / (1024 * 1024), $dec_places);
|
||||
@@ -73,9 +78,10 @@ if ($page == 'overview') {
|
||||
|
||||
$number_domains_stmt = Database::prepare("
|
||||
SELECT COUNT(*) AS `number_domains` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `parentdomainid`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = :adminid")
|
||||
);
|
||||
$number_domains = Database::pexecute_first($number_domains_stmt, array('adminid' => $userinfo['adminid']));
|
||||
WHERE `parentdomainid`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = :adminid"));
|
||||
$number_domains = Database::pexecute_first($number_domains_stmt, array(
|
||||
'adminid' => $userinfo['adminid']
|
||||
));
|
||||
|
||||
$overview['number_domains'] = $number_domains['number_domains'];
|
||||
|
||||
@@ -83,52 +89,23 @@ if ($page == 'overview') {
|
||||
$mysqlserverversion = Database::getAttribute(PDO::ATTR_SERVER_VERSION);
|
||||
$webserverinterface = strtoupper(@php_sapi_name());
|
||||
|
||||
if ((isset($_GET['lookfornewversion']) && $_GET['lookfornewversion'] == 'yes')
|
||||
|| (isset($lookfornewversion) && $lookfornewversion == 'yes')
|
||||
) {
|
||||
$update_check_uri = 'http://version.froxlor.org/Froxlor/legacy/' . $version;
|
||||
|
||||
if (ini_get('allow_url_fopen')) {
|
||||
$latestversion = @file($update_check_uri);
|
||||
|
||||
if (isset($latestversion[0])) {
|
||||
$latestversion = explode('|', $latestversion[0]);
|
||||
|
||||
if (is_array($latestversion)
|
||||
&& count($latestversion) >= 1
|
||||
) {
|
||||
$_version = $latestversion[0];
|
||||
$_message = isset($latestversion[1]) ? $latestversion[1] : '';
|
||||
$_link = isset($latestversion[2]) ? $latestversion[2] : htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
|
||||
|
||||
// add the branding so debian guys are not gettings confused
|
||||
// about their version-number
|
||||
$lookfornewversion_lable = $_version.$branding;
|
||||
$lookfornewversion_link = $_link;
|
||||
$lookfornewversion_addinfo = $_message;
|
||||
|
||||
// not numeric -> error-message
|
||||
if (!preg_match('/^((\d+\\.)(\d+\\.)(\d+\\.)?(\d+)?(\-(svn|dev|rc)(\d+))?)$/', $_version)) {
|
||||
// check for customized version to not output
|
||||
// "There is a newer version of froxlor" besides the error-message
|
||||
$isnewerversion = 2;
|
||||
} elseif (version_compare2($version, $_version) == -1) {
|
||||
$isnewerversion = 1;
|
||||
} else {
|
||||
$isnewerversion = 0;
|
||||
}
|
||||
} else {
|
||||
redirectTo($update_check_uri.'/pretty', NULL, false);
|
||||
}
|
||||
} else {
|
||||
redirectTo($update_check_uri.'/pretty', NULL, false);
|
||||
}
|
||||
} else {
|
||||
redirectTo($update_check_uri.'/pretty', NULL, false);
|
||||
if ((isset($_GET['lookfornewversion']) && $_GET['lookfornewversion'] == 'yes') || (isset($lookfornewversion) && $lookfornewversion == 'yes')) {
|
||||
try {
|
||||
$json_result = Froxlor::getLocal($userinfo)->checkUpdate();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
$lookfornewversion_lable = $result['version'];
|
||||
$lookfornewversion_link = $result['link'];
|
||||
$lookfornewversion_message = $result['message'];
|
||||
$lookfornewversion_addinfo = $result['additional_info'];
|
||||
$isnewerversion = $result['isnewerversion'];
|
||||
} else {
|
||||
$lookfornewversion_lable = $lng['admin']['lookfornewversion']['clickhere'];
|
||||
$lookfornewversion_link = htmlspecialchars($filename . '?s=' . urlencode($s) . '&page=' . urlencode($page) . '&lookfornewversion=yes');
|
||||
$lookfornewversion_message = '';
|
||||
$lookfornewversion_addinfo = '';
|
||||
$isnewerversion = 0;
|
||||
}
|
||||
@@ -138,12 +115,21 @@ if ($page == 'overview') {
|
||||
$userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, $dec_places);
|
||||
$userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), $dec_places);
|
||||
$userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), $dec_places);
|
||||
$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps tickets subdomains');
|
||||
$userinfo = \Froxlor\PhpHelper::strReplaceArray('-1', $lng['customer']['unlimited'], $userinfo, 'customers domains diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps subdomains');
|
||||
|
||||
$userinfo['custom_notes'] = ($userinfo['custom_notes'] != '') ? nl2br($userinfo['custom_notes']) : '';
|
||||
|
||||
$cron_last_runs = getCronjobsLastRun();
|
||||
$outstanding_tasks = getOutstandingTasks();
|
||||
$cron_last_runs = \Froxlor\System\Cronjob::getCronjobsLastRun();
|
||||
$outstanding_tasks = \Froxlor\System\Cronjob::getOutstandingTasks();
|
||||
|
||||
$system_hostname = gethostname();
|
||||
$meminfo = explode("\n", @file_get_contents("/proc/meminfo"));
|
||||
$memory = "";
|
||||
for ($i = 0; $i < sizeof($meminfo); ++ $i) {
|
||||
if (substr($meminfo[$i], 0, 3) === "Mem") {
|
||||
$memory .= $meminfo[$i] . PHP_EOL;
|
||||
}
|
||||
}
|
||||
|
||||
if (function_exists('sys_getloadavg')) {
|
||||
$loadArray = sys_getloadavg();
|
||||
@@ -169,10 +155,7 @@ if ($page == 'overview') {
|
||||
// First: With exec (let's hope it's enabled for the Froxlor - vHost)
|
||||
$uptime_array = explode(" ", @file_get_contents("/proc/uptime"));
|
||||
|
||||
if (is_array($uptime_array)
|
||||
&& isset($uptime_array[0])
|
||||
&& is_numeric($uptime_array[0])
|
||||
) {
|
||||
if (is_array($uptime_array) && isset($uptime_array[0]) && is_numeric($uptime_array[0])) {
|
||||
// Some calculatioon to get a nicly formatted display
|
||||
$seconds = round($uptime_array[0], 0);
|
||||
$minutes = $seconds / 60;
|
||||
@@ -190,82 +173,82 @@ if ($page == 'overview') {
|
||||
$uptime = '';
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("index/index") . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("index/index") . "\";");
|
||||
} elseif ($page == 'change_password') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$old_password = validate($_POST['old_password'], 'old password');
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$old_password = \Froxlor\Validate\Validate::validate($_POST['old_password'], 'old password');
|
||||
|
||||
if (md5($old_password) != $userinfo['password']) {
|
||||
standard_error('oldpasswordnotcorrect');
|
||||
exit;
|
||||
if (! \Froxlor\System\Crypt::validatePasswordLogin($userinfo, $old_password, TABLE_PANEL_ADMINS, 'adminid')) {
|
||||
\Froxlor\UI\Response::standard_error('oldpasswordnotcorrect');
|
||||
}
|
||||
|
||||
$new_password = validate($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
|
||||
$new_password = \Froxlor\Validate\Validate::validate($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = \Froxlor\Validate\Validate::validate($_POST['new_password_confirm'], 'new password confirm');
|
||||
|
||||
if ($old_password == '') {
|
||||
standard_error(array('stringisempty', 'oldpassword'));
|
||||
} elseif($new_password == '') {
|
||||
standard_error(array('stringisempty', 'newpassword'));
|
||||
} elseif($new_password_confirm == '') {
|
||||
standard_error(array('stringisempty', 'newpasswordconfirm'));
|
||||
} elseif($new_password != $new_password_confirm) {
|
||||
standard_error('newpasswordconfirmerror');
|
||||
} else {
|
||||
$chgpwd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_ADMINS . "`
|
||||
SET `password`= :newpasswd
|
||||
WHERE `adminid`= :adminid
|
||||
AND `password`= :oldpasswd"
|
||||
);
|
||||
Database::pexecute($chgpwd_stmt, array(
|
||||
'newpasswd' => md5($new_password),
|
||||
'adminid' => (int)$userinfo['adminid'],
|
||||
'oldpasswd' => md5($old_password)
|
||||
\Froxlor\UI\Response::standard_error(array(
|
||||
'stringisempty',
|
||||
'oldpassword'
|
||||
));
|
||||
} elseif ($new_password == '') {
|
||||
\Froxlor\UI\Response::standard_error(array(
|
||||
'stringisempty',
|
||||
'newpassword'
|
||||
));
|
||||
} elseif ($new_password_confirm == '') {
|
||||
\Froxlor\UI\Response::standard_error(array(
|
||||
'stringisempty',
|
||||
'newpasswordconfirm'
|
||||
));
|
||||
} elseif ($new_password != $new_password_confirm) {
|
||||
\Froxlor\UI\Response::standard_error('newpasswordconfirmerror');
|
||||
} else {
|
||||
try {
|
||||
Admins::getLocal($userinfo, array(
|
||||
'id' => $userinfo['adminid'],
|
||||
'admin_password' => $new_password
|
||||
))->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'changed password');
|
||||
\Froxlor\UI\Response::redirectTo($filename, Array(
|
||||
's' => $s
|
||||
));
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, 'changed password');
|
||||
redirectTo($filename, Array('s' => $s));
|
||||
}
|
||||
} else {
|
||||
eval("echo \"" . getTemplate("index/change_password") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("index/change_password") . "\";");
|
||||
}
|
||||
|
||||
} elseif ($page == 'change_language') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$def_language = validate($_POST['def_language'], 'default language');
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$def_language = \Froxlor\Validate\Validate::validate($_POST['def_language'], 'default language');
|
||||
|
||||
if (isset($languages[$def_language])) {
|
||||
$lng_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_ADMINS . "`
|
||||
SET `def_language`= :deflng
|
||||
WHERE `adminid`= :adminid"
|
||||
);
|
||||
Database::pexecute($lng_stmt, array(
|
||||
'deflng' => $def_language,
|
||||
'adminid' => (int)$userinfo['adminid']
|
||||
));
|
||||
try {
|
||||
Admins::getLocal($userinfo, array(
|
||||
'id' => $userinfo['adminid'],
|
||||
'def_language' => $def_language
|
||||
))->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
// also update current session
|
||||
$lng_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_SESSIONS . "`
|
||||
SET `language`= :lng
|
||||
WHERE `hash`= :hash"
|
||||
);
|
||||
WHERE `hash`= :hash");
|
||||
Database::pexecute($lng_stmt, array(
|
||||
'lng' => $def_language,
|
||||
'hash' => $s
|
||||
));
|
||||
}
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "changed his/her default language to '" . $def_language . "'");
|
||||
redirectTo($filename, array('s' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "changed his/her default language to '" . $def_language . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$language_options = '';
|
||||
@@ -275,43 +258,39 @@ if ($page == 'overview') {
|
||||
$default_lang = $userinfo['def_language'];
|
||||
}
|
||||
|
||||
while (list($language_file, $language_name) = each($languages)) {
|
||||
$language_options.= makeoption($language_name, $language_file, $default_lang, true);
|
||||
foreach ($languages as $language_file => $language_name) {
|
||||
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, $default_lang, true);
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("index/change_language") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("index/change_language") . "\";");
|
||||
}
|
||||
|
||||
} elseif ($page == 'change_theme') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$theme = validate($_POST['theme'], 'theme');
|
||||
|
||||
$theme_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_ADMINS . "`
|
||||
SET `theme`= :theme
|
||||
WHERE `adminid`= :adminid"
|
||||
);
|
||||
Database::pexecute($theme_stmt, array(
|
||||
'theme' => $theme,
|
||||
'adminid' => (int)$userinfo['adminid']
|
||||
));
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$theme = \Froxlor\Validate\Validate::validate($_POST['theme'], 'theme');
|
||||
try {
|
||||
Admins::getLocal($userinfo, array(
|
||||
'id' => $userinfo['adminid'],
|
||||
'theme' => $theme
|
||||
))->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
// also update current session
|
||||
$theme_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_SESSIONS . "`
|
||||
SET `theme`= :theme
|
||||
WHERE `hash`= :hash"
|
||||
);
|
||||
WHERE `hash`= :hash");
|
||||
Database::pexecute($theme_stmt, array(
|
||||
'theme' => $theme,
|
||||
'hash' => $s
|
||||
));
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "changed his/her theme to '" . $theme . "'");
|
||||
redirectTo($filename, array('s' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "changed his/her theme to '" . $theme . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$theme_options = '';
|
||||
@@ -321,27 +300,22 @@ if ($page == 'overview') {
|
||||
$default_theme = $userinfo['theme'];
|
||||
}
|
||||
|
||||
$themes_avail = getThemes();
|
||||
$themes_avail = \Froxlor\UI\Template::getThemes();
|
||||
foreach ($themes_avail as $t => $d) {
|
||||
$theme_options.= makeoption($d, $t, $default_theme, true);
|
||||
$theme_options .= \Froxlor\UI\HTML::makeoption($d, $t, $default_theme, true);
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("index/change_theme") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("index/change_theme") . "\";");
|
||||
}
|
||||
|
||||
} elseif ($page == 'send_error_report'
|
||||
&& Settings::Get('system.allow_error_report_admin') == '1'
|
||||
) {
|
||||
} elseif ($page == 'send_error_report' && Settings::Get('system.allow_error_report_admin') == '1') {
|
||||
|
||||
// only show this if we really have an exception to report
|
||||
if (isset($_GET['errorid'])
|
||||
&& $_GET['errorid'] != ''
|
||||
) {
|
||||
if (isset($_GET['errorid']) && $_GET['errorid'] != '') {
|
||||
|
||||
$errid = $_GET['errorid'];
|
||||
// read error file
|
||||
$err_dir = makeCorrectDir(FROXLOR_INSTALL_DIR."/logs/");
|
||||
$err_file = makeCorrectFile($err_dir."/".$errid."_sql-error.log");
|
||||
$err_dir = \Froxlor\FileDir::makeCorrectDir(\Froxlor\Froxlor::getInstallDir() . "/logs/");
|
||||
$err_file = \Froxlor\FileDir::makeCorrectFile($err_dir . "/" . $errid . "_sql-error.log");
|
||||
|
||||
if (file_exists($err_file)) {
|
||||
|
||||
@@ -351,9 +325,9 @@ if ($page == 'overview') {
|
||||
$_error = array(
|
||||
'code' => str_replace("\n", "", substr($error[1], 5)),
|
||||
'message' => str_replace("\n", "", substr($error[2], 4)),
|
||||
'file' => str_replace("\n", "", substr($error[3], 5 + strlen(FROXLOR_INSTALL_DIR))),
|
||||
'file' => str_replace("\n", "", substr($error[3], 5 + strlen(\Froxlor\Froxlor::getInstallDir()))),
|
||||
'line' => str_replace("\n", "", substr($error[4], 5)),
|
||||
'trace' => str_replace(FROXLOR_INSTALL_DIR, "", substr($error[5], 6))
|
||||
'trace' => str_replace(\Froxlor\Froxlor::getInstallDir(), "", substr($error[5], 6))
|
||||
);
|
||||
|
||||
// build mail-content
|
||||
@@ -364,14 +338,13 @@ if ($page == 'overview') {
|
||||
$mail_body .= "File: " . $_error['file'] . ':' . $_error['line'] . "\n\n";
|
||||
$mail_body .= "Trace:\n" . trim($_error['trace']) . "\n\n";
|
||||
$mail_body .= "-------------------------------------------------------------\n\n";
|
||||
$mail_body .= "Froxlor-version: ".$version."\n\n";
|
||||
$mail_body .= "Froxlor-version: " . $version . "\n";
|
||||
$mail_body .= "DB-version: " . $dbversion . "\n\n";
|
||||
$mail_body .= "End of report";
|
||||
$mail_html = nl2br($mail_body);
|
||||
|
||||
// send actual report to dev-team
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// send mail and say thanks
|
||||
$_mailerror = false;
|
||||
try {
|
||||
@@ -380,7 +353,7 @@ if ($page == 'overview') {
|
||||
$mail->MsgHTML($mail_html);
|
||||
$mail->AddAddress('error-reports@froxlor.org', 'Froxlor Developer Team');
|
||||
$mail->Send();
|
||||
} catch(phpmailerException $e) {
|
||||
} catch (\PHPMailer\PHPMailer\Exception $e) {
|
||||
$mailerr_msg = $e->errorMessage();
|
||||
$_mailerror = true;
|
||||
} catch (Exception $e) {
|
||||
@@ -390,21 +363,32 @@ if ($page == 'overview') {
|
||||
|
||||
if ($_mailerror) {
|
||||
// error when reporting an error...LOLFUQ
|
||||
standard_error('send_report_error', $mailerr_msg);
|
||||
\Froxlor\UI\Response::standard_error('send_report_error', $mailerr_msg);
|
||||
}
|
||||
|
||||
// finally remove error from fs
|
||||
@unlink($err_file);
|
||||
redirectTo($filename, array('s' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
// show a nice summary of the error-report
|
||||
// before actually sending anything
|
||||
eval("echo \"" . getTemplate("index/send_error_report") . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("index/send_error_report") . "\";");
|
||||
} else {
|
||||
redirectTo($filename, array('s' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
} else {
|
||||
redirectTo($filename, array('s' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
} elseif ($page == 'apikeys' && Settings::Get('api.enabled') == 1) {
|
||||
require_once __DIR__ . '/api_keys.php';
|
||||
} elseif ($page == 'apihelp' && Settings::Get('api.enabled') == 1) {
|
||||
require_once __DIR__ . '/apihelp.php';
|
||||
} elseif ($page == '2fa' && Settings::Get('2fa.enabled') == 1) {
|
||||
require_once __DIR__ . '/2fa.php';
|
||||
}
|
||||
|
||||
@@ -16,28 +16,34 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\IpsAndPorts as IpsAndPorts;
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
$id = intval($_GET['id']);
|
||||
}
|
||||
|
||||
if ($page == 'ipsandports'
|
||||
|| $page == 'overview'
|
||||
) {
|
||||
if ($page == 'ipsandports' || $page == 'overview') {
|
||||
// Do not display attributes that are not used by the current webserver
|
||||
$websrv = Settings::Get('system.webserver');
|
||||
$is_nginx = ($websrv == 'nginx');
|
||||
$is_apache = ($websrv == 'apache2');
|
||||
$is_apache24 = $is_apache && (Settings::Get('system.apache24') === '1');
|
||||
|
||||
if ($action == '') {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_ipsandports");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed admin_ipsandports");
|
||||
$fields = array(
|
||||
'ip' => $lng['admin']['ipsandports']['ip'],
|
||||
'port' => $lng['admin']['ipsandports']['port']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_IPSANDPORTS, $fields);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_IPSANDPORTS, $fields);
|
||||
$ipsandports = '';
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_IPSANDPORTS . "` " . $paging->getSqlWhere(false) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt);
|
||||
@@ -52,381 +58,103 @@ if ($page == 'ipsandports'
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$row = htmlentities_array($row);
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
if (filter_var($row['ip'], FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)) {
|
||||
$row['ip'] = '[' . $row['ip'] . ']';
|
||||
}
|
||||
eval("\$ipsandports.=\"" . getTemplate("ipsandports/ipsandports_ipandport") . "\";");
|
||||
eval("\$ipsandports.=\"" . \Froxlor\UI\Template::getTemplate("ipsandports/ipsandports_ipandport") . "\";");
|
||||
$count ++;
|
||||
}
|
||||
$i ++;
|
||||
}
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("ipsandports/ipsandports") . "\";");
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
try {
|
||||
$json_result = IpsAndPorts::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
eval("echo \"" . getTemplate("ipsandports/ipsandports") . "\";");
|
||||
if (isset($result['id']) && $result['id'] == $id) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
} elseif($action == 'delete'
|
||||
&& $id != 0
|
||||
) {
|
||||
$result_stmt = Database::prepare("SELECT `id`, `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = :id");
|
||||
$result = Database::pexecute_first($result_stmt, array('id' => $id));
|
||||
|
||||
if (isset($result['id'])
|
||||
&& $result['id'] == $id
|
||||
) {
|
||||
$result_checkdomain_stmt = Database::prepare("
|
||||
SELECT `id_domain` as `id` FROM `" . TABLE_DOMAINTOIP . "` WHERE `id_ipandports` = :id"
|
||||
);
|
||||
$result_checkdomain = Database::pexecute_first($result_checkdomain_stmt, array('id' => $id));
|
||||
|
||||
if ($result_checkdomain['id'] == '') {
|
||||
if ($result['id'] != Settings::Get('system.defaultip')) {
|
||||
|
||||
$result_sameipotherport_stmt = Database::prepare("
|
||||
SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
WHERE `ip` = :ip AND `id` <> :id"
|
||||
);
|
||||
$result_sameipotherport = Database::pexecute_first($result_sameipotherport_stmt, array('id' => $id, 'ip' => $result['ip']));
|
||||
|
||||
if (($result['ip'] != Settings::Get('system.ipaddress'))
|
||||
|| ($result['ip'] == Settings::Get('system.ipaddress')
|
||||
&& $result_sameipotherport['id'] != '')
|
||||
) {
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `ip`, `port` FROM `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
WHERE `id` = :id"
|
||||
);
|
||||
$result = Database::pexecute_first($result_stmt, array('id' => $id));
|
||||
|
||||
if ($result['ip'] != '') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
WHERE `id` = :id"
|
||||
);
|
||||
Database::pexecute($del_stmt, array('id' => $id));
|
||||
|
||||
// also, remove connections to domains (multi-stack)
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `".TABLE_DOMAINTOIP."` WHERE `id_ipandports` = :id"
|
||||
);
|
||||
Database::pexecute($del_stmt, array('id' => $id));
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_WARNING, "deleted IP/port '" . $result['ip'] . ":" . $result['port'] . "'");
|
||||
inserttask('1');
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
try {
|
||||
IpsAndPorts::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_ip_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['ip'] . ':' . $result['port']);
|
||||
\Froxlor\UI\HTML::askYesNo('admin_ip_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['ip'] . ':' . $result['port']);
|
||||
}
|
||||
}
|
||||
} else {
|
||||
standard_error('cantdeletesystemip');
|
||||
}
|
||||
} else {
|
||||
standard_error('cantdeletedefaultip');
|
||||
}
|
||||
} else {
|
||||
standard_error('ipstillhasdomains');
|
||||
}
|
||||
}
|
||||
|
||||
} elseif ($action == 'add') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$ip = validate_ip($_POST['ip']);
|
||||
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
|
||||
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
|
||||
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
|
||||
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
|
||||
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
|
||||
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
|
||||
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
|
||||
$docroot = validate($_POST['docroot'], 'docroot');
|
||||
|
||||
if ((int)Settings::Get('system.use_ssl') == 1) {
|
||||
$ssl = isset($_POST['ssl']) ? intval($_POST['ssl']) : 0;
|
||||
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
|
||||
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
|
||||
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
|
||||
$ssl_cert_chainfile = validate($_POST['ssl_cert_chainfile'], 'ssl_cert_chainfile');
|
||||
} else {
|
||||
$ssl = 0;
|
||||
$ssl_cert_file = '';
|
||||
$ssl_key_file = '';
|
||||
$ssl_ca_file = '';
|
||||
$ssl_cert_chainfile = '';
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
IpsAndPorts::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
if ($listen_statement != '1') {
|
||||
$listen_statement = '0';
|
||||
}
|
||||
|
||||
if ($namevirtualhost_statement != '1') {
|
||||
$namevirtualhost_statement = '0';
|
||||
}
|
||||
|
||||
if ($vhostcontainer != '1') {
|
||||
$vhostcontainer = '0';
|
||||
}
|
||||
|
||||
if ($vhostcontainer_servername_statement != '1') {
|
||||
$vhostcontainer_servername_statement = '0';
|
||||
}
|
||||
|
||||
if ($ssl != '1') {
|
||||
$ssl = '0';
|
||||
}
|
||||
|
||||
if ($ssl_cert_file != '') {
|
||||
$ssl_cert_file = makeCorrectFile($ssl_cert_file);
|
||||
}
|
||||
|
||||
if ($ssl_key_file != '') {
|
||||
$ssl_key_file = makeCorrectFile($ssl_key_file);
|
||||
}
|
||||
|
||||
if ($ssl_ca_file != '') {
|
||||
$ssl_ca_file = makeCorrectFile($ssl_ca_file);
|
||||
}
|
||||
|
||||
if ($ssl_cert_chainfile != '') {
|
||||
$ssl_cert_chainfile = makeCorrectFile($ssl_cert_chainfile);
|
||||
}
|
||||
|
||||
if (strlen(trim($docroot)) > 0) {
|
||||
$docroot = makeCorrectDir($docroot);
|
||||
} else {
|
||||
$docroot = '';
|
||||
}
|
||||
|
||||
$result_checkfordouble_stmt = Database::prepare("
|
||||
SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
WHERE `ip` = :ip AND `port` = :port"
|
||||
);
|
||||
$result_checkfordouble = Database::pexecute_first($result_checkfordouble_stmt, array('ip' => $ip, 'port' => $port));
|
||||
|
||||
if ($result_checkfordouble['id'] != '') {
|
||||
standard_error('myipnotdouble');
|
||||
} else {
|
||||
$ins_stmt = Database::prepare("
|
||||
INSERT INTO `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
SET
|
||||
`ip` = :ip, `port` = :port, `listen_statement` = :ls,
|
||||
`namevirtualhost_statement` = :nvhs, `vhostcontainer` = :vhc,
|
||||
`vhostcontainer_servername_statement` = :vhcss,
|
||||
`specialsettings` = :ss, `ssl` = :ssl,
|
||||
`ssl_cert_file` = :ssl_cert, `ssl_key_file` = :ssl_key,
|
||||
`ssl_ca_file` = :ssl_ca, `ssl_cert_chainfile` = :ssl_chain,
|
||||
`default_vhostconf_domain` = :dvhd, `docroot` = :docroot;
|
||||
");
|
||||
$ins_data = array(
|
||||
'ip' => $ip,
|
||||
'port' => $port,
|
||||
'ls' => $listen_statement,
|
||||
'nvhs' => $namevirtualhost_statement,
|
||||
'vhc' => $vhostcontainer,
|
||||
'vhcss' => $vhostcontainer_servername_statement,
|
||||
'ss' => $specialsettings,
|
||||
'ssl' => $ssl,
|
||||
'ssl_cert' => $ssl_cert_file,
|
||||
'ssl_key' => $ssl_key_file,
|
||||
'ssl_ca' => $ssl_ca_file,
|
||||
'ssl_chain' => $ssl_cert_chainfile,
|
||||
'dvhd' => $default_vhostconf_domain,
|
||||
'docroot' => $docroot
|
||||
);
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
|
||||
if (filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)) {
|
||||
$ip = '[' . $ip . ']';
|
||||
}
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_WARNING, "added IP/port '" . $ip . ":" . $port . "'");
|
||||
inserttask('1');
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
redirectTo($filename, Array('page' => $page, 's' => $s));
|
||||
}
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$ipsandports_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/ipsandports/formfield.ipsandports_add.php';
|
||||
$ipsandports_add_form = htmlform::genHTMLForm($ipsandports_add_data);
|
||||
$ipsandports_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($ipsandports_add_data);
|
||||
|
||||
$title = $ipsandports_add_data['ipsandports_add']['title'];
|
||||
$image = $ipsandports_add_data['ipsandports_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("ipsandports/ipsandports_add") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("ipsandports/ipsandports_add") . "\";");
|
||||
}
|
||||
|
||||
} elseif($action == 'edit'
|
||||
&& $id != 0
|
||||
) {
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_IPSANDPORTS . "` WHERE `id` = :id"
|
||||
);
|
||||
$result = Database::pexecute_first($result_stmt, array('id' => $id));
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
try {
|
||||
$json_result = IpsAndPorts::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if ($result['ip'] != '') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$ip = validate_ip($_POST['ip']);
|
||||
$port = validate($_POST['port'], 'port', '/^(([1-9])|([1-9][0-9])|([1-9][0-9][0-9])|([1-9][0-9][0-9][0-9])|([1-5][0-9][0-9][0-9][0-9])|(6[0-4][0-9][0-9][0-9])|(65[0-4][0-9][0-9])|(655[0-2][0-9])|(6553[0-5]))$/Di', array('stringisempty', 'myport'));
|
||||
$listen_statement = isset($_POST['listen_statement']) ? 1 : 0;
|
||||
$namevirtualhost_statement = isset($_POST['namevirtualhost_statement']) ? 1 : 0;
|
||||
$vhostcontainer = isset($_POST['vhostcontainer']) ? 1 : 0;
|
||||
$specialsettings = validate(str_replace("\r\n", "\n", $_POST['specialsettings']), 'specialsettings', '/^[^\0]*$/');
|
||||
$vhostcontainer_servername_statement = isset($_POST['vhostcontainer_servername_statement']) ? 1 : 0;
|
||||
$default_vhostconf_domain = validate(str_replace("\r\n", "\n", $_POST['default_vhostconf_domain']), 'default_vhostconf_domain', '/^[^\0]*$/');
|
||||
$docroot = validate($_POST['docroot'], 'docroot');
|
||||
|
||||
$result_checkfordouble_stmt = Database::prepare("
|
||||
SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
WHERE `ip` = :ip AND `port` = :port"
|
||||
);
|
||||
$result_checkfordouble = Database::pexecute_first($result_checkfordouble_stmt, array('ip' => $ip, 'port' => $port));
|
||||
|
||||
$result_sameipotherport_stmt = Database::prepare("
|
||||
SELECT `id` FROM `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
WHERE `ip` = :ip AND `id` <> :id"
|
||||
);
|
||||
$result_sameipotherport = Database::pexecute_first($result_sameipotherport_stmt, array('ip' => $ip, 'id' => $id));
|
||||
|
||||
if ((int)Settings::Get('system.use_ssl') == 1
|
||||
&& isset($_POST['ssl'])
|
||||
&& $_POST['ssl'] != 0
|
||||
) {
|
||||
$ssl = 1;
|
||||
$ssl_cert_file = validate($_POST['ssl_cert_file'], 'ssl_cert_file');
|
||||
$ssl_key_file = validate($_POST['ssl_key_file'], 'ssl_key_file');
|
||||
$ssl_ca_file = validate($_POST['ssl_ca_file'], 'ssl_ca_file');
|
||||
$ssl_cert_chainfile = validate($_POST['ssl_cert_chainfile'], 'ssl_cert_chainfile');
|
||||
} else {
|
||||
$ssl = 0;
|
||||
$ssl_cert_file = '';
|
||||
$ssl_key_file = '';
|
||||
$ssl_ca_file = '';
|
||||
$ssl_cert_chainfile = '';
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
IpsAndPorts::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
if ($listen_statement != '1') {
|
||||
$listen_statement = '0';
|
||||
}
|
||||
|
||||
if ($namevirtualhost_statement != '1') {
|
||||
$namevirtualhost_statement = '0';
|
||||
}
|
||||
|
||||
if ($vhostcontainer != '1') {
|
||||
$vhostcontainer = '0';
|
||||
}
|
||||
|
||||
if ($vhostcontainer_servername_statement != '1') {
|
||||
$vhostcontainer_servername_statement = '0';
|
||||
}
|
||||
|
||||
if ($ssl != '1') {
|
||||
$ssl = '0';
|
||||
}
|
||||
|
||||
if ($ssl_cert_file != '') {
|
||||
$ssl_cert_file = makeCorrectFile($ssl_cert_file);
|
||||
}
|
||||
|
||||
if ($ssl_key_file != '') {
|
||||
$ssl_key_file = makeCorrectFile($ssl_key_file);
|
||||
}
|
||||
|
||||
if ($ssl_ca_file != '') {
|
||||
$ssl_ca_file = makeCorrectFile($ssl_ca_file);
|
||||
}
|
||||
|
||||
if ($ssl_cert_chainfile != '') {
|
||||
$ssl_cert_chainfile = makeCorrectFile($ssl_cert_chainfile);
|
||||
}
|
||||
|
||||
if (strlen(trim($docroot)) > 0) {
|
||||
$docroot = makeCorrectDir($docroot);
|
||||
} else {
|
||||
$docroot = '';
|
||||
}
|
||||
|
||||
if ($result['ip'] != $ip
|
||||
&& $result['ip'] == Settings::Get('system.ipaddress')
|
||||
&& $result_sameipotherport['id'] == ''
|
||||
) {
|
||||
standard_error('cantchangesystemip');
|
||||
|
||||
} elseif($result_checkfordouble['id'] != ''
|
||||
&& $result_checkfordouble['id'] != $id
|
||||
) {
|
||||
standard_error('myipnotdouble');
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_IPSANDPORTS . "`
|
||||
SET
|
||||
`ip` = :ip, `port` = :port, `listen_statement` = :ls,
|
||||
`namevirtualhost_statement` = :nvhs, `vhostcontainer` = :vhc,
|
||||
`vhostcontainer_servername_statement` = :vhcss,
|
||||
`specialsettings` = :ss, `ssl` = :ssl,
|
||||
`ssl_cert_file` = :ssl_cert, `ssl_key_file` = :ssl_key,
|
||||
`ssl_ca_file` = :ssl_ca, `ssl_cert_chainfile` = :ssl_chain,
|
||||
`default_vhostconf_domain` = :dvhd, `docroot` = :docroot
|
||||
WHERE `id` = :id;
|
||||
");
|
||||
$upd_data = array(
|
||||
'ip' => $ip,
|
||||
'port' => $port,
|
||||
'ls' => $listen_statement,
|
||||
'nvhs' => $namevirtualhost_statement,
|
||||
'vhc' => $vhostcontainer,
|
||||
'vhcss' => $vhostcontainer_servername_statement,
|
||||
'ss' => $specialsettings,
|
||||
'ssl' => $ssl,
|
||||
'ssl_cert' => $ssl_cert_file,
|
||||
'ssl_key' => $ssl_key_file,
|
||||
'ssl_ca' => $ssl_ca_file,
|
||||
'ssl_chain' => $ssl_cert_chainfile,
|
||||
'dvhd' => $default_vhostconf_domain,
|
||||
'docroot' => $docroot,
|
||||
'id' => $id
|
||||
);
|
||||
Database::pexecute($upd_stmt, $upd_data);
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_WARNING, "changed IP/port from '" . $result['ip'] . ":" . $result['port'] . "' to '" . $ip . ":" . $port . "'");
|
||||
inserttask('1');
|
||||
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
|
||||
redirectTo($filename, Array('page' => $page, 's' => $s));
|
||||
}
|
||||
|
||||
} else {
|
||||
|
||||
$result = htmlentities_array($result);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
|
||||
$ipsandports_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/ipsandports/formfield.ipsandports_edit.php';
|
||||
$ipsandports_edit_form = htmlform::genHTMLForm($ipsandports_edit_data);
|
||||
$ipsandports_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($ipsandports_edit_data);
|
||||
|
||||
$title = $ipsandports_edit_data['ipsandports_edit']['title'];
|
||||
$image = $ipsandports_edit_data['ipsandports_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("ipsandports/ipsandports_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("ipsandports/ipsandports_edit") . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -16,13 +16,12 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
if ($page == 'log'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
use Froxlor\Database\Database;
|
||||
|
||||
if ($page == 'log' && $userinfo['change_serversettings'] == '1') {
|
||||
if ($action == '') {
|
||||
$fields = array(
|
||||
'date' => $lng['logger']['date'],
|
||||
@@ -30,11 +29,12 @@ if ($page == 'log'
|
||||
'user' => $lng['logger']['user'],
|
||||
'text' => $lng['logger']['action']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_LOG, $fields, null, null, 0, 'desc');
|
||||
$result_stmt = Database::query('
|
||||
SELECT * FROM `' . TABLE_PANEL_LOG . '` ' . $paging->getSqlWhere(false) . ' ' . $paging->getSqlOrderBy() . ' ' . $paging->getSqlLimit()
|
||||
);
|
||||
$paging->setEntries(Database::num_rows());
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_LOG, $fields, null, null, 0, 'desc', 30);
|
||||
$query = 'SELECT * FROM `' . TABLE_PANEL_LOG . '` ' . $paging->getSqlWhere(false) . ' ' . $paging->getSqlOrderBy();
|
||||
$result_stmt = Database::query($query . ' ' . $paging->getSqlLimit());
|
||||
$result_cnt_stmt = Database::query($query);
|
||||
$logs_count = $result_cnt_stmt->rowCount();
|
||||
$paging->setEntries($logs_count);
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
@@ -43,17 +43,13 @@ if ($page == 'log'
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
|
||||
if (!isset($clog[$row['action']])
|
||||
|| !is_array($clog[$row['action']])
|
||||
) {
|
||||
if (! isset($clog[$row['action']]) || ! is_array($clog[$row['action']])) {
|
||||
$clog[$row['action']] = array();
|
||||
}
|
||||
$clog[$row['action']][$row['logid']] = $row;
|
||||
}
|
||||
|
||||
if ($paging->sortfield == 'date'
|
||||
&& $paging->sortorder == 'desc'
|
||||
) {
|
||||
if ($paging->sortfield == 'date' && $paging->sortorder == 'desc') {
|
||||
krsort($clog);
|
||||
} else {
|
||||
ksort($clog);
|
||||
@@ -66,25 +62,25 @@ if ($page == 'log'
|
||||
foreach ($clog as $action => $logrows) {
|
||||
$_action = 0;
|
||||
foreach ($logrows as $row) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$row = htmlentities_array($row);
|
||||
// if ($paging->checkDisplay($i)) {
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
$row['date'] = date("d.m.y H:i:s", $row['date']);
|
||||
|
||||
if ($_action != $action) {
|
||||
switch ($action) {
|
||||
case USR_ACTION:
|
||||
case \Froxlor\FroxlorLogger::USR_ACTION:
|
||||
$_action = $lng['admin']['customer'];
|
||||
break;
|
||||
case RES_ACTION:
|
||||
case \Froxlor\FroxlorLogger::RES_ACTION:
|
||||
$_action = $lng['logger']['reseller'];
|
||||
break;
|
||||
case ADM_ACTION:
|
||||
case \Froxlor\FroxlorLogger::ADM_ACTION:
|
||||
$_action = $lng['logger']['admin'];
|
||||
break;
|
||||
case CRON_ACTION:
|
||||
case \Froxlor\FroxlorLogger::CRON_ACTION:
|
||||
$_action = $lng['logger']['cron'];
|
||||
break;
|
||||
case LOGIN_ACTION:
|
||||
case \Froxlor\FroxlorLogger::LOGIN_ACTION:
|
||||
$_action = $lng['logger']['login'];
|
||||
break;
|
||||
case LOG_ERROR:
|
||||
@@ -96,59 +92,40 @@ if ($page == 'log'
|
||||
}
|
||||
|
||||
$row['action'] = $_action;
|
||||
eval("\$log.=\"" . getTemplate('logger/logger_action') . "\";");
|
||||
eval("\$log.=\"" . \Froxlor\UI\Template::getTemplate('logger/logger_action') . "\";");
|
||||
}
|
||||
|
||||
$log_count ++;
|
||||
$type = $row['type'];
|
||||
$_type = 'unknown';
|
||||
|
||||
switch ($type) {
|
||||
case LOG_INFO:
|
||||
$_type = 'Information';
|
||||
break;
|
||||
case LOG_NOTICE:
|
||||
$_type = 'Notice';
|
||||
break;
|
||||
case LOG_WARNING:
|
||||
$_type = 'Warning';
|
||||
break;
|
||||
case LOG_ERR:
|
||||
$_type = 'Error';
|
||||
break;
|
||||
case LOG_CRIT:
|
||||
$_type = 'Critical';
|
||||
break;
|
||||
default:
|
||||
$_type = 'Unknown';
|
||||
break;
|
||||
}
|
||||
|
||||
$row['type'] = $_type;
|
||||
eval("\$log.=\"" . getTemplate('logger/logger_log') . "\";");
|
||||
$row['type'] = \Froxlor\FroxlorLogger::getInstanceOf()->getLogLevelDesc($row['type']);
|
||||
eval("\$log.=\"" . \Froxlor\UI\Template::getTemplate('logger/logger_log') . "\";");
|
||||
$count ++;
|
||||
$_action = $action;
|
||||
}
|
||||
// }
|
||||
$i ++;
|
||||
}
|
||||
$i ++;
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('logger/logger') . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('logger/logger') . "\";");
|
||||
} elseif ($action == 'truncate') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$truncatedate = time() - (60 * 10);
|
||||
$trunc_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < :trunc"
|
||||
);
|
||||
Database::pexecute($trunc_stmt, array('trunc' => $truncatedate));
|
||||
$log->logAction(ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)');
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
DELETE FROM `" . TABLE_PANEL_LOG . "` WHERE `date` < :trunc");
|
||||
Database::pexecute($trunc_stmt, array(
|
||||
'trunc' => $truncatedate
|
||||
));
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, 'truncated the system-log (mysql)');
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('logger_reallytruncate', $filename, array('page' => $page, 'action' => $action), TABLE_PANEL_LOG);
|
||||
\Froxlor\UI\HTML::askYesNo('logger_reallytruncate', $filename, array(
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), TABLE_PANEL_LOG);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -16,10 +16,11 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
@@ -28,30 +29,27 @@ if (isset($_POST['id'])) {
|
||||
|
||||
if ($page == 'message') {
|
||||
if ($action == '') {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, 'viewed panel_message');
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'viewed panel_message');
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if ($_POST['receipient'] == 0
|
||||
&& $userinfo['customers_see_all'] == '1'
|
||||
) {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to admins');
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
if ($_POST['receipient'] == 0 && $userinfo['customers_see_all'] == '1') {
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'sending messages to admins');
|
||||
$result = Database::query('SELECT `name`, `email` FROM `' . TABLE_PANEL_ADMINS . "`");
|
||||
} elseif ($_POST['receipient'] == 1) {
|
||||
if ($userinfo['customers_see_all'] == '1') {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers');
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'sending messages to ALL customers');
|
||||
$result = Database::query('SELECT `firstname`, `name`, `company`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`");
|
||||
} else {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, 'sending messages to customers');
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, 'sending messages to customers');
|
||||
$result = Database::prepare('
|
||||
SELECT `firstname`, `name`, `company`, `email` FROM `' . TABLE_PANEL_CUSTOMERS . "`
|
||||
WHERE `adminid` = :adminid"
|
||||
);
|
||||
Database::pexecute($result, array('adminid' => $userinfo['adminid']));
|
||||
WHERE `adminid` = :adminid");
|
||||
Database::pexecute($result, array(
|
||||
'adminid' => $userinfo['adminid']
|
||||
));
|
||||
}
|
||||
} else {
|
||||
standard_error('noreceipientsgiven');
|
||||
\Froxlor\UI\Response::standard_error('noreceipientsgiven');
|
||||
}
|
||||
|
||||
$subject = $_POST['subject'];
|
||||
@@ -66,7 +64,11 @@ if ($page == 'message') {
|
||||
|
||||
$row['firstname'] = isset($row['firstname']) ? $row['firstname'] : '';
|
||||
$row['company'] = isset($row['company']) ? $row['company'] : '';
|
||||
$mail->AddAddress($row['email'], getCorrectUserSalutation(array('firstname' => $row['firstname'], 'name' => $row['name'], 'company' => $row['company'])));
|
||||
$mail->AddAddress($row['email'], \Froxlor\User::getCorrectUserSalutation(array(
|
||||
'firstname' => $row['firstname'],
|
||||
'name' => $row['name'],
|
||||
'company' => $row['company']
|
||||
)));
|
||||
$mail->From = $userinfo['email'];
|
||||
$mail->FromName = (isset($userinfo['firstname']) ? $userinfo['firstname'] . ' ' : '') . $userinfo['name'];
|
||||
|
||||
@@ -77,17 +79,22 @@ if ($page == 'message') {
|
||||
$mailerr_msg = $row['email'];
|
||||
}
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg);
|
||||
standard_error('errorsendingmail', $row['email']);
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_ERR, 'Error sending mail: ' . $mailerr_msg);
|
||||
\Froxlor\UI\Response::standard_error('errorsendingmail', $row['email']);
|
||||
}
|
||||
|
||||
$mailcounter ++;
|
||||
$mail->ClearAddresses();
|
||||
}
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s, 'action' => 'showsuccess', 'sentitems' => $mailcounter));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s,
|
||||
'action' => 'showsuccess',
|
||||
'sentitems' => $mailcounter
|
||||
));
|
||||
} else {
|
||||
standard_error('nomessagetosend');
|
||||
\Froxlor\UI\Response::standard_error('nomessagetosend');
|
||||
}
|
||||
}
|
||||
}
|
||||
@@ -102,7 +109,6 @@ if ($page == 'message') {
|
||||
} else {
|
||||
$successmessage = str_replace('%s', $sentitems, $lng['message']['success']);
|
||||
}
|
||||
|
||||
} else {
|
||||
$success = 0;
|
||||
$sentitems = 0;
|
||||
@@ -113,9 +119,9 @@ if ($page == 'message') {
|
||||
$receipients = '';
|
||||
|
||||
if ($userinfo['customers_see_all'] == '1') {
|
||||
$receipients.= makeoption($lng['panel']['reseller'], 0);
|
||||
$receipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['reseller'], 0);
|
||||
}
|
||||
|
||||
$receipients .= makeoption($lng['panel']['customer'], 1);
|
||||
eval("echo \"" . getTemplate('message/message') . "\";");
|
||||
$receipients .= \Froxlor\UI\HTML::makeoption($lng['panel']['customer'], 1);
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('message/message') . "\";");
|
||||
}
|
||||
|
||||
156
admin_opcacheinfo.php
Normal file
@@ -0,0 +1,156 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Janos Muzsi <muzsij@hypernics.hu> (2016)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
*
|
||||
* Based on https://github.com/amnuts/opcache-gui
|
||||
*
|
||||
*/
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
if ($action == 'reset' && function_exists('opcache_reset') && $userinfo['change_serversettings'] == '1') {
|
||||
opcache_reset();
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "reseted OPcache");
|
||||
header('Location: ' . $linker->getLink(array(
|
||||
'section' => 'opcacheinfo',
|
||||
'page' => 'showinfo'
|
||||
)));
|
||||
exit();
|
||||
}
|
||||
|
||||
if (! function_exists('opcache_get_configuration')) {
|
||||
\Froxlor\UI\Response::standard_error($lng['error']['no_opcacheinfo']);
|
||||
}
|
||||
|
||||
if ($page == 'showinfo') {
|
||||
|
||||
$opcache_info = opcache_get_configuration();
|
||||
$opcache_status = opcache_get_status(false);
|
||||
$time = time();
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed OPcache info");
|
||||
|
||||
$runtimelines = '';
|
||||
if (isset($opcache_info['directives']) && is_array($opcache_info['directives'])) {
|
||||
foreach ($opcache_info['directives'] as $name => $value) {
|
||||
$linkname = str_replace('_', '-', $name);
|
||||
if ($name == 'opcache.optimization_level' && is_integer($value)) {
|
||||
$value = '0x' . dechex($value);
|
||||
}
|
||||
if ($name == 'opcache.memory_consumption' && is_integer($value) && $value % (1024 * 1024) == 0) {
|
||||
$value = $value / (1024 * 1024);
|
||||
}
|
||||
if ($value === null || $value === '') {
|
||||
$value = $lng['opcacheinfo']['novalue'];
|
||||
}
|
||||
if ($value === true) {
|
||||
$value = $lng['opcacheinfo']['true'];
|
||||
}
|
||||
if ($value === false) {
|
||||
$value = $lng['opcacheinfo']['false'];
|
||||
}
|
||||
if (is_integer($value)) {
|
||||
$value = number_format($value, 0, '.', ' ');
|
||||
}
|
||||
$name = str_replace('_', ' ', $name);
|
||||
eval("\$runtimelines.=\"" . \Froxlor\UI\Template::getTemplate("settings/opcacheinfo/runtime_line") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
$cachehits = @$opcache_status['opcache_statistics']['hits'] ?: 0;
|
||||
$cachemiss = @$opcache_status['opcache_statistics']['misses'] ?: 0;
|
||||
$blacklistmiss = @$opcache_status['opcache_statistics']['blacklist_misses'] ?: 0;
|
||||
$cachetotal = $cachehits + $cachemiss + $blacklistmiss;
|
||||
|
||||
$general = array(
|
||||
'version' => (isset($opcache_info['version']['opcache_product_name']) ? $opcache_info['version']['opcache_product_name'] . ' ' : '') . $opcache_info['version']['version'],
|
||||
'phpversion' => phpversion(),
|
||||
'start_time' => @$opcache_status['opcache_statistics']['start_time'] ? date('Y-m-d H:i:s', $opcache_status['opcache_statistics']['start_time']) : '',
|
||||
'last_restart_time' => @$opcache_status['opcache_statistics']['last_restart_time'] ? date('Y-m-d H:i:s', $opcache_status['opcache_statistics']['last_restart_time']) : $lng['opcacheinfo']['never'],
|
||||
'oom_restarts' => number_format(@$opcache_status['opcache_statistics']['oom_restarts'] ?: 0, 0, '.', ' '),
|
||||
'hash_restarts' => number_format(@$opcache_status['opcache_statistics']['hash_restarts'] ?: 0, 0, '.', ' '),
|
||||
'manual_restarts' => number_format(@$opcache_status['opcache_statistics']['manual_restarts'] ?: 0, 0, '.', ' '),
|
||||
'status' => (@$opcache_status['restart_in_progress'] ? $lng['opcacheinfo']['restartinprogress'] : (@$opcache_status['restart_pending'] ? $lng['opcacheinfo']['restartpending'] : (@$opcache_status['cache_full'] ? $lng['opcacheinfo']['cachefull'] : (@$opcache_status['opcache_enabled'] ? $lng['opcacheinfo']['enabled'] : $lng['opcacheinfo']['novalue'])))),
|
||||
'cachedscripts' => number_format(@$opcache_status['opcache_statistics']['num_cached_scripts'] ?: 0, 0, '.', ' '),
|
||||
'cachehits' => number_format($cachehits, 0, '.', ' ') . ($cachetotal > 0 ? sprintf(" (%.1f %%)", $cachehits / ($cachetotal) * 100) : ''),
|
||||
'cachemiss' => number_format($cachemiss, 0, '.', ' ') . ($cachetotal > 0 ? sprintf(" (%.1f %%)", $cachemiss / ($cachetotal) * 100) : ''),
|
||||
'blacklistmiss' => number_format($blacklistmiss, 0, '.', ' ') . ($cachetotal > 0 ? sprintf(" (%.1f %%)", $blacklistmiss / ($cachetotal) * 100) : '')
|
||||
);
|
||||
|
||||
$usedmem = @$opcache_status['memory_usage']['used_memory'] ?: 0;
|
||||
$usedmemstr = bsize($usedmem);
|
||||
$freemem = @$opcache_status['memory_usage']['free_memory'] ?: 0;
|
||||
$freememstr = bsize($freemem);
|
||||
$totalmem = $usedmem + $freemem;
|
||||
$wastedmem = @$opcache_status['memory_usage']['wasted_memory'] ?: 0;
|
||||
$wastedmemstr = bsize($wastedmem);
|
||||
if ($totalmem) {
|
||||
$memory = array(
|
||||
'total' => bsize($totalmem),
|
||||
'used' => $usedmemstr . ($totalmem > 0 ? sprintf(" (%.1f %%)", $usedmem / ($totalmem) * 100) : ''),
|
||||
'free' => $freememstr . ($totalmem > 0 ? sprintf(" (%.1f %%)", $freemem / ($totalmem) * 100) : ''),
|
||||
'wasted' => $wastedmemstr . ($totalmem > 0 ? sprintf(" (%.1f %%)", $wastedmem / ($totalmem) * 100) : '')
|
||||
);
|
||||
}
|
||||
|
||||
if (isset($opcache_status['interned_strings_usage'])) {
|
||||
$usedstring = @$opcache_status['interned_strings_usage']['used_memory'] ?: 0;
|
||||
$usedstringstr = bsize($usedstring);
|
||||
$freestring = @$opcache_status['interned_strings_usage']['free_memory'] ?: 0;
|
||||
$freestringstr = bsize($freestring);
|
||||
$totalstring = $usedstring + $freestring;
|
||||
$stringbuffer = array(
|
||||
'total' => bsize($totalstring),
|
||||
'used' => $usedstringstr . ($totalstring > 0 ? sprintf(" (%.1f %%)", $usedstring / $totalstring * 100) : ''),
|
||||
'free' => $freestringstr . ($totalstring > 0 ? sprintf(" (%.1f %%)", $freestring / $totalstring * 100) : ''),
|
||||
'strcount' => number_format(@$opcache_status['interned_strings_usage']['number_of_strings'] ?: 0, 0, '.', ' ')
|
||||
);
|
||||
}
|
||||
|
||||
$usedkey = @$opcache_status['opcache_statistics']['num_cached_keys'] ?: 0;
|
||||
$usedkeystr = number_format($usedkey, 0, '.', ' ');
|
||||
$totalkey = @$opcache_status['opcache_statistics']['max_cached_keys'] ?: 0;
|
||||
$wastedkey = $usedkey - (@$opcache_status['opcache_statistics']['num_cached_scripts'] ?: 0);
|
||||
if (isset($opcache_status['opcache_statistics'])) {
|
||||
$keystat = array(
|
||||
'total' => number_format($totalkey, 0, '.', ' '),
|
||||
'used' => $usedkeystr . ($totalkey > 0 ? sprintf(" (%.1f %%)", $usedkey / ($totalkey) * 100) : ''),
|
||||
'wasted' => number_format($wastedkey, 0, '.', ' ') . ($totalkey > 0 ? sprintf(" (%.1f %%)", $wastedkey / ($totalkey) * 100) : '')
|
||||
);
|
||||
}
|
||||
|
||||
$blacklistlines = '';
|
||||
if (isset($opcache_info['blacklist']) && is_array($opcache_info['blacklist'])) {
|
||||
foreach ($opcache_info['blacklist'] as $value) {
|
||||
eval("\$blacklistlines.=\"" . \Froxlor\UI\Template::getTemplate("settings/opcacheinfo/blacklist_line") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/opcacheinfo/showinfo") . "\";");
|
||||
}
|
||||
|
||||
function bsize($s)
|
||||
{
|
||||
foreach (array(
|
||||
'',
|
||||
'K',
|
||||
'M',
|
||||
'G'
|
||||
) as $i => $k) {
|
||||
if ($s < 1024)
|
||||
break;
|
||||
$s /= 1024;
|
||||
}
|
||||
return sprintf("%5.1f %sBytes", $s, $k);
|
||||
}
|
||||
@@ -16,10 +16,13 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Api\Commands\PhpSettings as PhpSettings;
|
||||
use Froxlor\Api\Commands\FpmDaemons as FpmDaemons;
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
@@ -30,307 +33,302 @@ if ($page == 'overview') {
|
||||
|
||||
if ($action == '') {
|
||||
|
||||
try {
|
||||
$json_result = PhpSettings::getLocal($userinfo, array(
|
||||
'with_subdomains' => true
|
||||
))->listing();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
$tablecontent = '';
|
||||
$count = 0;
|
||||
$result = Database::query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "`");
|
||||
|
||||
while ($row = $result->fetch(PDO::FETCH_ASSOC)) {
|
||||
|
||||
$domainresult = false;
|
||||
$query_params = array('id' => $row['id']);
|
||||
|
||||
$query = "SELECT * FROM `".TABLE_PANEL_DOMAINS."`
|
||||
WHERE `phpsettingid` = :id
|
||||
AND `parentdomainid` = '0'";
|
||||
|
||||
if ((int)$userinfo['domains_see_all'] == 0) {
|
||||
$query .= " AND `adminid` = :adminid";
|
||||
$query_params['adminid'] = $userinfo['adminid'];
|
||||
if (isset($result['count']) && $result['count'] > 0) {
|
||||
foreach ($result['list'] as $row) {
|
||||
if (isset($row['is_default']) && $row['is_default'] == true) {
|
||||
$row['description'] = "<b>" . $row['description'] . "</b>";
|
||||
}
|
||||
|
||||
if ((int)Settings::Get('panel.phpconfigs_hidestdsubdomain') == 1) {
|
||||
$ssdids_res = Database::query("
|
||||
SELECT DISTINCT `standardsubdomain` FROM `".TABLE_PANEL_CUSTOMERS."`
|
||||
WHERE `standardsubdomain` > 0 ORDER BY `standardsubdomain` ASC;"
|
||||
);
|
||||
$ssdids = array();
|
||||
while ($ssd = $ssdids_res->fetch(PDO::FETCH_ASSOC)) {
|
||||
$ssdids[] = $ssd['standardsubdomain'];
|
||||
$domains = "";
|
||||
$subdomains_count = count($row['subdomains']);
|
||||
foreach ($row['domains'] as $configdomain) {
|
||||
$domains .= $configdomain . "<br>";
|
||||
}
|
||||
if (count($ssdids) > 0) {
|
||||
$query .= " AND `id` NOT IN (".implode(', ', $ssdids).")";
|
||||
}
|
||||
}
|
||||
|
||||
$domainresult_stmt = Database::prepare($query);
|
||||
Database::pexecute($domainresult_stmt, $query_params);
|
||||
|
||||
$domains = '';
|
||||
if (Database::num_rows() > 0) {
|
||||
while ($row2 = $domainresult_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$domains.= $row2['domain'] . '<br/>';
|
||||
}
|
||||
}
|
||||
|
||||
// check whether we use that config as froxor-vhost config
|
||||
if (Settings::Get('system.mod_fcgid_defaultini_ownvhost') == $row['id']
|
||||
|| Settings::Get('phpfpm.vhost_defaultini') == $row['id']
|
||||
) {
|
||||
$domains .= Settings::Get('system.hostname');
|
||||
}
|
||||
|
||||
if ($domains == '') {
|
||||
$count ++;
|
||||
if ($subdomains_count == 0 && empty($domains)) {
|
||||
$domains = $lng['admin']['phpsettings']['notused'];
|
||||
}
|
||||
|
||||
// check whether this is our default config
|
||||
if ((Settings::Get('system.mod_fcgid') == '1'
|
||||
&& Settings::Get('system.mod_fcgid_defaultini') == $row['id'])
|
||||
|| (Settings::Get('phpfpm.enabled') == '1'
|
||||
&& Settings::Get('phpfpm.defaultini') == $row['id'])
|
||||
) {
|
||||
$row['description'] = '<b>'.$row['description'].'</b>';
|
||||
eval("\$tablecontent.=\"" . \Froxlor\UI\Template::getTemplate("phpconfig/overview_overview") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
$count ++;
|
||||
eval("\$tablecontent.=\"" . getTemplate("phpconfig/overview_overview") . "\";");
|
||||
}
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting overview has been viewed by '" . $userinfo['loginname'] . "'");
|
||||
eval("echo \"" . getTemplate("phpconfig/overview") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("phpconfig/overview") . "\";");
|
||||
}
|
||||
|
||||
if ($action == 'add') {
|
||||
|
||||
if ((int) $userinfo['change_serversettings'] == 1) {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$description = validate($_POST['description'], 'description');
|
||||
$phpsettings = validate(str_replace("\r\n", "\n", $_POST['phpsettings']), 'phpsettings', '/^[^\0]*$/');
|
||||
|
||||
if (Settings::Get('system.mod_fcgid') == 1) {
|
||||
$binary = makeCorrectFile(validate($_POST['binary'], 'binary'));
|
||||
$file_extensions = validate($_POST['file_extensions'], 'file_extensions', '/^[a-zA-Z0-9\s]*$/');
|
||||
$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
|
||||
$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
|
||||
// disable fpm stuff
|
||||
$fpm_enableslowlog = 0;
|
||||
$fpm_reqtermtimeout = 0;
|
||||
$fpm_reqslowtimeout = 0;
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
PhpSettings::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
elseif (Settings::Get('phpfpm.enabled') == 1) {
|
||||
$fpm_enableslowlog = isset($_POST['phpfpm_enable_slowlog']) ? (int)$_POST['phpfpm_enable_slowlog'] : 0;
|
||||
$fpm_reqtermtimeout = validate($_POST['phpfpm_reqtermtimeout'], 'phpfpm_reqtermtimeout', '/^([0-9]+)(|s|m|h|d)$/');
|
||||
$fpm_reqslowtimeout = validate($_POST['phpfpm_reqslowtimeout'], 'phpfpm_reqslowtimeout', '/^([0-9]+)(|s|m|h|d)$/');
|
||||
// disable fcgid stuff
|
||||
$binary = '/usr/bin/php-cgi';
|
||||
$file_extensions = 'php';
|
||||
$mod_fcgid_starter = 0;
|
||||
$mod_fcgid_maxrequests = 0;
|
||||
}
|
||||
|
||||
if (strlen($description) == 0
|
||||
|| strlen($description) > 50
|
||||
) {
|
||||
standard_error('descriptioninvalid');
|
||||
}
|
||||
|
||||
$ins_stmt = Database::prepare("
|
||||
INSERT INTO `" . TABLE_PANEL_PHPCONFIGS . "` SET
|
||||
`description` = :desc,
|
||||
`binary` = :binary,
|
||||
`file_extensions` = :fext,
|
||||
`mod_fcgid_starter` = :starter,
|
||||
`mod_fcgid_maxrequests` = :mreq,
|
||||
`fpm_slowlog` = :fpmslow,
|
||||
`fpm_reqterm` = :fpmreqterm,
|
||||
`fpm_reqslow` = :fpmreqslow,
|
||||
`phpsettings` = :phpsettings"
|
||||
);
|
||||
$ins_data = array(
|
||||
'desc' => $description,
|
||||
'binary' => $binary,
|
||||
'fext' => $file_extensions,
|
||||
'starter' => $mod_fcgid_starter,
|
||||
'mreq' => $mod_fcgid_maxrequests,
|
||||
'fpmslow' => $fpm_enableslowlog,
|
||||
'fpmreqterm' => $fpm_reqtermtimeout,
|
||||
'fpmreqslow' => $fpm_reqslowtimeout,
|
||||
'phpsettings' => $phpsettings
|
||||
);
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
|
||||
inserttask('1');
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting with description '" . $description . "' has been created by '" . $userinfo['loginname'] . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$result_stmt = Database::query("SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = 1");
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
$fpmconfigs = '';
|
||||
$configs = Database::query("SELECT * FROM `" . TABLE_PANEL_FPMDAEMONS . "` ORDER BY `description` ASC");
|
||||
while ($row = $configs->fetch(PDO::FETCH_ASSOC)) {
|
||||
$fpmconfigs .= \Froxlor\UI\HTML::makeoption($row['description'], $row['id'], 1, true, true);
|
||||
}
|
||||
|
||||
$pm_select = \Froxlor\UI\HTML::makeoption('static', 'static', 'static', true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('dynamic', 'dynamic', 'static', true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('ondemand', 'ondemand', 'static', true, true);
|
||||
|
||||
$phpconfig_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/phpconfig/formfield.phpconfig_add.php';
|
||||
$phpconfig_add_form = htmlform::genHTMLForm($phpconfig_add_data);
|
||||
$phpconfig_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($phpconfig_add_data);
|
||||
|
||||
$title = $phpconfig_add_data['phpconfig_add']['title'];
|
||||
$image = $phpconfig_add_data['phpconfig_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("phpconfig/overview_add") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("phpconfig/overview_add") . "\";");
|
||||
}
|
||||
|
||||
} else {
|
||||
standard_error('nopermissionsorinvalidid');
|
||||
\Froxlor\UI\Response::standard_error('nopermissionsorinvalidid');
|
||||
}
|
||||
}
|
||||
|
||||
if ($action == 'delete') {
|
||||
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = :id"
|
||||
);
|
||||
$result = Database::pexecute_first($result_stmt, array('id' => $id));
|
||||
|
||||
if ((Settings::Get('system.mod_fcgid') == '1'
|
||||
&& Settings::Get('system.mod_fcgid_defaultini_ownvhost') == $id)
|
||||
|| (Settings::Get('phpfpm.enabled') == '1'
|
||||
&& Settings::Get('phpfpm.vhost_defaultini') == $id)
|
||||
) {
|
||||
standard_error('cannotdeletehostnamephpconfig');
|
||||
try {
|
||||
$json_result = PhpSettings::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if ((Settings::Get('system.mod_fcgid') == '1'
|
||||
&& Settings::Get('system.mod_fcgid_defaultini') == $id)
|
||||
|| (Settings::Get('phpfpm.enabled') == '1'
|
||||
&& Settings::Get('phpfpm.defaultini') == $id)
|
||||
) {
|
||||
standard_error('cannotdeletedefaultphpconfig');
|
||||
if ($result['id'] != 0 && $result['id'] == $id && (int) $userinfo['change_serversettings'] == 1 && $id != 1) // cannot delete the default php.config
|
||||
{
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
PhpSettings::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
if ($result['id'] != 0
|
||||
&& $result['id'] == $id
|
||||
&& (int)$userinfo['change_serversettings'] == 1
|
||||
&& $id != 1 // cannot delete the default php.config
|
||||
) {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
// set php-config to default for all domains using the
|
||||
// config that is to be deleted
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
|
||||
`phpsettingid` = '1' WHERE `phpsettingid` = :id"
|
||||
);
|
||||
Database::pexecute($upd_stmt, array('id' => $id));
|
||||
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = :id"
|
||||
);
|
||||
Database::pexecute($del_stmt, array('id' => $id));
|
||||
|
||||
inserttask('1');
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting with id #" . (int)$id . " has been deleted by '" . $userinfo['loginname'] . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('phpsetting_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['description']);
|
||||
\Froxlor\UI\HTML::askYesNo('phpsetting_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['description']);
|
||||
}
|
||||
} else {
|
||||
standard_error('nopermissionsorinvalidid');
|
||||
\Froxlor\UI\Response::standard_error('nopermissionsorinvalidid');
|
||||
}
|
||||
}
|
||||
|
||||
if ($action == 'edit') {
|
||||
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_PHPCONFIGS . "` WHERE `id` = :id"
|
||||
);
|
||||
$result = Database::pexecute_first($result_stmt, array('id' => $id));
|
||||
|
||||
if ($result['id'] != 0
|
||||
&& $result['id'] == $id
|
||||
&& (int)$userinfo['change_serversettings'] == 1
|
||||
) {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$description = validate($_POST['description'], 'description');
|
||||
$phpsettings = validate(str_replace("\r\n", "\n", $_POST['phpsettings']), 'phpsettings', '/^[^\0]*$/');
|
||||
|
||||
if (Settings::Get('system.mod_fcgid') == 1) {
|
||||
$binary = makeCorrectFile(validate($_POST['binary'], 'binary'));
|
||||
$file_extensions = validate($_POST['file_extensions'], 'file_extensions', '/^[a-zA-Z0-9\s]*$/');
|
||||
$mod_fcgid_starter = validate($_POST['mod_fcgid_starter'], 'mod_fcgid_starter', '/^[0-9]*$/', '', array('-1', ''));
|
||||
$mod_fcgid_maxrequests = validate($_POST['mod_fcgid_maxrequests'], 'mod_fcgid_maxrequests', '/^[0-9]*$/', '', array('-1', ''));
|
||||
// disable fpm stuff
|
||||
$fpm_enableslowlog = 0;
|
||||
$fpm_reqtermtimeout = 0;
|
||||
$fpm_reqslowtimeout = 0;
|
||||
}
|
||||
elseif (Settings::Get('phpfpm.enabled') == 1) {
|
||||
$fpm_enableslowlog = isset($_POST['phpfpm_enable_slowlog']) ? (int)$_POST['phpfpm_enable_slowlog'] : 0;
|
||||
$fpm_reqtermtimeout = validate($_POST['phpfpm_reqtermtimeout'], 'phpfpm_reqtermtimeout', '/^([0-9]+)(|s|m|h|d)$/');
|
||||
$fpm_reqslowtimeout = validate($_POST['phpfpm_reqslowtimeout'], 'phpfpm_reqslowtimeout', '/^([0-9]+)(|s|m|h|d)$/');
|
||||
// disable fcgid stuff
|
||||
$binary = '/usr/bin/php-cgi';
|
||||
$file_extensions = 'php';
|
||||
$mod_fcgid_starter = 0;
|
||||
$mod_fcgid_maxrequests = 0;
|
||||
}
|
||||
|
||||
if (strlen($description) == 0
|
||||
|| strlen($description) > 50
|
||||
) {
|
||||
standard_error('descriptioninvalid');
|
||||
}
|
||||
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_PHPCONFIGS . "` SET
|
||||
`description` = :desc,
|
||||
`binary` = :binary,
|
||||
`file_extensions` = :fext,
|
||||
`mod_fcgid_starter` = :starter,
|
||||
`mod_fcgid_maxrequests` = :mreq,
|
||||
`fpm_slowlog` = :fpmslow,
|
||||
`fpm_reqterm` = :fpmreqterm,
|
||||
`fpm_reqslow` = :fpmreqslow,
|
||||
`phpsettings` = :phpsettings
|
||||
WHERE `id` = :id"
|
||||
);
|
||||
$upd_data = array(
|
||||
'desc' => $description,
|
||||
'binary' => $binary,
|
||||
'fext' => $file_extensions,
|
||||
'starter' => $mod_fcgid_starter,
|
||||
'mreq' => $mod_fcgid_maxrequests,
|
||||
'fpmslow' => $fpm_enableslowlog,
|
||||
'fpmreqterm' => $fpm_reqtermtimeout,
|
||||
'fpmreqslow' => $fpm_reqslowtimeout,
|
||||
'phpsettings' => $phpsettings,
|
||||
try {
|
||||
$json_result = PhpSettings::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
);
|
||||
Database::pexecute($upd_stmt, $upd_data);
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
inserttask('1');
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "php.ini setting with description '" . $description . "' has been changed by '" . $userinfo['loginname'] . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
if ($result['id'] != 0 && $result['id'] == $id && (int) $userinfo['change_serversettings'] == 1) {
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
PhpSettings::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$fpmconfigs = '';
|
||||
$configs = Database::query("SELECT * FROM `" . TABLE_PANEL_FPMDAEMONS . "` ORDER BY `description` ASC");
|
||||
while ($row = $configs->fetch(PDO::FETCH_ASSOC)) {
|
||||
$fpmconfigs .= \Froxlor\UI\HTML::makeoption($row['description'], $row['id'], $result['fpmsettingid'], true, true);
|
||||
}
|
||||
|
||||
$pm_select = \Froxlor\UI\HTML::makeoption('static', 'static', $result['pm'], true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('dynamic', 'dynamic', $result['pm'], true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('ondemand', 'ondemand', $result['pm'], true, true);
|
||||
|
||||
$phpconfig_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/phpconfig/formfield.phpconfig_edit.php';
|
||||
$phpconfig_edit_form = htmlform::genHTMLForm($phpconfig_edit_data);
|
||||
$phpconfig_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($phpconfig_edit_data);
|
||||
|
||||
$title = $phpconfig_edit_data['phpconfig_edit']['title'];
|
||||
$image = $phpconfig_edit_data['phpconfig_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("phpconfig/overview_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("phpconfig/overview_edit") . "\";");
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::standard_error('nopermissionsorinvalidid');
|
||||
}
|
||||
}
|
||||
} elseif ($page == 'fpmdaemons') {
|
||||
|
||||
if ($action == '') {
|
||||
|
||||
try {
|
||||
$json_result = FpmDaemons::getLocal($userinfo)->listing();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
$tablecontent = '';
|
||||
$count = 0;
|
||||
if (isset($result['count']) && $result['count'] > 0) {
|
||||
foreach ($result['list'] as $row) {
|
||||
$configs = "";
|
||||
foreach ($row['configs'] as $configused) {
|
||||
$configs .= $configused . "<br>";
|
||||
}
|
||||
$count ++;
|
||||
eval("\$tablecontent.=\"" . \Froxlor\UI\Template::getTemplate("phpconfig/fpmdaemons_overview") . "\";");
|
||||
}
|
||||
}
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("phpconfig/fpmdaemons") . "\";");
|
||||
}
|
||||
|
||||
if ($action == 'add') {
|
||||
|
||||
if ((int) $userinfo['change_serversettings'] == 1) {
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
FpmDaemons::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
standard_error('nopermissionsorinvalidid');
|
||||
|
||||
$pm_select = \Froxlor\UI\HTML::makeoption('static', 'static', 'static', true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('dynamic', 'dynamic', 'static', true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('ondemand', 'ondemand', 'static', true, true);
|
||||
|
||||
$fpmconfig_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/phpconfig/formfield.fpmconfig_add.php';
|
||||
$fpmconfig_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($fpmconfig_add_data);
|
||||
|
||||
$title = $fpmconfig_add_data['fpmconfig_add']['title'];
|
||||
$image = $fpmconfig_add_data['fpmconfig_add']['image'];
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("phpconfig/fpmconfig_add") . "\";");
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::standard_error('nopermissionsorinvalidid');
|
||||
}
|
||||
}
|
||||
|
||||
if ($action == 'delete') {
|
||||
|
||||
try {
|
||||
$json_result = FpmDaemons::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if ($id == 1) {
|
||||
\Froxlor\UI\Response::standard_error('cannotdeletedefaultphpconfig');
|
||||
}
|
||||
|
||||
if ($result['id'] != 0 && $result['id'] == $id && (int) $userinfo['change_serversettings'] == 1 && $id != 1) // cannot delete the default php.config
|
||||
{
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
FpmDaemons::getLocal($userinfo, $_POST)->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
\Froxlor\UI\HTML::askYesNo('fpmsetting_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['description']);
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::standard_error('nopermissionsorinvalidid');
|
||||
}
|
||||
}
|
||||
|
||||
if ($action == 'edit') {
|
||||
|
||||
try {
|
||||
$json_result = FpmDaemons::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if ($result['id'] != 0 && $result['id'] == $id && (int) $userinfo['change_serversettings'] == 1) {
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
FpmDaemons::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$pm_select = \Froxlor\UI\HTML::makeoption('static', 'static', $result['pm'], true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('dynamic', 'dynamic', $result['pm'], true, true);
|
||||
$pm_select .= \Froxlor\UI\HTML::makeoption('ondemand', 'ondemand', $result['pm'], true, true);
|
||||
|
||||
$fpmconfig_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/phpconfig/formfield.fpmconfig_edit.php';
|
||||
$fpmconfig_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($fpmconfig_edit_data);
|
||||
|
||||
$title = $fpmconfig_edit_data['fpmconfig_edit']['title'];
|
||||
$image = $fpmconfig_edit_data['fpmconfig_edit']['image'];
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("phpconfig/fpmconfig_edit") . "\";");
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::standard_error('nopermissionsorinvalidid');
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
513
admin_plans.php
Normal file
@@ -0,0 +1,513 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
$id = intval($_GET['id']);
|
||||
}
|
||||
|
||||
if ($page == '' || $page == 'overview') {
|
||||
|
||||
if ($action == '') {
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed admin_plans");
|
||||
$fields = array(
|
||||
'p.name' => $lng['admin']['plans']['name'],
|
||||
'p.description' => $lng['admin']['plans']['description'],
|
||||
'adminname' => $lng['admin']['admin'],
|
||||
'p.ts' => $lng['admin']['plans']['last_update']
|
||||
);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_PLANS, $fields);
|
||||
$plans = '';
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT p.*, a.loginname as adminname
|
||||
FROM `" . TABLE_PANEL_PLANS . "` p, `" . TABLE_PANEL_ADMINS . "` a
|
||||
WHERE " . ($userinfo['customers_see_all'] ? '' : " `p`.`adminid` = :adminid AND ") . "
|
||||
`p`.`adminid` = `a`.`adminid` " . $paging->getSqlWhere(false) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid']
|
||||
));
|
||||
$paging->setEntries(Database::num_rows());
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$i = 0;
|
||||
$count = 0;
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
$row['ts_format'] = date("d.m.Y H:i", $row['ts']);
|
||||
eval("\$plans.=\"" . \Froxlor\UI\Template::getTemplate("plans/plans_plan") . "\";");
|
||||
$count ++;
|
||||
}
|
||||
$i ++;
|
||||
}
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("plans/plans") . "\";");
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_PLANS . "` WHERE `id` = :id");
|
||||
$result = Database::pexecute_first($result_stmt, array(
|
||||
'id' => $id
|
||||
));
|
||||
|
||||
if ($result['id'] != 0 && $result['id'] == $id && (int) $userinfo['adminid'] == $result['adminid']) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_PLANS . "` WHERE `id` = :id");
|
||||
Database::pexecute($del_stmt, array(
|
||||
'id' => $id
|
||||
));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "Plan '" . $result['name'] . "' has been deleted by '" . $userinfo['loginname'] . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
\Froxlor\UI\HTML::askYesNo('plan_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['name']);
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::standard_error('nopermissionsorinvalidid');
|
||||
}
|
||||
} elseif ($action == 'add') {
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$name = \Froxlor\Validate\Validate::validate($_POST['name'], 'name');
|
||||
$description = \Froxlor\Validate\Validate::validate(str_replace("\r\n", "\n", $_POST['description']), 'description', '/^[^\0]*$/');
|
||||
|
||||
$value_arr = array();
|
||||
|
||||
if (empty($name)) {
|
||||
\Froxlor\UI\Response::standard_error('stringmustntbeempty', 'name');
|
||||
}
|
||||
|
||||
$value_arr['diskspace'] = (int)($_POST['diskspace']);
|
||||
if (isset($_POST['diskspace_ul'])) {
|
||||
$value_arr['diskspace'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['traffic'] = $_POST['traffic'];
|
||||
if (isset($_POST['traffic_ul'])) {
|
||||
$value_arr['traffic'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['subdomains'] = (int)($_POST['subdomains']);
|
||||
if (isset($_POST['subdomains_ul'])) {
|
||||
$value_arr['subdomains'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['emails'] = (int)($_POST['emails']);
|
||||
if (isset($_POST['emails_ul'])) {
|
||||
$value_arr['emails'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['email_accounts'] = (int)($_POST['email_accounts']);
|
||||
if (isset($_POST['email_accounts_ul'])) {
|
||||
$value_arr['email_accounts'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['email_forwarders'] = (int)($_POST['email_forwarders']);
|
||||
if (isset($_POST['email_forwarders_ul'])) {
|
||||
$value_arr['email_forwarders'] = - 1;
|
||||
}
|
||||
|
||||
if (Settings::Get('system.mail_quota_enabled') == '1') {
|
||||
$value_arr['email_quota'] = \Froxlor\Validate\Validate::validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array(
|
||||
'0',
|
||||
''
|
||||
));
|
||||
if (isset($_POST['email_quota_ul'])) {
|
||||
$value_arr['email_quota'] = - 1;
|
||||
}
|
||||
} else {
|
||||
$value_arr['email_quota'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['email_imap'] = 0;
|
||||
if (isset($_POST['email_imap'])) {
|
||||
$value_arr['email_imap'] = (int)($_POST['email_imap']);
|
||||
}
|
||||
|
||||
$value_arr['email_pop3'] = 0;
|
||||
if (isset($_POST['email_pop3'])) {
|
||||
$value_arr['email_pop3'] = (int)($_POST['email_pop3']);
|
||||
}
|
||||
|
||||
$value_arr['ftps'] = (int)($_POST['ftps']);
|
||||
if (isset($_POST['ftps_ul'])) {
|
||||
$value_arr['ftps'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['mysqls'] = (int)($_POST['mysqls']);
|
||||
if (isset($_POST['mysqls_ul'])) {
|
||||
$value_arr['mysqls'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['phpenabled'] = 0;
|
||||
if (isset($_POST['phpenabled'])) {
|
||||
$value_arr['phpenabled'] = intval($_POST['phpenabled']);
|
||||
}
|
||||
|
||||
$value_arr['allowed_phpconfigs'] = array();
|
||||
if (isset($_POST['allowed_phpconfigs']) && is_array($_POST['allowed_phpconfigs'])) {
|
||||
foreach ($_POST['allowed_phpconfigs'] as $allowed_phpconfig) {
|
||||
$allowed_phpconfig = intval($allowed_phpconfig);
|
||||
$value_arr['allowed_phpconfigs'][] = $allowed_phpconfig;
|
||||
}
|
||||
}
|
||||
|
||||
$value_arr['perlenabled'] = 0;
|
||||
if (isset($_POST['perlenabled'])) {
|
||||
$value_arr['perlenabled'] = intval($_POST['perlenabled']);
|
||||
}
|
||||
|
||||
$value_arr['dnsenabled'] = 0;
|
||||
if (isset($_POST['dnsenabled'])) {
|
||||
$value_arr['dnsenabled'] = intval($_POST['dnsenabled']);
|
||||
}
|
||||
|
||||
$ins_stmt = Database::prepare("
|
||||
INSERT INTO `" . TABLE_PANEL_PLANS . "`
|
||||
SET `adminid` = :adminid, `name` = :name, `description` = :desc, `value` = :valuearr, `ts` = UNIX_TIMESTAMP();
|
||||
");
|
||||
$ins_data = array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'name' => $name,
|
||||
'desc' => $description,
|
||||
'valuearr' => json_encode($value_arr)
|
||||
);
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, "added plan '" . $name . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$diskspace_ul = \Froxlor\UI\HTML::makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$traffic_ul = \Froxlor\UI\HTML::makecheckbox('traffic_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$subdomains_ul = \Froxlor\UI\HTML::makecheckbox('subdomains_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$emails_ul = \Froxlor\UI\HTML::makecheckbox('emails_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_accounts_ul = \Froxlor\UI\HTML::makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_forwarders_ul = \Froxlor\UI\HTML::makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$email_quota_ul = \Froxlor\UI\HTML::makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$ftps_ul = \Froxlor\UI\HTML::makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
$mysqls_ul = \Froxlor\UI\HTML::makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, '0', true, true);
|
||||
|
||||
$phpconfigs = array();
|
||||
$configs = Database::query("
|
||||
SELECT c.*, fc.description as interpreter
|
||||
FROM `" . TABLE_PANEL_PHPCONFIGS . "` c
|
||||
LEFT JOIN `" . TABLE_PANEL_FPMDAEMONS . "` fc ON fc.id = c.fpmsettingid
|
||||
");
|
||||
while ($row = $configs->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ((int) Settings::Get('phpfpm.enabled') == 1) {
|
||||
$phpconfigs[] = array(
|
||||
'label' => $row['description'] . " [" . $row['interpreter'] . "]<br />",
|
||||
'value' => $row['id']
|
||||
);
|
||||
} else {
|
||||
$phpconfigs[] = array(
|
||||
'label' => $row['description'] . "<br />",
|
||||
'value' => $row['id']
|
||||
);
|
||||
}
|
||||
}
|
||||
|
||||
// dummy to avoid unknown variables
|
||||
$language_options = null;
|
||||
$gender_options = null;
|
||||
$hosting_plans = null;
|
||||
|
||||
$plans_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/plans/formfield.plans_add.php';
|
||||
$cust_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/customer/formfield.customer_add.php';
|
||||
// unset unneeded stuff
|
||||
unset($cust_add_data['customer_add']['sections']['section_a']);
|
||||
unset($cust_add_data['customer_add']['sections']['section_b']);
|
||||
unset($cust_add_data['customer_add']['sections']['section_cpre']);
|
||||
// merge
|
||||
$plans_add_data['plans_add']['sections'] = array_merge($plans_add_data['plans_add']['sections'], $cust_add_data['customer_add']['sections']);
|
||||
$plans_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($plans_add_data);
|
||||
|
||||
$title = $plans_add_data['plans_add']['title'];
|
||||
$image = $plans_add_data['plans_add']['image'];
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("plans/plans_add") . "\";");
|
||||
}
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_PLANS . "` WHERE `id` = :id");
|
||||
$result = Database::pexecute_first($result_stmt, array(
|
||||
'id' => $id
|
||||
));
|
||||
|
||||
if ($result['name'] != '') {
|
||||
|
||||
$result['value'] = json_decode($result['value'], true);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
|
||||
foreach ($result['value'] as $index => $value) {
|
||||
$result[$index] = $value;
|
||||
}
|
||||
$result['allowed_phpconfigs'] = json_encode($result['allowed_phpconfigs']);
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
$name = \Froxlor\Validate\Validate::validate($_POST['name'], 'name');
|
||||
$description = \Froxlor\Validate\Validate::validate(str_replace("\r\n", "\n", $_POST['description']), 'description', '/^[^\0]*$/');
|
||||
|
||||
$value_arr = array();
|
||||
|
||||
$value_arr['diskspace'] = (int)($_POST['diskspace']);
|
||||
if (isset($_POST['diskspace_ul'])) {
|
||||
$value_arr['diskspace'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['traffic'] = $_POST['traffic'];
|
||||
if (isset($_POST['traffic_ul'])) {
|
||||
$value_arr['traffic'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['subdomains'] = (int)($_POST['subdomains']);
|
||||
if (isset($_POST['subdomains_ul'])) {
|
||||
$value_arr['subdomains'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['emails'] = (int)($_POST['emails']);
|
||||
if (isset($_POST['emails_ul'])) {
|
||||
$value_arr['emails'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['email_accounts'] = (int)($_POST['email_accounts']);
|
||||
if (isset($_POST['email_accounts_ul'])) {
|
||||
$value_arr['email_accounts'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['email_forwarders'] = (int)($_POST['email_forwarders']);
|
||||
if (isset($_POST['email_forwarders_ul'])) {
|
||||
$value_arr['email_forwarders'] = - 1;
|
||||
}
|
||||
|
||||
if (Settings::Get('system.mail_quota_enabled') == '1') {
|
||||
$value_arr['email_quota'] = \Froxlor\Validate\Validate::validate($_POST['email_quota'], 'email_quota', '/^\d+$/', 'vmailquotawrong', array(
|
||||
'0',
|
||||
''
|
||||
));
|
||||
if (isset($_POST['email_quota_ul'])) {
|
||||
$value_arr['email_quota'] = - 1;
|
||||
}
|
||||
} else {
|
||||
$value_arr['email_quota'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['email_imap'] = 0;
|
||||
if (isset($_POST['email_imap'])) {
|
||||
$value_arr['email_imap'] = (int)($_POST['email_imap']);
|
||||
}
|
||||
|
||||
$value_arr['email_pop3'] = 0;
|
||||
if (isset($_POST['email_pop3'])) {
|
||||
$value_arr['email_pop3'] = (int)($_POST['email_pop3']);
|
||||
}
|
||||
|
||||
$value_arr['ftps'] = (int)($_POST['ftps']);
|
||||
if (isset($_POST['ftps_ul'])) {
|
||||
$value_arr['ftps'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['mysqls'] = (int)($_POST['mysqls']);
|
||||
if (isset($_POST['mysqls_ul'])) {
|
||||
$value_arr['mysqls'] = - 1;
|
||||
}
|
||||
|
||||
$value_arr['phpenabled'] = 0;
|
||||
if (isset($_POST['phpenabled'])) {
|
||||
$value_arr['phpenabled'] = intval($_POST['phpenabled']);
|
||||
}
|
||||
|
||||
$value_arr['allowed_phpconfigs'] = array();
|
||||
if (isset($_POST['allowed_phpconfigs']) && is_array($_POST['allowed_phpconfigs'])) {
|
||||
foreach ($_POST['allowed_phpconfigs'] as $allowed_phpconfig) {
|
||||
$allowed_phpconfig = intval($allowed_phpconfig);
|
||||
$value_arr['allowed_phpconfigs'][] = $allowed_phpconfig;
|
||||
}
|
||||
}
|
||||
|
||||
$value_arr['perlenabled'] = 0;
|
||||
if (isset($_POST['perlenabled'])) {
|
||||
$value_arr['perlenabled'] = intval($_POST['perlenabled']);
|
||||
}
|
||||
|
||||
$value_arr['dnsenabled'] = 0;
|
||||
if (isset($_POST['dnsenabled'])) {
|
||||
$value_arr['dnsenabled'] = intval($_POST['dnsenabled']);
|
||||
}
|
||||
|
||||
$ins_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_PLANS . "`
|
||||
SET `name` = :name, `description` = :desc, `value` = :valuearr, `ts` = UNIX_TIMESTAMP()
|
||||
WHERE `id` = :id
|
||||
");
|
||||
$ins_data = array(
|
||||
'name' => $name,
|
||||
'desc' => $description,
|
||||
'valuearr' => json_encode($value_arr),
|
||||
'id' => $id
|
||||
);
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, "updated plan '" . $name . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$diskspace_ul = \Froxlor\UI\HTML::makecheckbox('diskspace_ul', $lng['customer']['unlimited'], '-1', false, $result['diskspace'], true, true);
|
||||
if ($result['diskspace'] == '-1') {
|
||||
$result['diskspace'] = '';
|
||||
}
|
||||
|
||||
$traffic_ul = \Froxlor\UI\HTML::makecheckbox('traffic_ul', $lng['customer']['unlimited'], '-1', false, $result['traffic'], true, true);
|
||||
if ($result['traffic'] == '-1') {
|
||||
$result['traffic'] = '';
|
||||
}
|
||||
|
||||
$subdomains_ul = \Froxlor\UI\HTML::makecheckbox('subdomains_ul', $lng['customer']['unlimited'], '-1', false, $result['subdomains'], true, true);
|
||||
if ($result['subdomains'] == '-1') {
|
||||
$result['subdomains'] = '';
|
||||
}
|
||||
|
||||
$emails_ul = \Froxlor\UI\HTML::makecheckbox('emails_ul', $lng['customer']['unlimited'], '-1', false, $result['emails'], true, true);
|
||||
if ($result['emails'] == '-1') {
|
||||
$result['emails'] = '';
|
||||
}
|
||||
|
||||
$email_accounts_ul = \Froxlor\UI\HTML::makecheckbox('email_accounts_ul', $lng['customer']['unlimited'], '-1', false, $result['email_accounts'], true, true);
|
||||
if ($result['email_accounts'] == '-1') {
|
||||
$result['email_accounts'] = '';
|
||||
}
|
||||
|
||||
$email_forwarders_ul = \Froxlor\UI\HTML::makecheckbox('email_forwarders_ul', $lng['customer']['unlimited'], '-1', false, $result['email_forwarders'], true, true);
|
||||
if ($result['email_forwarders'] == '-1') {
|
||||
$result['email_forwarders'] = '';
|
||||
}
|
||||
|
||||
$email_quota_ul = \Froxlor\UI\HTML::makecheckbox('email_quota_ul', $lng['customer']['unlimited'], '-1', false, $result['email_quota'], true, true);
|
||||
if ($result['email_quota'] == '-1') {
|
||||
$result['email_quota'] = '';
|
||||
}
|
||||
|
||||
$ftps_ul = \Froxlor\UI\HTML::makecheckbox('ftps_ul', $lng['customer']['unlimited'], '-1', false, $result['ftps'], true, true);
|
||||
if ($result['ftps'] == '-1') {
|
||||
$result['ftps'] = '';
|
||||
}
|
||||
|
||||
$mysqls_ul = \Froxlor\UI\HTML::makecheckbox('mysqls_ul', $lng['customer']['unlimited'], '-1', false, $result['mysqls'], true, true);
|
||||
if ($result['mysqls'] == '-1') {
|
||||
$result['mysqls'] = '';
|
||||
}
|
||||
|
||||
$phpconfigs = array();
|
||||
$configs = Database::query("
|
||||
SELECT c.*, fc.description as interpreter
|
||||
FROM `" . TABLE_PANEL_PHPCONFIGS . "` c
|
||||
LEFT JOIN `" . TABLE_PANEL_FPMDAEMONS . "` fc ON fc.id = c.fpmsettingid
|
||||
");
|
||||
while ($row = $configs->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ((int) Settings::Get('phpfpm.enabled') == 1) {
|
||||
$phpconfigs[] = array(
|
||||
'label' => $row['description'] . " [" . $row['interpreter'] . "]<br />",
|
||||
'value' => $row['id']
|
||||
);
|
||||
} else {
|
||||
$phpconfigs[] = array(
|
||||
'label' => $row['description'] . "<br />",
|
||||
'value' => $row['id']
|
||||
);
|
||||
}
|
||||
}
|
||||
|
||||
$result['imap'] = $result['email_imap'];
|
||||
$result['pop3'] = $result['email_pop3'];
|
||||
|
||||
// dummy to avoid unknown variables
|
||||
$result['loginname'] = null;
|
||||
$result['documentroot'] = null;
|
||||
$result['standardsubdomain'] = null;
|
||||
$result['deactivated'] = null;
|
||||
$language_options = null;
|
||||
$result['firstname'] = null;
|
||||
$gender_options = null;
|
||||
$result['company'] = null;
|
||||
$result['street'] = null;
|
||||
$result['zipcode'] = null;
|
||||
$result['city'] = null;
|
||||
$result['phone'] = null;
|
||||
$result['fax'] = null;
|
||||
$result['email'] = null;
|
||||
$result['customernumber'] = null;
|
||||
$result['custom_notes'] = null;
|
||||
$result['custom_notes_show'] = null;
|
||||
$hosting_plans = null;
|
||||
$admin_select_cnt = null;
|
||||
$admin_select = null;
|
||||
|
||||
$plans_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/plans/formfield.plans_edit.php';
|
||||
$cust_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/customer/formfield.customer_edit.php';
|
||||
// unset unneeded stuff
|
||||
unset($cust_edit_data['customer_edit']['sections']['section_a']);
|
||||
unset($cust_edit_data['customer_edit']['sections']['section_b']);
|
||||
unset($cust_edit_data['customer_edit']['sections']['section_cpre']);
|
||||
// merge
|
||||
$plans_edit_data['plans_edit']['sections'] = array_merge($plans_edit_data['plans_edit']['sections'], $cust_edit_data['customer_edit']['sections']);
|
||||
$plans_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($plans_edit_data);
|
||||
|
||||
$title = $plans_edit_data['plans_edit']['title'];
|
||||
$image = $plans_edit_data['plans_edit']['image'];
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("plans/plans_edit") . "\";");
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'jqGetPlanValues') {
|
||||
$planid = isset($_POST['planid']) ? (int) $_POST['planid'] : 0;
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_PLANS . "` WHERE `id` = :id");
|
||||
$result = Database::pexecute_first($result_stmt, array(
|
||||
'id' => $planid
|
||||
));
|
||||
echo $result['value'];
|
||||
exit();
|
||||
}
|
||||
}
|
||||
@@ -16,6 +16,9 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\Froxlor;
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
@@ -27,12 +30,10 @@ $sql_root = Database::getSqlData();
|
||||
Database::needRoot(false);
|
||||
|
||||
if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
|
||||
$settings_data = loadConfigArrayDir('./actions/admin/settings/');
|
||||
$settings = loadSettings($settings_data);
|
||||
$settings_data = \Froxlor\PhpHelper::loadConfigArrayDir('./actions/admin/settings/');
|
||||
Settings::loadSettingsInto($settings_data);
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
$_part = isset($_GET['part']) ? $_GET['part'] : '';
|
||||
if ($_part == '') {
|
||||
@@ -48,7 +49,6 @@ if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
|
||||
$settings_part = true;
|
||||
}
|
||||
$only_enabledisable = false;
|
||||
|
||||
} else {
|
||||
$settings_all = false;
|
||||
$settings_part = false;
|
||||
@@ -56,30 +56,28 @@ if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
|
||||
}
|
||||
|
||||
// check if the session timeout is too low #815
|
||||
if (isset($_POST['session_sessiontimeout'])
|
||||
&& $_POST['session_sessiontimeout'] < 60
|
||||
) {
|
||||
standard_error($lng['error']['session_timeout'], $lng['error']['session_timeout_desc']);
|
||||
if (isset($_POST['session_sessiontimeout']) && $_POST['session_sessiontimeout'] < 60) {
|
||||
\Froxlor\UI\Response::standard_error($lng['error']['session_timeout'], $lng['error']['session_timeout_desc']);
|
||||
}
|
||||
|
||||
if (processFormEx(
|
||||
$settings_data,
|
||||
$_POST,
|
||||
array('filename' => $filename, 'action' => $action, 'page' => $page),
|
||||
$_part,
|
||||
$settings_all,
|
||||
$settings_part,
|
||||
$only_enabledisable
|
||||
)
|
||||
) {
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
|
||||
inserttask('1');
|
||||
if (\Froxlor\UI\Form::processFormEx($settings_data, $_POST, array(
|
||||
'filename' => $filename,
|
||||
'action' => $action,
|
||||
'page' => $page
|
||||
), $_part, $settings_all, $settings_part, $only_enabledisable)) {
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "rebuild configfiles due to changed setting");
|
||||
\Froxlor\System\Cronjob::inserttask('1');
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
\Froxlor\System\Cronjob::inserttask('4');
|
||||
// cron.d file
|
||||
\Froxlor\System\Cronjob::inserttask('99');
|
||||
|
||||
standard_success('settingssaved', '', array('filename' => $filename, 'action' => $action, 'page' => $page));
|
||||
\Froxlor\UI\Response::standard_success('settingssaved', '', array(
|
||||
'filename' => $filename,
|
||||
'action' => $action,
|
||||
'page' => $page
|
||||
));
|
||||
}
|
||||
|
||||
} else {
|
||||
|
||||
$_part = isset($_GET['part']) ? $_GET['part'] : '';
|
||||
@@ -87,39 +85,36 @@ if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
|
||||
$_part = isset($_POST['part']) ? $_POST['part'] : '';
|
||||
}
|
||||
|
||||
$fields = buildFormEx($settings_data, $_part);
|
||||
$fields = \Froxlor\UI\Form::buildFormEx($settings_data, $_part);
|
||||
|
||||
$settings_page = '';
|
||||
if ($_part == '') {
|
||||
eval("\$settings_page .= \"" . getTemplate("settings/settings_overview") . "\";");
|
||||
eval("\$settings_page .= \"" . \Froxlor\UI\Template::getTemplate("settings/settings_overview") . "\";");
|
||||
} else {
|
||||
eval("\$settings_page .= \"" . getTemplate("settings/settings") . "\";");
|
||||
eval("\$settings_page .= \"" . \Froxlor\UI\Template::getTemplate("settings/settings") . "\";");
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("settings/settings_form_begin") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/settings_form_begin") . "\";");
|
||||
eval("echo \$settings_page;");
|
||||
eval("echo \"" . getTemplate("settings/settings_form_end") . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/settings_form_end") . "\";");
|
||||
}
|
||||
|
||||
} elseif($page == 'phpinfo'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
} elseif ($page == 'phpinfo' && $userinfo['change_serversettings'] == '1') {
|
||||
ob_start();
|
||||
phpinfo();
|
||||
$phpinfo = array('phpinfo' => array());
|
||||
if (preg_match_all(
|
||||
'#(?:<h2>(?:<a name=".*?">)?(.*?)(?:</a>)?</h2>)|(?:<tr(?: class=".*?")?><t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>)?)?</tr>)#s',
|
||||
ob_get_clean(), $matches, PREG_SET_ORDER
|
||||
)
|
||||
) {
|
||||
$phpinfo = array(
|
||||
'phpinfo' => array()
|
||||
);
|
||||
if (preg_match_all('#(?:<h2>(?:<a name=".*?">)?(.*?)(?:</a>)?</h2>)|(?:<tr(?: class=".*?")?><t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>(?:<t[hd](?: class=".*?")?>(.*?)\s*</t[hd]>)?)?</tr>)#s', ob_get_clean(), $matches, PREG_SET_ORDER)) {
|
||||
foreach ($matches as $match) {
|
||||
$end = array_keys($phpinfo);
|
||||
$end = end($end);
|
||||
if (strlen($match[1])) {
|
||||
$phpinfo[$match[1]] = array();
|
||||
} elseif (isset($match[3])) {
|
||||
$phpinfo[$end][$match[2]] = isset($match[4]) ? array($match[3], $match[4]) : $match[3];
|
||||
$phpinfo[$end][$match[2]] = isset($match[4]) ? array(
|
||||
$match[3],
|
||||
$match[4]
|
||||
) : $match[3];
|
||||
} else {
|
||||
$phpinfo[$end][] = $match[2];
|
||||
}
|
||||
@@ -129,112 +124,99 @@ if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
|
||||
$phpinfoentries = "";
|
||||
foreach ($section as $key => $val) {
|
||||
if (is_array($val)) {
|
||||
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_3") . "\";");
|
||||
eval("\$phpinfoentries .= \"" . \Froxlor\UI\Template::getTemplate("settings/phpinfo/phpinfo_3") . "\";");
|
||||
} elseif (is_string($key)) {
|
||||
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_2") . "\";");
|
||||
eval("\$phpinfoentries .= \"" . \Froxlor\UI\Template::getTemplate("settings/phpinfo/phpinfo_2") . "\";");
|
||||
} else {
|
||||
eval("\$phpinfoentries .= \"" . getTemplate("settings/phpinfo/phpinfo_1") . "\";");
|
||||
eval("\$phpinfoentries .= \"" . \Froxlor\UI\Template::getTemplate("settings/phpinfo/phpinfo_1") . "\";");
|
||||
}
|
||||
}
|
||||
// first header -> show actual php version
|
||||
if (strtolower($name) == "phpinfo") {
|
||||
$name = "PHP " . PHP_VERSION;
|
||||
}
|
||||
eval("\$phpinfohtml .= \"" . getTemplate("settings/phpinfo/phpinfo_table") . "\";");
|
||||
eval("\$phpinfohtml .= \"" . \Froxlor\UI\Template::getTemplate("settings/phpinfo/phpinfo_table") . "\";");
|
||||
}
|
||||
$phpinfo = $phpinfohtml;
|
||||
} else {
|
||||
standard_error($lng['error']['no_phpinfo']);
|
||||
\Froxlor\UI\Response::standard_error($lng['error']['no_phpinfo']);
|
||||
}
|
||||
eval("echo \"" . getTemplate("settings/phpinfo") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/phpinfo") . "\";");
|
||||
} elseif ($page == 'rebuildconfigs' && $userinfo['change_serversettings'] == '1') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
} elseif($page == 'rebuildconfigs'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "rebuild configfiles");
|
||||
inserttask('1');
|
||||
inserttask('10');
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "rebuild configfiles");
|
||||
\Froxlor\System\Cronjob::inserttask('1');
|
||||
\Froxlor\System\Cronjob::inserttask('10');
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
|
||||
standard_success('rebuildingconfigs', '', array('filename' => 'admin_index.php'));
|
||||
\Froxlor\System\Cronjob::inserttask('4');
|
||||
// cron.d file
|
||||
\Froxlor\System\Cronjob::inserttask('99');
|
||||
|
||||
\Froxlor\UI\Response::standard_success('rebuildingconfigs', '', array(
|
||||
'filename' => 'admin_index.php'
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_configs_reallyrebuild', $filename, array('page' => $page));
|
||||
\Froxlor\UI\HTML::askYesNo('admin_configs_reallyrebuild', $filename, array(
|
||||
'page' => $page
|
||||
));
|
||||
}
|
||||
} elseif ($page == 'updatecounters' && $userinfo['change_serversettings'] == '1') {
|
||||
|
||||
} elseif($page == 'updatecounters'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "updated resource-counters");
|
||||
$updatecounters = updateCounters(true);
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "updated resource-counters");
|
||||
$updatecounters = \Froxlor\User::updateCounters(true);
|
||||
$customers = '';
|
||||
foreach ($updatecounters['customers'] as $customerid => $customer) {
|
||||
eval("\$customers.=\"" . getTemplate("settings/updatecounters_row_customer") . "\";");
|
||||
eval("\$customers.=\"" . \Froxlor\UI\Template::getTemplate("settings/updatecounters_row_customer") . "\";");
|
||||
}
|
||||
|
||||
$admins = '';
|
||||
foreach ($updatecounters['admins'] as $adminid => $admin) {
|
||||
eval("\$admins.=\"" . getTemplate("settings/updatecounters_row_admin") . "\";");
|
||||
eval("\$admins.=\"" . \Froxlor\UI\Template::getTemplate("settings/updatecounters_row_admin") . "\";");
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("settings/updatecounters") . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/updatecounters") . "\";");
|
||||
} else {
|
||||
ask_yesno('admin_counters_reallyupdate', $filename, array('page' => $page));
|
||||
\Froxlor\UI\HTML::askYesNo('admin_counters_reallyupdate', $filename, array(
|
||||
'page' => $page
|
||||
));
|
||||
}
|
||||
} elseif ($page == 'wipecleartextmailpws' && $userinfo['change_serversettings'] == '1') {
|
||||
|
||||
} elseif ($page == 'wipecleartextmailpws'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_WARNING, "wiped all cleartext mail passwords");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, "wiped all cleartext mail passwords");
|
||||
Database::query("UPDATE `" . TABLE_MAIL_USERS . "` SET `password` = '';");
|
||||
Database::query("UPDATE `" . TABLE_PANEL_SETTINGS . "` SET `value` = '0' WHERE `settinggroup` = 'system' AND `varname` = 'mailpwcleartext'");
|
||||
redirectTo($filename, array('s' => $s));
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_cleartextmailpws_reallywipe', $filename, array('page' => $page));
|
||||
\Froxlor\UI\HTML::askYesNo('admin_cleartextmailpws_reallywipe', $filename, array(
|
||||
'page' => $page
|
||||
));
|
||||
}
|
||||
} elseif ($page == 'wipequotas' && $userinfo['change_serversettings'] == '1') {
|
||||
|
||||
} elseif($page == 'wipequotas'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_WARNING, "wiped all mailquotas");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, "wiped all mailquotas");
|
||||
|
||||
// Set the quota to 0 which means unlimited
|
||||
Database::query("UPDATE `" . TABLE_MAIL_USERS . "` SET `quota` = '0';");
|
||||
Database::query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_quota_used` = '0'");
|
||||
redirectTo($filename, array('s' => $s));
|
||||
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_quotas_reallywipe', $filename, array('page' => $page));
|
||||
\Froxlor\UI\HTML::askYesNo('admin_quotas_reallywipe', $filename, array(
|
||||
'page' => $page
|
||||
));
|
||||
}
|
||||
|
||||
} elseif ($page == 'enforcequotas'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
} elseif ($page == 'enforcequotas' && $userinfo['change_serversettings'] == '1') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// Fetch all accounts
|
||||
$result_stmt = Database::query("SELECT `quota`, `customerid` FROM `" . TABLE_MAIL_USERS . "`");
|
||||
|
||||
@@ -248,7 +230,10 @@ if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
|
||||
|
||||
while ($array = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$difference = Settings::Get('system.mail_quota') - $array['quota'];
|
||||
Database::pexecute($upd_stmt, array('diff' => $difference, 'customerid' => $customerid));
|
||||
Database::pexecute($upd_stmt, array(
|
||||
'diff' => $difference,
|
||||
'customerid' => $customerid
|
||||
));
|
||||
}
|
||||
}
|
||||
|
||||
@@ -256,34 +241,144 @@ if ($page == 'overview' && $userinfo['change_serversettings'] == '1') {
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_MAIL_USERS . "` SET `quota` = :quota
|
||||
");
|
||||
Database::pexecute($upd_stmt, array('quota' => Settings::Get('system.mail_quota')));
|
||||
Database::pexecute($upd_stmt, array(
|
||||
'quota' => Settings::Get('system.mail_quota')
|
||||
));
|
||||
|
||||
// Update the Customer, if the used quota is bigger than the allowed quota
|
||||
Database::query("UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `email_quota` = `email_quota_used` WHERE `email_quota` < `email_quota_used`");
|
||||
$log->logAction(ADM_ACTION, LOG_WARNING, 'enforcing mailquota to all customers: ' . Settings::Get('system.mail_quota') . ' MB');
|
||||
redirectTo($filename, array('s' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, 'enforcing mailquota to all customers: ' . Settings::Get('system.mail_quota') . ' MB');
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_quotas_reallyenforce', $filename, array('page' => $page));
|
||||
\Froxlor\UI\HTML::askYesNo('admin_quotas_reallyenforce', $filename, array(
|
||||
'page' => $page
|
||||
));
|
||||
}
|
||||
} elseif ($page == 'integritycheck'
|
||||
&& $userinfo['change_serversettings'] == '1'
|
||||
) {
|
||||
$integrity = new IntegrityCheck();
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
} elseif ($page == 'integritycheck' && $userinfo['change_serversettings'] == '1') {
|
||||
$integrity = new \Froxlor\Database\IntegrityCheck();
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$integrity->fixAll();
|
||||
} elseif(isset($_GET['action'])
|
||||
&& $_GET['action'] == "fix") {
|
||||
ask_yesno('admin_integritycheck_reallyfix', $filename, array('page' => $page));
|
||||
} elseif (isset($_GET['action']) && $_GET['action'] == "fix") {
|
||||
\Froxlor\UI\HTML::askYesNo('admin_integritycheck_reallyfix', $filename, array(
|
||||
'page' => $page
|
||||
));
|
||||
}
|
||||
|
||||
$integritycheck = '';
|
||||
foreach ($integrity->available as $id => $check) {
|
||||
$displayid = $id + 1;
|
||||
$result = $integrity->$check();
|
||||
eval("\$integritycheck.=\"" . getTemplate("settings/integritycheck_row") . "\";");
|
||||
$checkdesc = $lng['integrity_check'][$check];
|
||||
eval("\$integritycheck.=\"" . \Froxlor\UI\Template::getTemplate("settings/integritycheck_row") . "\";");
|
||||
}
|
||||
eval("echo \"" . getTemplate("settings/integritycheck") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/integritycheck") . "\";");
|
||||
} elseif ($page == 'importexport' && $userinfo['change_serversettings'] == '1') {
|
||||
// check for json-stuff
|
||||
if (! extension_loaded('json')) {
|
||||
\Froxlor\UI\Response::standard_error('jsonextensionnotfound');
|
||||
}
|
||||
|
||||
if (isset($_GET['action']) && $_GET['action'] == "export") {
|
||||
// export
|
||||
try {
|
||||
$json_result = Froxlor::getLocal($userinfo)->exportSettings();
|
||||
$json_export = json_decode($json_result, true)['data'];
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
header('Content-disposition: attachment; filename=Froxlor_settings-' . $version . '-' . $dbversion . '_' . date('d.m.Y') . '.json');
|
||||
header('Content-type: application/json');
|
||||
echo $json_export;
|
||||
exit();
|
||||
} elseif (isset($_GET['action']) && $_GET['action'] == "import") {
|
||||
// import
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// get uploaded file
|
||||
if (isset($_FILES["import_file"]["tmp_name"])) {
|
||||
$imp_content = file_get_contents($_FILES["import_file"]["tmp_name"]);
|
||||
try {
|
||||
Froxlor::getLocal($userinfo, array(
|
||||
'json_str' => $imp_content
|
||||
))->importSettings();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::standard_success('settingsimported', '', array(
|
||||
'filename' => 'admin_settings.php'
|
||||
));
|
||||
}
|
||||
\Froxlor\UI\Response::dynamic_error("Upload failed");
|
||||
}
|
||||
} else {
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/importexport/index") . "\";");
|
||||
}
|
||||
} elseif ($page == 'testmail') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$test_addr = isset($_POST['test_addr']) ? $_POST['test_addr'] : null;
|
||||
|
||||
/**
|
||||
* Initialize the mailingsystem
|
||||
*/
|
||||
$testmail = new \PHPMailer\PHPMailer\PHPMailer(true);
|
||||
$testmail->CharSet = "UTF-8";
|
||||
|
||||
if (Settings::Get('system.mail_use_smtp')) {
|
||||
$testmail->isSMTP();
|
||||
$testmail->Host = Settings::Get('system.mail_smtp_host');
|
||||
$testmail->SMTPAuth = Settings::Get('system.mail_smtp_auth') == '1' ? true : false;
|
||||
$testmail->Username = Settings::Get('system.mail_smtp_user');
|
||||
$testmail->Password = Settings::Get('system.mail_smtp_passwd');
|
||||
if (Settings::Get('system.mail_smtp_usetls')) {
|
||||
$testmail->SMTPSecure = 'tls';
|
||||
} else {
|
||||
$testmail->SMTPAutoTLS = false;
|
||||
}
|
||||
$testmail->Port = Settings::Get('system.mail_smtp_port');
|
||||
}
|
||||
|
||||
$_mailerror = false;
|
||||
if (\PHPMailer\PHPMailer\PHPMailer::ValidateAddress(Settings::Get('panel.adminmail')) !== false) {
|
||||
// set return-to address and custom sender-name, see #76
|
||||
$testmail->SetFrom(Settings::Get('panel.adminmail'), Settings::Get('panel.adminmail_defname'));
|
||||
if (Settings::Get('panel.adminmail_return') != '') {
|
||||
$testmail->AddReplyTo(Settings::Get('panel.adminmail_return'), Settings::Get('panel.adminmail_defname'));
|
||||
}
|
||||
|
||||
try {
|
||||
$testmail->Subject = "Froxlor Test-Mail";
|
||||
$mail_body = "Yay, this worked :)";
|
||||
$testmail->AltBody = $mail_body;
|
||||
$testmail->MsgHTML(str_replace("\n", "<br />", $mail_body));
|
||||
$testmail->AddAddress($test_addr);
|
||||
$testmail->Send();
|
||||
} catch (\PHPMailer\PHPMailer\Exception $e) {
|
||||
$mailerr_msg = $e->errorMessage();
|
||||
$_mailerror = true;
|
||||
} catch (Exception $e) {
|
||||
$mailerr_msg = $e->getMessage();
|
||||
$_mailerror = true;
|
||||
}
|
||||
|
||||
if (! $_mailerror) {
|
||||
// success
|
||||
$mail->ClearAddresses();
|
||||
\Froxlor\UI\Response::standard_success('testmailsent', '', array(
|
||||
'filename' => 'admin_settings.php',
|
||||
'page' => 'testmail'
|
||||
));
|
||||
}
|
||||
} else {
|
||||
// invalid sender e-mail
|
||||
$mailerr_msg = "Invalid sender e-mail address: " . Settings::Get('panel.adminmail');
|
||||
$_mailerror = true;
|
||||
}
|
||||
}
|
||||
|
||||
$mail_smtp_user = Settings::Get('system.mail_smtp_user');
|
||||
$mail_smtp_host = Settings::Get('system.mail_smtp_host');
|
||||
$mail_smtp_port = Settings::Get('system.mail_smtp_port');
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("settings/testmail") . "\";");
|
||||
}
|
||||
|
||||
@@ -16,14 +16,15 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
|
||||
if (isset($_POST['subjectid'])) {
|
||||
$subjectid = intval($_POST['subjectid']);
|
||||
$mailbodyid = intval($_POST['mailbodyid']);
|
||||
|
||||
} elseif (isset($_GET['subjectid'])) {
|
||||
$subjectid = intval($_GET['subjectid']);
|
||||
$mailbodyid = intval($_GET['mailbodyid']);
|
||||
@@ -31,7 +32,6 @@ if (isset($_POST['subjectid'])) {
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
|
||||
} elseif (isset($_GET['id'])) {
|
||||
$id = intval($_GET['id']);
|
||||
}
|
||||
@@ -46,20 +46,7 @@ $available_templates = array(
|
||||
|
||||
// only show templates of features that are enabled #1191
|
||||
if ((int) Settings::Get('system.report_enable') == 1) {
|
||||
array_push($available_templates,
|
||||
'trafficmaxpercent',
|
||||
'diskmaxpercent'
|
||||
);
|
||||
}
|
||||
|
||||
if ((int)Settings::Get('ticket.enabled') == 1) {
|
||||
array_push($available_templates,
|
||||
'new_ticket_by_customer',
|
||||
'new_ticket_for_customer',
|
||||
'new_ticket_by_staff',
|
||||
'new_reply_ticket_by_customer',
|
||||
'new_reply_ticket_by_staff'
|
||||
);
|
||||
array_push($available_templates, 'trafficmaxpercent', 'diskmaxpercent');
|
||||
}
|
||||
|
||||
$file_templates = array(
|
||||
@@ -68,7 +55,7 @@ $file_templates = array(
|
||||
|
||||
if ($action == '') {
|
||||
// email templates
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_templates");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed admin_templates");
|
||||
|
||||
if (Settings::Get('panel.sendalternativemail') == 1) {
|
||||
$available_templates[] = 'pop_success_alternative';
|
||||
@@ -78,9 +65,10 @@ if ($action == '') {
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `id`, `language`, `varname` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `templategroup`='mails'
|
||||
ORDER BY `language`, `varname`"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid']));
|
||||
ORDER BY `language`, `varname`");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid']
|
||||
));
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$parts = array();
|
||||
@@ -94,20 +82,22 @@ if ($action == '') {
|
||||
$subjectid = $email['subject'];
|
||||
$mailbodyid = $email['mailbody'];
|
||||
$template = $lng['admin']['templates'][$action];
|
||||
eval("\$templates.=\"" . getTemplate("templates/templates_template") . "\";");
|
||||
eval("\$templates.=\"" . \Froxlor\UI\Template::getTemplate("templates/templates_template") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
$add = false;
|
||||
while (list($language_file, $language_name) = each($languages)) {
|
||||
foreach ($languages as $language_file => $language_name) {
|
||||
|
||||
$templates_done = array();
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `varname` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `language`= :lang
|
||||
AND `templategroup` = 'mails' AND `varname` LIKE '%_subject'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid'], 'lang' => $language_name));
|
||||
AND `templategroup` = 'mails' AND `varname` LIKE '%_subject'");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'lang' => $language_name
|
||||
));
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$templates_done[] = str_replace('_subject', '', $row['varname']);
|
||||
@@ -123,107 +113,110 @@ if ($action == '') {
|
||||
$filetemplateadd = false;
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `id`, `varname` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `templategroup`='files'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid']));
|
||||
WHERE `adminid` = :adminid AND `templategroup`='files'");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid']
|
||||
));
|
||||
|
||||
if (Database::num_rows() != count($file_templates)) {
|
||||
$filetemplateadd = true;
|
||||
}
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
eval("\$filetemplates.=\"" . getTemplate("templates/templates_filetemplate") . "\";");
|
||||
eval("\$filetemplates.=\"" . \Froxlor\UI\Template::getTemplate("templates/templates_filetemplate") . "\";");
|
||||
}
|
||||
eval("echo \"" . getTemplate("templates/templates") . "\";");
|
||||
|
||||
} elseif($action == 'delete'
|
||||
&& $subjectid != 0
|
||||
&& $mailbodyid != 0
|
||||
) {
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("templates/templates") . "\";");
|
||||
} elseif ($action == 'delete' && $subjectid != 0 && $mailbodyid != 0) {
|
||||
// email templates
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `language`, `varname` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid'], 'id' => $subjectid));
|
||||
WHERE `adminid` = :adminid AND `id` = :id");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'id' => $subjectid
|
||||
));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if ($result['varname'] != '') {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid
|
||||
AND (`id` = :ida OR `id` = :idb)"
|
||||
);
|
||||
AND (`id` = :ida OR `id` = :idb)");
|
||||
Database::pexecute($del_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'ida' => $subjectid,
|
||||
'idb' => $mailbodyid
|
||||
));
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "deleted template '" . $result['language'] . ' - ' . $lng['admin']['templates'][str_replace('_subject', '', $result['varname'])] . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "deleted template '" . $result['language'] . ' - ' . $lng['admin']['templates'][str_replace('_subject', '', $result['varname'])] . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_template_reallydelete', $filename, array('subjectid' => $subjectid, 'mailbodyid' => $mailbodyid, 'page' => $page, 'action' => $action), $result['language'] . ' - ' . $lng['admin']['templates'][str_replace('_subject', '', $result['varname'])]);
|
||||
\Froxlor\UI\HTML::askYesNo('admin_template_reallydelete', $filename, array(
|
||||
'subjectid' => $subjectid,
|
||||
'mailbodyid' => $mailbodyid,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['language'] . ' - ' . $lng['admin']['templates'][str_replace('_subject', '', $result['varname'])]);
|
||||
}
|
||||
}
|
||||
|
||||
} elseif($action == 'deletef'
|
||||
&& $id != 0
|
||||
) {
|
||||
} elseif ($action == 'deletef' && $id != 0) {
|
||||
// file templates
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid'], 'id' => $id));
|
||||
WHERE `adminid` = :adminid AND `id` = :id");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'id' => $id
|
||||
));
|
||||
|
||||
if (Database::num_rows() > 0) {
|
||||
|
||||
$row = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($del_stmt, array('adminid' => $userinfo['adminid'], 'id' => $id));
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "deleted template '" . $lng['admin']['templates'][$row['varname']] . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
WHERE `adminid` = :adminid AND `id` = :id");
|
||||
Database::pexecute($del_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'id' => $id
|
||||
));
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "deleted template '" . $lng['admin']['templates'][$row['varname']] . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('admin_template_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $lng['admin']['templates'][$row['varname']]);
|
||||
\Froxlor\UI\HTML::askYesNo('admin_template_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $lng['admin']['templates'][$row['varname']]);
|
||||
}
|
||||
|
||||
} else {
|
||||
standard_error('templatenotfound');
|
||||
exit;
|
||||
\Froxlor\UI\Response::standard_error('templatenotfound');
|
||||
}
|
||||
|
||||
} elseif ($action == 'add') {
|
||||
|
||||
if (Settings::Get('panel.sendalternativemail') == 1) {
|
||||
$available_templates[] = 'pop_success_alternative';
|
||||
}
|
||||
|
||||
if (isset($_POST['prepare'])
|
||||
&& $_POST['prepare'] == 'prepare'
|
||||
) {
|
||||
if (isset($_POST['prepare']) && $_POST['prepare'] == 'prepare') {
|
||||
// email templates
|
||||
$language = validate($_POST['language'], 'language', '/^[^\r\n\0"\']+$/', 'nolanguageselect');
|
||||
$template = validate($_POST['template'], 'template');
|
||||
$language = htmlentities(\Froxlor\Validate\Validate::validate($_POST['language'], 'language', '/^[^\r\n\0"\']+$/', 'nolanguageselect'));
|
||||
$template = \Froxlor\Validate\Validate::validate($_POST['template'], 'template');
|
||||
|
||||
$lng_bak = $lng;
|
||||
foreach ($langs['English'] as $key => $value) {
|
||||
include_once makeSecurePath($value['file']);
|
||||
include_once \Froxlor\FileDir::makeSecurePath($value['file']);
|
||||
}
|
||||
if ($language != 'English') {
|
||||
foreach ($langs[$language] as $key => $value) {
|
||||
include makeSecurePath($value['file']);
|
||||
include \Froxlor\FileDir::makeSecurePath($value['file']);
|
||||
}
|
||||
}
|
||||
|
||||
@@ -233,28 +226,27 @@ if ($action == '') {
|
||||
$lng = $lng_bak;
|
||||
|
||||
$template_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/templates/formfield.template_add.php';
|
||||
$template_add_form = htmlform::genHTMLForm($template_add_data);
|
||||
$template_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($template_add_data);
|
||||
|
||||
$title = $template_add_data['template_add']['title'];
|
||||
$image = $template_add_data['template_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("templates/templates_add_2") . "\";");
|
||||
|
||||
} elseif(isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("templates/templates_add_2") . "\";");
|
||||
} elseif (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// email templates
|
||||
$language = validate($_POST['language'], 'language', '/^[^\r\n\0"\']+$/', 'nolanguageselect');
|
||||
$template = validate($_POST['template'], 'template');
|
||||
$subject = validate($_POST['subject'], 'subject', '/^[^\r\n\0]+$/', 'nosubjectcreate');
|
||||
$mailbody = validate($_POST['mailbody'], 'mailbody', '/^[^\0]+$/', 'nomailbodycreate');
|
||||
$language = htmlentities(\Froxlor\Validate\Validate::validate($_POST['language'], 'language', '/^[^\r\n\0"\']+$/', 'nolanguageselect'));
|
||||
$template = \Froxlor\Validate\Validate::validate($_POST['template'], 'template');
|
||||
$subject = \Froxlor\Validate\Validate::validate($_POST['subject'], 'subject', '/^[^\r\n\0]+$/', 'nosubjectcreate');
|
||||
$mailbody = \Froxlor\Validate\Validate::validate($_POST['mailbody'], 'mailbody', '/^[^\0]+$/', 'nomailbodycreate');
|
||||
$templates = array();
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `varname` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `language` = :lang
|
||||
AND `templategroup` = 'mails' AND `varname` LIKE '%_subject'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid'], 'lang' => $language));
|
||||
AND `templategroup` = 'mails' AND `varname` LIKE '%_subject'");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'lang' => $language
|
||||
));
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$templates[] = str_replace('_subject', '', $row['varname']);
|
||||
@@ -262,8 +254,7 @@ if ($action == '') {
|
||||
|
||||
$templates = array_diff($available_templates, $templates);
|
||||
if (array_search($template, $templates) === false) {
|
||||
standard_error('templatenotfound');
|
||||
|
||||
\Froxlor\UI\Response::standard_error('templatenotfound');
|
||||
} else {
|
||||
$ins_stmt = Database::prepare("
|
||||
INSERT INTO `" . TABLE_PANEL_TEMPLATES . "` SET
|
||||
@@ -271,8 +262,7 @@ if ($action == '') {
|
||||
`language` = :lang,
|
||||
`templategroup` = 'mails',
|
||||
`varname` = :var,
|
||||
`value` = :value"
|
||||
);
|
||||
`value` = :value");
|
||||
|
||||
// mail-subject
|
||||
$ins_data = array(
|
||||
@@ -292,16 +282,16 @@ if ($action == '') {
|
||||
);
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "added template '" . $language . ' - ' . $template . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "added template '" . $language . ' - ' . $template . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
|
||||
} elseif(isset($_POST['filesend'])
|
||||
&& $_POST['filesend'] == 'filesend'
|
||||
) {
|
||||
} elseif (isset($_POST['filesend']) && $_POST['filesend'] == 'filesend') {
|
||||
// file templates
|
||||
$template = validate($_POST['template'], 'template');
|
||||
$filecontent = validate($_POST['filecontent'], 'filecontent', '/^[^\0]+$/', 'filecontentnotset');
|
||||
$template = \Froxlor\Validate\Validate::validate($_POST['template'], 'template');
|
||||
$filecontent = \Froxlor\Validate\Validate::validate($_POST['filecontent'], 'filecontent', '/^[^\0]+$/', 'filecontentnotset');
|
||||
|
||||
$ins_stmt = Database::prepare("
|
||||
INSERT INTO `" . TABLE_PANEL_TEMPLATES . "` SET
|
||||
@@ -309,8 +299,7 @@ if ($action == '') {
|
||||
`language` = '',
|
||||
`templategroup` = 'files',
|
||||
`varname` = :var,
|
||||
`value` = :value"
|
||||
);
|
||||
`value` = :value");
|
||||
|
||||
$ins_data = array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
@@ -319,9 +308,11 @@ if ($action == '') {
|
||||
);
|
||||
Database::pexecute($ins_stmt, $ins_data);
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "added template '" . $template . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "added template '" . $template . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} elseif (! isset($_GET['files'])) {
|
||||
|
||||
// email templates
|
||||
@@ -329,14 +320,16 @@ if ($action == '') {
|
||||
$language_options = '';
|
||||
$template_options = '';
|
||||
|
||||
while (list($language_file, $language_name) = each($languages)) {
|
||||
foreach ($languages as $language_file => $language_name) {
|
||||
$templates = array();
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `varname` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `language` = :lang
|
||||
AND `templategroup` = 'mails' AND `varname` LIKE '%_subject'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid'], 'lang' => $language_name));
|
||||
AND `templategroup` = 'mails' AND `varname` LIKE '%_subject'");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'lang' => $language_name
|
||||
));
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$templates[] = str_replace('_subject', '', $row['varname']);
|
||||
@@ -344,35 +337,32 @@ if ($action == '') {
|
||||
|
||||
if (count(array_diff($available_templates, $templates)) > 0) {
|
||||
$add = true;
|
||||
$language_options.= makeoption($language_name, $language_file, $userinfo['language'], true, true);
|
||||
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, $userinfo['language'], true, true);
|
||||
|
||||
$templates = array_diff($available_templates, $templates);
|
||||
|
||||
foreach ($templates as $template) {
|
||||
$template_options.= makeoption($lng['admin']['templates'][$template], $template, NULL, true, true, $language_file) . "\n";
|
||||
$template_options .= \Froxlor\UI\HTML::makeoption($lng['admin']['templates'][$template], $template, NULL, true, true, $language_file) . "\n";
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
if ($add) {
|
||||
eval("echo \"" . getTemplate("templates/templates_add_1") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("templates/templates_add_1") . "\";");
|
||||
} else {
|
||||
standard_error('alltemplatesdefined');
|
||||
exit;
|
||||
\Froxlor\UI\Response::standard_error('alltemplatesdefined');
|
||||
}
|
||||
|
||||
} else {
|
||||
// filetemplates
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `id`, `varname` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `templategroup`='files'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid']));
|
||||
WHERE `adminid` = :adminid AND `templategroup`='files'");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid']
|
||||
));
|
||||
|
||||
if (Database::num_rows() == count($file_templates)) {
|
||||
standard_error('alltemplatesdefined');
|
||||
exit;
|
||||
|
||||
\Froxlor\UI\Response::standard_error('alltemplatesdefined');
|
||||
} else {
|
||||
|
||||
$templatesdefined = array();
|
||||
@@ -383,44 +373,39 @@ if ($action == '') {
|
||||
}
|
||||
|
||||
foreach (array_diff($file_templates, $templatesdefined) as $template) {
|
||||
$free_templates.= makeoption($lng['admin']['templates'][$template], $template, '', true);
|
||||
$free_templates .= \Froxlor\UI\HTML::makeoption($lng['admin']['templates'][$template], $template, '', true);
|
||||
}
|
||||
|
||||
$filetemplate_add_data = include_once dirname(__FILE__) . '/lib/formfields/admin/templates/formfield.filetemplate_add.php';
|
||||
$filetemplate_add_form = htmlform::genHTMLForm($filetemplate_add_data);
|
||||
$filetemplate_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($filetemplate_add_data);
|
||||
|
||||
$title = $filetemplate_add_data['filetemplate_add']['title'];
|
||||
$image = $filetemplate_add_data['filetemplate_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("templates/filetemplates_add") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("templates/filetemplates_add") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
} elseif($action == 'edit'
|
||||
&& $subjectid != 0
|
||||
&& $mailbodyid != 0
|
||||
) {
|
||||
} elseif ($action == 'edit' && $subjectid != 0 && $mailbodyid != 0) {
|
||||
// email templates
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `language`, `varname`, `value` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `id` = :subjectid"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid'], 'subjectid' => $subjectid));
|
||||
WHERE `adminid` = :adminid AND `id` = :subjectid");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'subjectid' => $subjectid
|
||||
));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if ($result['varname'] != '') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$subject = validate($_POST['subject'], 'subject', '/^[^\r\n\0]+$/', 'nosubjectcreate');
|
||||
$mailbody = validate($_POST['mailbody'], 'mailbody', '/^[^\0]+$/', 'nomailbodycreate');
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$subject = \Froxlor\Validate\Validate::validate($_POST['subject'], 'subject', '/^[^\r\n\0]+$/', 'nosubjectcreate');
|
||||
$mailbody = \Froxlor\Validate\Validate::validate($_POST['mailbody'], 'mailbody', '/^[^\0]+$/', 'nomailbodycreate');
|
||||
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_TEMPLATES . "` SET
|
||||
`value` = :value
|
||||
WHERE `adminid` = :adminid AND `id` = :id"
|
||||
);
|
||||
WHERE `adminid` = :adminid AND `id` = :id");
|
||||
// subject
|
||||
Database::pexecute($upd_stmt, array(
|
||||
'value' => $subject,
|
||||
@@ -434,84 +419,85 @@ if ($action == '') {
|
||||
'id' => $mailbodyid
|
||||
));
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "edited template '" . $result['varname'] . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "edited template '" . $result['varname'] . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$result = htmlentities_array($result);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
$template = $lng['admin']['templates'][str_replace('_subject', '', $result['varname'])];
|
||||
$subject = $result['value'];
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `language`, `varname`, `value`
|
||||
FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('id' => $mailbodyid));
|
||||
WHERE `id` = :id");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'id' => $mailbodyid
|
||||
));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
$template_name = str_replace('_mailbody', '', $result['varname']);
|
||||
|
||||
$result = htmlentities_array($result);
|
||||
// don't escape the already escaped language-string so save up before htmlentities()
|
||||
$language = $result['language'];
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
$mailbody = $result['value'];
|
||||
|
||||
$template_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/templates/formfield.template_edit.php';
|
||||
$template_edit_form = htmlform::genHTMLForm($template_edit_data);
|
||||
$template_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($template_edit_data);
|
||||
|
||||
$title = $template_edit_data['template_edit']['title'];
|
||||
$image = $template_edit_data['template_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("templates/templates_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("templates/templates_edit") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
} elseif($action == 'editf'
|
||||
&& $id != 0
|
||||
) {
|
||||
} elseif ($action == 'editf' && $id != 0) {
|
||||
// file templates
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT * FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid'], 'id' => $id));
|
||||
WHERE `adminid` = :adminid AND `id` = :id");
|
||||
Database::pexecute($result_stmt, array(
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'id' => $id
|
||||
));
|
||||
|
||||
if (Database::num_rows() > 0) {
|
||||
|
||||
$row = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
// filetemplates
|
||||
if (isset($_POST['filesend'])
|
||||
&& $_POST['filesend'] == 'filesend'
|
||||
) {
|
||||
$filecontent = validate($_POST['filecontent'], 'filecontent', '/^[^\0]+$/', 'filecontentnotset');
|
||||
if (isset($_POST['filesend']) && $_POST['filesend'] == 'filesend') {
|
||||
$filecontent = \Froxlor\Validate\Validate::validate($_POST['filecontent'], 'filecontent', '/^[^\0]+$/', 'filecontentnotset');
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_PANEL_TEMPLATES . "` SET
|
||||
`value` = :value
|
||||
WHERE `adminid` = :adminid AND `id` = :id"
|
||||
);
|
||||
WHERE `adminid` = :adminid AND `id` = :id");
|
||||
Database::pexecute($upd_stmt, array(
|
||||
'value' => $filecontent,
|
||||
'adminid' => $userinfo['adminid'],
|
||||
'id' => $id
|
||||
));
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "edited template '" . $row['varname'] . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_INFO, "edited template '" . $row['varname'] . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$row = htmlentities_array($row);
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
|
||||
$filetemplate_edit_data = include_once dirname(__FILE__) . '/lib/formfields/admin/templates/formfield.filetemplate_edit.php';
|
||||
$filetemplate_edit_form = htmlform::genHTMLForm($filetemplate_edit_data);
|
||||
$filetemplate_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($filetemplate_edit_data);
|
||||
|
||||
$title = $filetemplate_edit_data['filetemplate_edit']['title'];
|
||||
$image = $filetemplate_edit_data['filetemplate_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("templates/filetemplates_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("templates/filetemplates_edit") . "\";");
|
||||
}
|
||||
|
||||
} else {
|
||||
standard_error('templatenotfound');
|
||||
exit;
|
||||
\Froxlor\UI\Response::standard_error('templatenotfound');
|
||||
}
|
||||
}
|
||||
|
||||
@@ -1,909 +0,0 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2003-2009 the SysCP Team (see authors).
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
|
||||
} elseif(isset($_GET['id'])) {
|
||||
|
||||
$id = intval($_GET['id']);
|
||||
|
||||
// only check if this is not a category-id
|
||||
if (!isset($_GET['page']) || (isset($_GET['page']) && $_GET['page'] != 'categories')) {
|
||||
if (!$userinfo['customers_see_all']) {
|
||||
/*
|
||||
* Check if the current user is allowed to see the current ticket.
|
||||
*/
|
||||
$stmt = Database::prepare("
|
||||
SELECT `id` FROM `panel_tickets`
|
||||
WHERE `id` = :id AND `adminid` = :adminid
|
||||
");
|
||||
$result = Database::pexecute_first($stmt, array('id' => $id, 'adminid' => $userinfo['adminid']));
|
||||
|
||||
if ($result == null) {
|
||||
// no rights to see the requested ticket
|
||||
standard_error(array('ticketnotaccessible'));
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
if ($page == 'tickets'
|
||||
&& $userinfo['customers'] != '0'
|
||||
) {
|
||||
// Let's see how many customers we have
|
||||
$countcustomers_stmt = Database::prepare("
|
||||
SELECT COUNT(`customerid`) as `countcustomers`
|
||||
FROM `" . TABLE_PANEL_CUSTOMERS . "` " .
|
||||
($userinfo['customers_see_all'] ? '' : "WHERE `adminid` = :adminid")
|
||||
);
|
||||
$countcustomers = Database::pexecute_first($countcustomers_stmt, array('adminid' => $userinfo['adminid']));
|
||||
$countcustomers = (int)$countcustomers['countcustomers'];
|
||||
|
||||
if ($action == '') {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_tickets");
|
||||
$fields = array(
|
||||
'status' => $lng['ticket']['status'],
|
||||
'lastchange' => $lng['ticket']['lastchange'],
|
||||
'subject' => $lng['ticket']['subject'],
|
||||
'lastreplier' => $lng['ticket']['lastreplier']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_TICKETS, $fields, null, null, 1, 'desc');
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `main`.`id`, `main`.`customerid`, (
|
||||
SELECT COUNT(`sub`.`id`)
|
||||
FROM `" . TABLE_PANEL_TICKETS . "` `sub`
|
||||
WHERE `sub`.`answerto` = `main`.`id`) as `ticket_answers`,
|
||||
`main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority`
|
||||
FROM `" . TABLE_PANEL_TICKETS . "` as `main`
|
||||
WHERE `main`.`answerto` = '0' AND `archived` = '0' " .
|
||||
($userinfo['customers_see_all'] ? '' : " AND `adminid` = :adminid") .
|
||||
$paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid']));
|
||||
$num_rows = Database::num_rows();
|
||||
$paging->setEntries($num_rows);
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$ctickets = array();
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if (!isset($ctickets[$row['customerid']])
|
||||
|| !is_array($ctickets[$row['customerid']])
|
||||
) {
|
||||
$ctickets[$row['customerid']] = array();
|
||||
}
|
||||
$ctickets[$row['customerid']][$row['id']] = $row;
|
||||
}
|
||||
|
||||
if ($paging->sortfield == 'customerid'
|
||||
&& $paging->sortorder == 'desc'
|
||||
) {
|
||||
krsort($ctickets);
|
||||
} else {
|
||||
ksort($ctickets);
|
||||
}
|
||||
|
||||
$i = 0;
|
||||
$count = 0;
|
||||
$tickets_count = 0;
|
||||
$tickets = '';
|
||||
foreach ($ctickets as $cid => $ticketrows) {
|
||||
$_cid = 0;
|
||||
foreach ($ticketrows as $row) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
|
||||
$row = htmlentities_array($row);
|
||||
$row['lastchange'] = date("d.m.y H:i", $row['lastchange']);
|
||||
|
||||
if ($_cid != $row['customerid']) {
|
||||
$cid = $row['customerid'];
|
||||
$usr_stmt = Database::prepare('
|
||||
SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :cid'
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array('cid' => $cid));
|
||||
|
||||
if (isset($usr['loginname'])) {
|
||||
$customer = getCorrectFullUserDetails($usr);
|
||||
$customerloginname = $usr['loginname'];
|
||||
$customerid = $usr['customerid'];
|
||||
} else {
|
||||
$customer = $lng['ticket']['nonexistingcustomer'];
|
||||
}
|
||||
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
|
||||
}
|
||||
|
||||
$tickets_count++;
|
||||
|
||||
if ($row['status'] >= 0
|
||||
&& $row['status'] <= 2
|
||||
) {
|
||||
$reopen = 0;
|
||||
} else {
|
||||
$reopen = 1;
|
||||
}
|
||||
|
||||
$row['status'] = ticket::getStatusText($lng, $row['status']);
|
||||
$row['priority'] = ticket::getPriorityText($lng, $row['priority']);
|
||||
|
||||
if ($row['lastreplier'] == '1') {
|
||||
$row['lastreplier'] = $lng['ticket']['staff'];
|
||||
$cananswer = 0;
|
||||
} else {
|
||||
$row['lastreplier'] = $lng['ticket']['customer'];
|
||||
$cananswer = 1;
|
||||
}
|
||||
|
||||
$row['subject'] = html_entity_decode($row['subject']);
|
||||
if (strlen($row['subject']) > 30) {
|
||||
$ts = wordwrap($row['subject'], 30, "|");
|
||||
$ts = explode("|", $ts);
|
||||
$row['subject'] = $ts[0]. '...';
|
||||
}
|
||||
|
||||
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";");
|
||||
$count++;
|
||||
$_cid = $row['customerid'];
|
||||
}
|
||||
$i++;
|
||||
}
|
||||
}
|
||||
eval("echo \"" . getTemplate("tickets/tickets") . "\";");
|
||||
|
||||
} elseif($action == 'new') {
|
||||
|
||||
if ($userinfo['tickets_used'] < $userinfo['tickets']
|
||||
|| $userinfo['tickets'] == '-1'
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$newticket = ticket::getInstanceOf($userinfo, -1);
|
||||
$newticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
|
||||
$newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
|
||||
$newticket->Set('category', validate($_POST['category'], 'category'), true, false);
|
||||
$newticket->Set('customer', (int)$_POST['customer'], true, false);
|
||||
$newticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false);
|
||||
|
||||
if ($newticket->Get('subject') == null) {
|
||||
standard_error(array('stringisempty', 'mysubject'));
|
||||
} elseif($newticket->Get('message') == null) {
|
||||
standard_error(array('stringisempty', 'mymessage'));
|
||||
} else {
|
||||
$now = time();
|
||||
$newticket->Set('admin', $userinfo['adminid'], true, true);
|
||||
$newticket->Set('dt', $now, true, true);
|
||||
$newticket->Set('lastchange', $now, true, true);
|
||||
$newticket->Set('ip', $_SERVER['REMOTE_ADDR'], true, true);
|
||||
$newticket->Set('status', '0', true, true);
|
||||
$newticket->Set('lastreplier', '1', true, true);
|
||||
$newticket->Set('by', '1', true, true);
|
||||
$newticket->Insert();
|
||||
$newticket->sendMail((int)$newticket->Get('customer'), 'new_ticket_by_staff_subject', $lng['mails']['new_ticket_by_staff']['subject'], 'new_ticket_by_staff_mailbody', $lng['mails']['new_ticket_by_staff']['mailbody']);
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "opened a new ticket for customer #" . $newticket->Get('customer') . " - '" . $newticket->Get('subject') . "'");
|
||||
redirectTo($filename, Array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$categories = '';
|
||||
$where = '';
|
||||
if ($userinfo['tickets_see_all'] != '1') {
|
||||
$where = 'WHERE `adminid` = :adminid';
|
||||
}
|
||||
$result_stmt = Database::prepare('
|
||||
SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
|
||||
'.$where.' ORDER BY `logicalorder`, `name` ASC'
|
||||
);
|
||||
$result = Database::pexecute_first($result_stmt, array('adminid' => $userinfo['adminid']));
|
||||
|
||||
if (isset($result['name'])
|
||||
&& $result['name'] != ''
|
||||
) {
|
||||
$result2_stmt = Database::prepare('
|
||||
SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
|
||||
'.$where.' ORDER BY `logicalorder`, `name` ASC'
|
||||
);
|
||||
Database::pexecute($result2_stmt, array('adminid' => $userinfo['adminid']));
|
||||
|
||||
while ($row = $result2_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$categories.= makeoption($row['name'], $row['id']);
|
||||
}
|
||||
|
||||
} else {
|
||||
$categories = makeoption($lng['ticket']['no_cat'], '0');
|
||||
}
|
||||
|
||||
$customers = '';
|
||||
$result_customers_stmt = Database::prepare("
|
||||
SELECT `customerid`, `loginname`, `name`, `firstname`, `company`
|
||||
FROM `" . TABLE_PANEL_CUSTOMERS . "` " .
|
||||
($userinfo['customers_see_all'] ? '' : " WHERE `adminid` = :adminid")."
|
||||
ORDER BY `name` ASC"
|
||||
);
|
||||
Database::pexecute($result_customers_stmt, array('adminid' => $userinfo['adminid']));
|
||||
|
||||
while ($row_customer = $result_customers_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
|
||||
}
|
||||
|
||||
$def_prio = Settings::Get('ticket.default_priority');
|
||||
$priorities = makeoption($lng['ticket']['high'], '1', $def_prio);
|
||||
$priorities.= makeoption($lng['ticket']['normal'], '2', $def_prio);
|
||||
$priorities.= makeoption($lng['ticket']['low'], '3', $def_prio);
|
||||
|
||||
$ticket_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_new.php';
|
||||
$ticket_new_form = htmlform::genHTMLForm($ticket_new_data);
|
||||
|
||||
$title = $ticket_new_data['ticket_new']['title'];
|
||||
$image = $ticket_new_data['ticket_new']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
|
||||
}
|
||||
|
||||
} else {
|
||||
standard_error('nomoreticketsavailable');
|
||||
}
|
||||
|
||||
} elseif($action == 'answer'
|
||||
&& $id != 0
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$replyticket = ticket::getInstanceOf($userinfo, -1);
|
||||
$replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
|
||||
$replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
|
||||
$replyticket->Set('message', validate(htmlentities(str_replace("\r\n", "\n", $_POST['message'])), 'message', '/^[^\0]*$/'), true, false);
|
||||
|
||||
if ($replyticket->Get('message') == null) {
|
||||
standard_error(array('stringisempty', 'mymessage'));
|
||||
} else {
|
||||
$now = time();
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$replyticket->Set('customer', $mainticket->Get('customer'), true, true);
|
||||
$replyticket->Set('lastchange', $now, true, true);
|
||||
$replyticket->Set('ip', $_SERVER['REMOTE_ADDR'], true, true);
|
||||
$replyticket->Set('status', '1', true, true);
|
||||
$replyticket->Set('answerto', (int)$id, true, false);
|
||||
$replyticket->Set('by', '1', true, true);
|
||||
$replyticket->Insert();
|
||||
|
||||
// Update priority if changed
|
||||
if ($replyticket->Get('priority') != $mainticket->Get('priority')) {
|
||||
$mainticket->Set('priority', $replyticket->Get('priority'), true);
|
||||
}
|
||||
|
||||
$mainticket->Set('lastchange', $now);
|
||||
$mainticket->Set('lastreplier', '1');
|
||||
$mainticket->Set('status', '2');
|
||||
$mainticket->Update();
|
||||
$mainticket->sendMail((int)$mainticket->Get('customer'), 'new_reply_ticket_by_staff_subject', $lng['mails']['new_reply_ticket_by_staff']['subject'], 'new_reply_ticket_by_staff_mailbody', $lng['mails']['new_reply_ticket_by_staff']['mailbody']);
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "answered ticket '" . $mainticket->Get('subject') . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
|
||||
} else {
|
||||
|
||||
$ticket_replies = '';
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$dt = date("d.m.Y H:i\h", $mainticket->Get('dt'));
|
||||
$status = ticket::getStatusText($lng, $mainticket->Get('status'));
|
||||
|
||||
if ($mainticket->Get('status') >= 0
|
||||
&& $mainticket->Get('status') <= 2
|
||||
) {
|
||||
$isclosed = 0;
|
||||
} else {
|
||||
$isclosed = 1;
|
||||
}
|
||||
|
||||
if ($mainticket->Get('by') == '1') {
|
||||
$by = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$cid = $mainticket->Get('customer');
|
||||
$usr_stmt = Database::prepare('
|
||||
SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :cid'
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array('cid' => $cid));
|
||||
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
|
||||
$by .= getCorrectFullUserDetails($usr).'</a>';
|
||||
}
|
||||
|
||||
$subject = $mainticket->Get('subject');
|
||||
$message = $mainticket->Get('message');
|
||||
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
|
||||
|
||||
$result_stmt = Database::prepare('
|
||||
SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = :cid'
|
||||
);
|
||||
$row = Database::pexecute_first($result_stmt, array('cid' => $mainticket->Get('category')));
|
||||
|
||||
$andere_stmt = Database::prepare('
|
||||
SELECT * FROM `' . TABLE_PANEL_TICKETS . '`
|
||||
WHERE `answerto` = :id ORDER BY `lastchange` ASC'
|
||||
);
|
||||
Database::pexecute($andere_stmt, array('id' => $id));
|
||||
$numrows_andere = Database::num_rows();
|
||||
|
||||
while ($row2 = $andere_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$subticket = ticket::getInstanceOf($userinfo, (int)$row2['id']);
|
||||
$lastchange = date("d.m.Y H:i\h", $subticket->Get('lastchange'));
|
||||
|
||||
if ($subticket->Get('by') == '1') {
|
||||
$by = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$cid = $subticket->Get('customer');
|
||||
$usr_stmt = Database::prepare('
|
||||
SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :cid'
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array('cid' => $cid));
|
||||
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $cid)).'" rel="external">';
|
||||
$by .= getCorrectFullUserDetails($usr).'</a>';
|
||||
}
|
||||
|
||||
$subject = $subticket->Get('subject');
|
||||
$message = $subticket->Get('message');
|
||||
|
||||
$row2 = htmlentities_array($row2);
|
||||
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
|
||||
}
|
||||
|
||||
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
|
||||
$priorities.= makeoption($lng['ticket']['normal'], '2', $mainticket->Get('priority'), true, true);
|
||||
$priorities.= makeoption($lng['ticket']['low'], '3', $mainticket->Get('priority'), true, true);
|
||||
$subject = htmlentities($mainticket->Get('subject'));
|
||||
$ticket_replies_count = $numrows_andere + 1;
|
||||
|
||||
// don't forget the main-ticket!
|
||||
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.ticket_reply.php';
|
||||
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
|
||||
|
||||
$title = $ticket_reply_data['ticket_reply']['title'];
|
||||
$image = $ticket_reply_data['ticket_reply']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
|
||||
}
|
||||
|
||||
} elseif($action == 'close'
|
||||
&& $id != 0
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$now = time();
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$mainticket->Set('lastchange', $now, true, true);
|
||||
$mainticket->Set('lastreplier', '1', true, true);
|
||||
$mainticket->Set('status', '3', true, true);
|
||||
$mainticket->Update();
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "closed ticket '" . $mainticket->Get('subject') . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
} else {
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
ask_yesno('ticket_reallyclose', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
|
||||
}
|
||||
|
||||
} elseif($action == 'reopen'
|
||||
&& $id != 0
|
||||
) {
|
||||
$now = time();
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$mainticket->Set('lastchange', $now, true, true);
|
||||
$mainticket->Set('lastreplier', '1', true, true);
|
||||
$mainticket->Set('status', '0', true, true);
|
||||
$mainticket->Update();
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "reopened ticket '" . $mainticket->Get('subject') . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
} elseif($action == 'archive'
|
||||
&& $id != 0
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$now = time();
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$mainticket->Set('lastchange', $now, true, true);
|
||||
$mainticket->Set('lastreplier', '1', true, true);
|
||||
$mainticket->Set('status', '3', true, true);
|
||||
$mainticket->Update();
|
||||
$mainticket->Archive();
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "archived ticket '" . $mainticket->Get('subject') . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
} else {
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
ask_yesno('ticket_reallyarchive', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
|
||||
}
|
||||
|
||||
} elseif($action == 'delete'
|
||||
&& $id != 0
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "deleted ticket '" . $mainticket->Get('subject') . "'");
|
||||
$mainticket->Delete();
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
} else {
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
|
||||
}
|
||||
}
|
||||
|
||||
} elseif($page == 'categories'
|
||||
&& $userinfo['customers'] != '0'
|
||||
) {
|
||||
if ($action == '') {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_tickets::categories");
|
||||
$fields = array(
|
||||
'name' => $lng['ticket']['category'],
|
||||
'logicalorder' => $lng['ticket']['logicalorder']
|
||||
);
|
||||
|
||||
$where = '1'; // WHERE 1 is like no 'where-clause'
|
||||
if ($userinfo['tickets_see_all'] != '1') {
|
||||
$where = " `main`.`adminid` = :adminid";
|
||||
}
|
||||
$paging = new paging($userinfo, TABLE_PANEL_TICKET_CATS, $fields);
|
||||
$result_stmt = Database::prepare("
|
||||
SELECT `main`.`id`, `main`.`name`, `main`.`logicalorder`, (
|
||||
SELECT COUNT(`sub`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub`
|
||||
WHERE `sub`.`category` = `main`.`id`
|
||||
AND `sub`.`answerto` = '0'
|
||||
AND `sub`.`adminid` = :adminid
|
||||
) as `ticketcount`, (
|
||||
SELECT COUNT(`sub2`.`id`) FROM `" . TABLE_PANEL_TICKETS . "` `sub2`
|
||||
WHERE `sub2`.`category` = `main`.`id`
|
||||
AND `sub2`.`answerto` = '0'
|
||||
AND (`sub2`.`status` = '0' OR `sub2`.`status` = '1' OR `sub2`.`status` = '2')
|
||||
AND `sub2`.`adminid` = :adminid
|
||||
) as `ticketcountnotclosed`
|
||||
FROM `" . TABLE_PANEL_TICKET_CATS . "` `main`
|
||||
WHERE " . $where . $paging->getSqlWhere(true) . " " .
|
||||
$paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($result_stmt, array('adminid' => $userinfo['adminid']));
|
||||
$numrows = Database::num_rows();
|
||||
$paging->setEntries($numrows);
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$i = 0;
|
||||
$count = 0;
|
||||
$ticketcategories = '';
|
||||
$categories_count = $numrows;
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$row = htmlentities_array($row);
|
||||
$closedtickets_count = ($row['ticketcount'] - $row['ticketcountnotclosed']);
|
||||
eval("\$ticketcategories.=\"" . getTemplate("tickets/tickets_categories") . "\";");
|
||||
$count++;
|
||||
}
|
||||
$i++;
|
||||
}
|
||||
eval("echo \"" . getTemplate("tickets/categories") . "\";");
|
||||
|
||||
} elseif($action == 'addcategory') {
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$category = validate($_POST['category'], 'category');
|
||||
$order = validate($_POST['logicalorder'], 'logicalorder');
|
||||
|
||||
if ($order < 1 || $order >= 1000) {
|
||||
// use the latest available
|
||||
$order = ticket::getHighestOrderNumber($userinfo['adminid']) + 1;
|
||||
}
|
||||
|
||||
if ($category == '') {
|
||||
standard_error(array('stringisempty', 'mycategory'));
|
||||
} else {
|
||||
ticket::addCategory($category, $userinfo['adminid'], $order);
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "added ticket-category '" . $category . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$order = ticket::getHighestOrderNumber($userinfo['adminid']) + 1;
|
||||
|
||||
$category_new_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_new.php';
|
||||
$category_new_form = htmlform::genHTMLForm($category_new_data);
|
||||
|
||||
$title = $category_new_data['category_new']['title'];
|
||||
$image = $category_new_data['category_new']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("tickets/tickets_newcategory") . "\";");
|
||||
}
|
||||
|
||||
} elseif($action == 'editcategory'
|
||||
&& $id != 0
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
|
||||
$category = validate($_POST['category'], 'category');
|
||||
$order = validate($_POST['logicalorder'], 'logicalorder');
|
||||
|
||||
if ($order < 1 || $order >= 1000) {
|
||||
$order = 1;
|
||||
}
|
||||
|
||||
if ($category == '') {
|
||||
standard_error(array('stringisempty', 'mycategory'));
|
||||
} else {
|
||||
ticket::editCategory($category, $id, $order);
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "edited ticket-category '" . $category . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$row_stmt = Database::prepare('
|
||||
SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = :id'
|
||||
);
|
||||
$row = Database::pexecute_first($row_stmt, array('id' => $id));
|
||||
$row = htmlentities_array($row);
|
||||
$category_edit_data = include_once dirname(__FILE__).'/lib/formfields/admin/tickets/formfield.category_edit.php';
|
||||
$category_edit_form = htmlform::genHTMLForm($category_edit_data);
|
||||
|
||||
$title = $category_edit_data['category_edit']['title'];
|
||||
$image = $category_edit_data['category_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("tickets/tickets_editcategory") . "\";");
|
||||
}
|
||||
|
||||
} elseif($action == 'deletecategory'
|
||||
&& $id != 0
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if (ticket::deleteCategory($id) == false) {
|
||||
standard_error('categoryhastickets');
|
||||
}
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "deleted ticket-category #" . $id);
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
|
||||
} else {
|
||||
$name = ticket::getCategoryName($id);
|
||||
ask_yesno('ticket_reallydeletecat', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $name);
|
||||
}
|
||||
}
|
||||
|
||||
} elseif($page == 'archive'
|
||||
&& $userinfo['customers'] != '0'
|
||||
) {
|
||||
if ($action == '') {
|
||||
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_tickets::archive");
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$priority = array();
|
||||
$categories = array();
|
||||
$subject = validate($_POST['subject'], 'subject');
|
||||
$priority[0] = isset($_POST['priority1']) ? $_POST['priority1'] : '';
|
||||
$priority[1] = isset($_POST['priority2']) ? $_POST['priority2'] : '';
|
||||
$priority[2] = isset($_POST['priority3']) ? $_POST['priority3'] : '';
|
||||
$fromdate = validate($_POST['fromdate'], 'fromdate');
|
||||
$todate = validate($_POST['todate'], 'todate');
|
||||
$message = validate($_POST['message'], 'message');
|
||||
$customer = validate($_POST['customer'], 'customer');
|
||||
|
||||
$cat_stmt = Database::query('SELECT COUNT(`id`) as `ccount` FROM `' . TABLE_PANEL_TICKET_CATS . '`');
|
||||
$cat = $cat_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
for ($x = 0;$x < $cat['ccount'];$x++) {
|
||||
$categories[$x] = isset($_POST['category' . $x]) ? $_POST['category' . $x] : '';
|
||||
}
|
||||
|
||||
$archive_search = ticket::getArchiveSearchStatement($subject, $priority, $fromdate, $todate, $message, $customer, $userinfo['adminid'], $categories);
|
||||
|
||||
$query = $archive_search[0];
|
||||
$archive_params = $archive_search[1];
|
||||
|
||||
$fields = array(
|
||||
'lastchange' => $lng['ticket']['lastchange'],
|
||||
'subject' => $lng['ticket']['subject'],
|
||||
'lastreplier' => $lng['ticket']['lastreplier']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_TICKETS, $fields);
|
||||
$result_stmt = Database::prepare($query . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt, $archive_params);
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$ctickets = array();
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if (!isset($ctickets[$row['customerid']])
|
||||
|| !is_array($ctickets[$row['customerid']])
|
||||
) {
|
||||
$ctickets[$row['customerid']] = array();
|
||||
}
|
||||
$ctickets[$row['customerid']][$row['id']] = $row;
|
||||
}
|
||||
|
||||
if ($paging->sortfield == 'customerid'
|
||||
&& $paging->sortorder == 'desc'
|
||||
) {
|
||||
krsort($ctickets);
|
||||
} else {
|
||||
ksort($ctickets);
|
||||
}
|
||||
|
||||
$i = 0;
|
||||
$count = 0;
|
||||
$tickets_count = 0;
|
||||
$tickets = '';
|
||||
foreach ($ctickets as $cid => $ticketrows) {
|
||||
if ($paging->sortfield == 'lastchange'
|
||||
&& $paging->sortorder == 'desc'
|
||||
) {
|
||||
krsort($ticketrows);
|
||||
} else {
|
||||
ksort($ticketrows);
|
||||
}
|
||||
|
||||
$_cid = -1;
|
||||
foreach ($ticketrows as $ticket) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']);
|
||||
if ($_cid != $ticket['customerid']) {
|
||||
$cid = $ticket['customerid'];
|
||||
$usr_stmt = Database::prepare('
|
||||
SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :cid'
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array('cid' => $cid));
|
||||
|
||||
if (isset($usr['loginname'])) {
|
||||
$customer = getCorrectFullUserDetails($usr);
|
||||
$customerloginname = $usr['loginname'];
|
||||
$customerid = $usr['customerid'];
|
||||
} else {
|
||||
$customer = $lng['ticket']['nonexistingcustomer'];
|
||||
$customerid = 0;
|
||||
$customerloginname = '';
|
||||
}
|
||||
eval("\$tickets.=\"" . getTemplate("tickets/tickets_customer") . "\";");
|
||||
}
|
||||
|
||||
$tickets_count++;
|
||||
switch ($ticket['priority'])
|
||||
{
|
||||
case 1: $ticket['display'] = 'high';
|
||||
break;
|
||||
case 2: $ticket['display'] = 'normal';
|
||||
break;
|
||||
case 3: $ticket['display'] = 'low';
|
||||
break;
|
||||
default: $ticket['display'] = 'unknown';
|
||||
}
|
||||
$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);
|
||||
|
||||
if ($ticket['lastreplier'] == '1') {
|
||||
$ticket['lastreplier'] = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$ticket['lastreplier'] = $lng['ticket']['customer'];
|
||||
}
|
||||
|
||||
if (strlen($ticket['subject']) > 20) {
|
||||
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
|
||||
}
|
||||
$ticket = htmlentities_array($ticket);
|
||||
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";");
|
||||
$count++;
|
||||
$_cid = $ticket['customerid'];
|
||||
}
|
||||
}
|
||||
$i++;
|
||||
}
|
||||
eval("echo \"" . getTemplate("tickets/archivesearch") . "\";");
|
||||
|
||||
} else {
|
||||
|
||||
$archived = array();
|
||||
$archived = ticket::getLastArchived(6, $userinfo['adminid']);
|
||||
$tickets = '';
|
||||
|
||||
if ($archived !== false) {
|
||||
|
||||
foreach ($archived as $id => $ticket) {
|
||||
|
||||
$ticket['lastchange'] = date("d.m.y H:i", $ticket['lastchange']);
|
||||
$ticket['priority'] = ticket::getPriorityText($lng, $ticket['priority']);
|
||||
|
||||
if ($ticket['lastreplier'] == '1') {
|
||||
$ticket['lastreplier'] = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$ticket['lastreplier'] = $lng['ticket']['customer'];
|
||||
}
|
||||
|
||||
if (strlen($ticket['subject']) > 20) {
|
||||
$ticket['subject'] = substr($ticket['subject'], 0, 17) . '...';
|
||||
}
|
||||
eval("\$tickets.=\"" . getTemplate("tickets/archived_tickets") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
$priorities_options = makecheckbox('priority1', $lng['ticket']['high'], '1');
|
||||
$priorities_options.= makecheckbox('priority2', $lng['ticket']['normal'], '2');
|
||||
$priorities_options.= makecheckbox('priority3', $lng['ticket']['low'], '3');
|
||||
$category_options = '';
|
||||
$ccount = 0;
|
||||
$result = Database::query('SELECT * FROM `' . TABLE_PANEL_TICKET_CATS . '` ORDER BY `name` ASC');
|
||||
|
||||
while ($row = $result->fetch(PDO::FETCH_ASSOC)) {
|
||||
$category_options.= makecheckbox('category' . $ccount, $row['name'], $row['id'], true);
|
||||
$ccount++;
|
||||
}
|
||||
|
||||
$customers = makeoption($lng['ticket']['nocustomer'], '-1', '-1');
|
||||
$result_customers_stmt = Database::prepare("
|
||||
SELECT `customerid`, `loginname`, `name`, `firstname`, `company`
|
||||
FROM `" . TABLE_PANEL_CUSTOMERS . "` " .
|
||||
($userinfo['customers_see_all'] ? '' : " WHERE `adminid` = :adminid")."
|
||||
ORDER BY `name` ASC"
|
||||
);
|
||||
Database::pexecute($result_customers_stmt, array('adminid' => $userinfo['adminid']));
|
||||
|
||||
while ($row_customer = $result_customers_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$customers.= makeoption(getCorrectFullUserDetails($row_customer) . ' (' . $row_customer['loginname'] . ')', $row_customer['customerid']);
|
||||
}
|
||||
eval("echo \"" . getTemplate("tickets/archive") . "\";");
|
||||
}
|
||||
|
||||
} elseif($action == 'view'
|
||||
&& $id != 0
|
||||
) {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed archived-ticket #" . $id);
|
||||
$ticket_replies = '';
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$lastchange = date("d.m.Y H:i\h", $mainticket->Get('lastchange'));
|
||||
$dt = date("d.m.Y H:i\h", $mainticket->Get('dt'));
|
||||
$status = ticket::getStatusText($lng, $mainticket->Get('status'));
|
||||
$isclosed = 1;
|
||||
|
||||
if ($mainticket->Get('by') == '1') {
|
||||
$by = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$cid = $mainticket->Get('customer');
|
||||
$usr_stmt = Database::prepare('
|
||||
SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :cid'
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array('cid' => $cid));
|
||||
|
||||
if (isset($usr['loginname'])) {
|
||||
$customer = getCorrectFullUserDetails($usr);
|
||||
$customerloginname = ' ('.$usr['loginname'].')';
|
||||
$customerid = $usr['customerid'];
|
||||
} else {
|
||||
$customer = $lng['ticket']['nonexistingcustomer'];
|
||||
$customerid = 0;
|
||||
$customerloginname = '';
|
||||
}
|
||||
if ($customerid != 0) {
|
||||
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $customerid)).'" rel="external">';
|
||||
$by .= $customer.$customerloginname.'</a>';
|
||||
} else {
|
||||
$by = $customer;
|
||||
}
|
||||
}
|
||||
|
||||
$subject = $mainticket->Get('subject');
|
||||
$message = $mainticket->Get('message');
|
||||
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
|
||||
|
||||
$result_stmt = Database::prepare('
|
||||
SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '` WHERE `id` = :cid'
|
||||
);
|
||||
$row = Database::pexecute_first($result_stmt, array('cid' => $mainticket->Get('category')));
|
||||
|
||||
$andere_stmt = Database::prepare('
|
||||
SELECT * FROM `' . TABLE_PANEL_TICKETS . '` WHERE `answerto` = :id'
|
||||
);
|
||||
Database::pexecute($andere_stmt, array('id' => $id));
|
||||
$numrows_andere = Database::num_rows();
|
||||
|
||||
while ($row2 = $andere_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$subticket = ticket::getInstanceOf($userinfo, (int)$row2['id']);
|
||||
$lastchange = date("d.m.Y H:i\h", $subticket->Get('lastchange'));
|
||||
|
||||
if ($subticket->Get('by') == '1') {
|
||||
$by = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$cid = $subticket->Get('customer');
|
||||
$usr_stmt = Database::prepare('
|
||||
SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :cid'
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array('cid' => $cid));
|
||||
|
||||
if (isset($usr['loginname'])) {
|
||||
$customer = getCorrectFullUserDetails($usr);
|
||||
$customerloginname = ' ('.$usr['loginname'].')';
|
||||
$customerid = $usr['customerid'];
|
||||
} else {
|
||||
$customer = $lng['ticket']['nonexistingcustomer'];
|
||||
$customerid = 0;
|
||||
$customerloginname = '';
|
||||
}
|
||||
if ($customerid != 0) {
|
||||
$by = '<a href="'.$linker->getLink(array('section' => 'customers', 'page' => 'customers', 'action' => 'su', 'id' => $customerid)).'" rel="external">';
|
||||
$by .= $customer.$customerloginname.'</a>';
|
||||
} else {
|
||||
$by = $customer;
|
||||
}
|
||||
}
|
||||
|
||||
$subject = $subticket->Get('subject');
|
||||
$message = $subticket->Get('message');
|
||||
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
|
||||
}
|
||||
|
||||
$priorities = makeoption($lng['ticket']['high'], '1', htmlentities($mainticket->Get('priority')), true, true);
|
||||
$priorities.= makeoption($lng['ticket']['normal'], '2', htmlentities($mainticket->Get('priority')), true, true);
|
||||
$priorities.= makeoption($lng['ticket']['low'], '3', htmlentities($mainticket->Get('priority')), true, true);
|
||||
$subject = $mainticket->Get('subject');
|
||||
$ticket_replies_count = $numrows_andere + 1;
|
||||
|
||||
// don't forget the main-ticket!
|
||||
eval("echo \"" . getTemplate("tickets/tickets_view") . "\";");
|
||||
|
||||
} elseif($action == 'delete'
|
||||
&& $id != 0
|
||||
) {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$log->logAction(ADM_ACTION, LOG_INFO, "deleted archived ticket '" . $mainticket->Get('subject') . "'");
|
||||
$mainticket->Delete();
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
} else {
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
ask_yesno('ticket_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
|
||||
}
|
||||
}
|
||||
} else {
|
||||
standard_error('nocustomerforticket');
|
||||
}
|
||||
@@ -15,20 +15,11 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
if ($action == 'logout') {
|
||||
$logout_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_SESSIONS . "`
|
||||
WHERE `userid` = :adminid
|
||||
AND `adminsession` = '1'"
|
||||
);
|
||||
Database::pexecute($logout_stmt, array('adminid' => $userinfo['adminid']));
|
||||
redirectTo('index.php');
|
||||
exit;
|
||||
}
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
@@ -49,7 +40,7 @@ $months = array(
|
||||
'9' => 'sep',
|
||||
'10' => 'oct',
|
||||
'11' => 'nov',
|
||||
'12' => 'dec',
|
||||
'12' => 'dec'
|
||||
);
|
||||
|
||||
if ($page == 'overview' || $page == 'customers') {
|
||||
@@ -82,17 +73,17 @@ if ($page == 'overview' || $page == 'customers') {
|
||||
'sep' => 0,
|
||||
'oct' => 0,
|
||||
'nov' => 0,
|
||||
'dec' => 0,
|
||||
'dec' => 0
|
||||
);
|
||||
|
||||
$customer_name_list_stmt = Database::prepare("
|
||||
SELECT `customerid`,`company`,`name`,`firstname`
|
||||
FROM `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
WHERE `deactivated`='0'" .
|
||||
($userinfo['customers_see_all'] ? '' : " AND `adminid` = :id") . "
|
||||
ORDER BY name"
|
||||
);
|
||||
Database::pexecute($customer_name_list_stmt, array('id' => $userinfo['adminid']));
|
||||
WHERE `deactivated`='0'" . ($userinfo['customers_see_all'] ? '' : " AND `adminid` = :id") . "
|
||||
ORDER BY name");
|
||||
Database::pexecute($customer_name_list_stmt, array(
|
||||
'id' => $userinfo['adminid']
|
||||
));
|
||||
|
||||
while ($customer_name = $customer_name_list_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
|
||||
@@ -110,33 +101,35 @@ if ($page == 'overview' || $page == 'customers') {
|
||||
'sep' => '-',
|
||||
'oct' => '-',
|
||||
'nov' => '-',
|
||||
'dec' => '-',
|
||||
'dec' => '-'
|
||||
);
|
||||
|
||||
$traffic_list_stmt = Database::prepare("
|
||||
SELECT month, SUM(http+ftp_up+ftp_down+mail)*1024 AS traffic
|
||||
FROM `" . TABLE_PANEL_TRAFFIC . "`
|
||||
WHERE year = :year AND `customerid` = :id
|
||||
GROUP BY month ORDER BY month"
|
||||
);
|
||||
Database::pexecute($traffic_list_stmt, array('year' => (date("Y")-$years), 'id' => $customer_name['customerid']));
|
||||
GROUP BY month ORDER BY month");
|
||||
Database::pexecute($traffic_list_stmt, array(
|
||||
'year' => (date("Y") - $years),
|
||||
'id' => $customer_name['customerid']
|
||||
));
|
||||
|
||||
while ($traffic_month = $traffic_list_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$virtual_host[$months[(int)$traffic_month['month']]] = size_readable($traffic_month['traffic'], 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s');
|
||||
$virtual_host[$months[(int) $traffic_month['month']]] = \Froxlor\PhpHelper::sizeReadable($traffic_month['traffic'], 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
$totals[$months[(int) $traffic_month['month']]] += $traffic_month['traffic'];
|
||||
}
|
||||
eval("\$domain_list .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
|
||||
eval("\$domain_list .= sprintf(\"%s\", \"" . \Froxlor\UI\Template::getTemplate("traffic/index_table_row") . "\");");
|
||||
}
|
||||
// sum up totals
|
||||
$virtual_host = array(
|
||||
'name' => $lng['traffic']['months']['total'],
|
||||
'name' => $lng['traffic']['months']['total']
|
||||
);
|
||||
foreach ($totals as $month => $bytes) {
|
||||
$virtual_host[$month] = ($bytes == 0 ? '-' : size_readable($bytes, 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s'));
|
||||
$virtual_host[$month] = ($bytes == 0 ? '-' : \Froxlor\PhpHelper::sizeReadable($bytes, 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s'));
|
||||
}
|
||||
$customerview = 0;
|
||||
eval("\$total_list = sprintf(\"%s\", \"" . getTemplate("traffic/index_table_row") . "\");");
|
||||
eval("\$stats_tables .= sprintf(\"%s\", \"" . getTemplate("traffic/index_table") . "\");");
|
||||
eval("\$total_list = sprintf(\"%s\", \"" . \Froxlor\UI\Template::getTemplate("traffic/index_table_row") . "\");");
|
||||
eval("\$stats_tables .= sprintf(\"%s\", \"" . \Froxlor\UI\Template::getTemplate("traffic/index_table") . "\");");
|
||||
}
|
||||
eval("echo \"" . getTemplate("traffic/index") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("traffic/index") . "\";");
|
||||
}
|
||||
|
||||
@@ -14,27 +14,25 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'admin');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(ADM_ACTION, LOG_NOTICE, "viewed admin_updates");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_NOTICE, "viewed admin_updates");
|
||||
|
||||
/**
|
||||
* this is a dirty hack but syscp 1.4.2.1 does not
|
||||
* have any version/dbversion in the database (don't know why)
|
||||
* so we have to set them both to run a correct upgrade
|
||||
*/
|
||||
if (!isFroxlor()) {
|
||||
if (Settings::Get('panel.version') == null
|
||||
|| Settings::Get('panel.version') == ''
|
||||
) {
|
||||
if (! \Froxlor\Froxlor::isFroxlor()) {
|
||||
if (Settings::Get('panel.version') == null || Settings::Get('panel.version') == '') {
|
||||
Settings::Set('panel.version', '1.4.2.1');
|
||||
}
|
||||
if (Settings::Get('system.dbversion') == null
|
||||
|| Settings::Get('system.dbversion') == ''
|
||||
) {
|
||||
if (Settings::Get('system.dbversion') == null || Settings::Get('system.dbversion') == '') {
|
||||
/**
|
||||
* for syscp-stable (1.4.2.1) this value has to be 0
|
||||
* so the required table-fields are added correctly
|
||||
@@ -42,8 +40,7 @@ if ($page == 'overview') {
|
||||
* -> bug #54
|
||||
*/
|
||||
$result_stmt = Database::query("
|
||||
SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'"
|
||||
);
|
||||
SELECT `value` FROM `" . TABLE_PANEL_SETTINGS . "` WHERE `varname` = 'dbversion'");
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if (isset($result['value'])) {
|
||||
@@ -54,28 +51,22 @@ if ($page == 'overview') {
|
||||
}
|
||||
}
|
||||
|
||||
if (hasUpdates($version)) {
|
||||
if (\Froxlor\Froxlor::hasDbUpdates() || \Froxlor\Froxlor::hasUpdates()) {
|
||||
$successful_update = false;
|
||||
$message = '';
|
||||
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if ((isset($_POST['update_preconfig'])
|
||||
&& isset($_POST['update_changesagreed'])
|
||||
&& intval($_POST['update_changesagreed']) != 0)
|
||||
|| !isset($_POST['update_preconfig'])
|
||||
) {
|
||||
eval("echo \"" . getTemplate('update/update_start') . "\";");
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
if ((isset($_POST['update_preconfig']) && isset($_POST['update_changesagreed']) && intval($_POST['update_changesagreed']) != 0) || ! isset($_POST['update_preconfig'])) {
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('update/update_start') . "\";");
|
||||
|
||||
include_once './install/updatesql.php';
|
||||
include_once \Froxlor\Froxlor::getInstallDir() . 'install/updatesql.php';
|
||||
|
||||
$redirect_url = 'admin_index.php?s=' . $s;
|
||||
eval("echo \"" . getTemplate('update/update_end') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('update/update_end') . "\";");
|
||||
|
||||
updateCounters();
|
||||
inserttask('1');
|
||||
@chmod('./lib/userdata.inc.php', 0440);
|
||||
\Froxlor\User::updateCounters();
|
||||
\Froxlor\System\Cronjob::inserttask('1');
|
||||
@chmod(\Froxlor\Froxlor::getInstallDir() . '/lib/userdata.inc.php', 0440);
|
||||
|
||||
$successful_update = true;
|
||||
} else {
|
||||
@@ -85,26 +76,37 @@ if ($page == 'overview') {
|
||||
|
||||
if (! $successful_update) {
|
||||
$current_version = Settings::Get('panel.version');
|
||||
$current_db_version = Settings::Get('panel.db_version');
|
||||
if (empty($current_db_version)) {
|
||||
$current_db_version = "0";
|
||||
}
|
||||
$new_version = $version;
|
||||
$new_db_version = $dbversion;
|
||||
|
||||
$ui_text = $lng['update']['update_information']['part_a'];
|
||||
if ($version != $current_version) {
|
||||
$ui_text = str_replace('%curversion', $current_version, $ui_text);
|
||||
$ui_text = str_replace('%newversion', $new_version, $ui_text);
|
||||
} else {
|
||||
// show db version
|
||||
$ui_text = str_replace('%curversion', $current_db_version, $ui_text);
|
||||
$ui_text = str_replace('%newversion', $new_db_version, $ui_text);
|
||||
}
|
||||
$update_information = $ui_text;
|
||||
|
||||
include_once './install/updates/preconfig.php';
|
||||
$preconfig = getPreConfig($current_version);
|
||||
include_once \Froxlor\Froxlor::getInstallDir() . '/install/updates/preconfig.php';
|
||||
$preconfig = getPreConfig($current_version, $current_db_version);
|
||||
if ($preconfig != '') {
|
||||
$update_information .= '<br />' . $preconfig . $message;
|
||||
}
|
||||
|
||||
$update_information .= $lng['update']['update_information']['part_b'];
|
||||
|
||||
eval("echo \"" . getTemplate('update/index') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('update/index') . "\";");
|
||||
}
|
||||
} else {
|
||||
$success_message = $lng['update']['noupdatesavail'];
|
||||
$redirect_url = 'admin_index.php?s=' . $s;
|
||||
eval("echo \"" . getTemplate('update/noupdatesavail') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('update/noupdatesavail') . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
74
api.php
Normal file
@@ -0,0 +1,74 @@
|
||||
<?php
|
||||
require __DIR__ . '/vendor/autoload.php';
|
||||
|
||||
require \Froxlor\Froxlor::getInstallDir() . '/lib/tables.inc.php';
|
||||
|
||||
// check whether API interface is enabled after all
|
||||
if (\Froxlor\Settings::Get('api.enabled') != 1) {
|
||||
// not enabled
|
||||
header("Status: 404 Not found", 404);
|
||||
header($_SERVER["SERVER_PROTOCOL"] . " 404 Not found", 404);
|
||||
exit();
|
||||
}
|
||||
|
||||
// we're talking json here
|
||||
header("Content-Type:application/json");
|
||||
|
||||
// get our request
|
||||
$request = @file_get_contents('php://input');
|
||||
|
||||
// check if present
|
||||
if (empty($request)) {
|
||||
json_response(400, "Invalid request");
|
||||
}
|
||||
|
||||
// decode json request
|
||||
$decoded_request = json_decode(stripslashes($request), true);
|
||||
|
||||
// is it valid?
|
||||
if (is_null($decoded_request)) {
|
||||
json_response(400, "Invalid JSON");
|
||||
}
|
||||
|
||||
// validate content
|
||||
try {
|
||||
$request = \Froxlor\Api\FroxlorRPC::validateRequest($decoded_request);
|
||||
// now actually do it
|
||||
$cls = "\\Froxlor\\Api\\Commands\\" . $request['command']['class'];
|
||||
$method = $request['command']['method'];
|
||||
$apiObj = new $cls($decoded_request['header'], $request['params']);
|
||||
// call the method with the params if any
|
||||
echo $apiObj->$method();
|
||||
} catch (Exception $e) {
|
||||
json_response($e->getCode(), $e->getMessage());
|
||||
}
|
||||
|
||||
exit();
|
||||
|
||||
/**
|
||||
* output json result
|
||||
*
|
||||
* @param int $status
|
||||
* @param string $status_message
|
||||
* @param mixed $data
|
||||
*
|
||||
* @return void
|
||||
*/
|
||||
function json_response($status, $status_message = '', $data = null)
|
||||
{
|
||||
if (isset($_SERVER["SERVER_PROTOCOL"]) && ! empty($_SERVER["SERVER_PROTOCOL"])) {
|
||||
$resheader = $_SERVER["SERVER_PROTOCOL"] . " " . $status;
|
||||
if (! empty($status_message)) {
|
||||
$resheader .= ' ' . str_replace("\n", " ", $status_message);
|
||||
}
|
||||
header($resheader);
|
||||
}
|
||||
$response = array();
|
||||
$response['status'] = $status;
|
||||
$response['status_message'] = $status_message;
|
||||
$response['data'] = $data;
|
||||
|
||||
$json_response = json_encode($response, JSON_UNESCAPED_SLASHES | JSON_PRETTY_PRINT);
|
||||
echo $json_response;
|
||||
exit();
|
||||
}
|
||||
233
api_keys.php
Normal file
@@ -0,0 +1,233 @@
|
||||
<?php
|
||||
if (! defined('AREA')) {
|
||||
header("Location: index.php");
|
||||
exit();
|
||||
}
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2018 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2018-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
* @since 0.10.0
|
||||
*
|
||||
*/
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
|
||||
// This file is being included in admin_index and customer_index
|
||||
// and therefore does not need to require lib/init.php
|
||||
|
||||
$del_stmt = Database::prepare("DELETE FROM `" . TABLE_API_KEYS . "` WHERE id = :id");
|
||||
$success_message = "";
|
||||
$id = isset($_GET['id']) ? (int) $_GET['id'] : 0;
|
||||
$area = AREA;
|
||||
|
||||
// do the delete and then just show a success-message and the apikeys list again
|
||||
if ($action == 'delete') {
|
||||
if ($id > 0) {
|
||||
$chk = (AREA == 'admin' && $userinfo['customers_see_all'] == '1') ? true : false;
|
||||
if (AREA == 'customer') {
|
||||
$chk_stmt = Database::prepare("
|
||||
SELECT c.customerid FROM `" . TABLE_PANEL_CUSTOMERS . "` c
|
||||
LEFT JOIN `" . TABLE_API_KEYS . "` ak ON ak.customerid = c.customerid
|
||||
WHERE ak.`id` = :id AND c.`customerid` = :cid
|
||||
");
|
||||
$chk = Database::pexecute_first($chk_stmt, array(
|
||||
'id' => $id,
|
||||
'cid' => $userinfo['customerid']
|
||||
));
|
||||
} elseif (AREA == 'admin' && $userinfo['customers_see_all'] == '0') {
|
||||
$chk_stmt = Database::prepare("
|
||||
SELECT a.adminid FROM `" . TABLE_PANEL_ADMINS . "` a
|
||||
LEFT JOIN `" . TABLE_API_KEYS . "` ak ON ak.adminid = a.adminid
|
||||
WHERE ak.`id` = :id AND a.`adminid` = :aid
|
||||
");
|
||||
$chk = Database::pexecute_first($chk_stmt, array(
|
||||
'id' => $id,
|
||||
'aid' => $userinfo['adminid']
|
||||
));
|
||||
}
|
||||
if ($chk !== false) {
|
||||
Database::pexecute($del_stmt, array(
|
||||
'id' => $id
|
||||
));
|
||||
$success_message = sprintf($lng['apikeys']['apikey_removed'], $id);
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'add') {
|
||||
$ins_stmt = Database::prepare("
|
||||
INSERT INTO `" . TABLE_API_KEYS . "` SET
|
||||
`apikey` = :key, `secret` = :secret, `adminid` = :aid, `customerid` = :cid, `valid_until` = '-1', `allowed_from` = ''
|
||||
");
|
||||
// customer generates for himself, admins will see a customer-select-box later
|
||||
if (AREA == 'admin') {
|
||||
$cid = 0;
|
||||
} elseif (AREA == 'customer') {
|
||||
$cid = $userinfo['customerid'];
|
||||
}
|
||||
$key = hash('sha256', openssl_random_pseudo_bytes(64 * 64));
|
||||
$secret = hash('sha512', openssl_random_pseudo_bytes(64 * 64 * 4));
|
||||
Database::pexecute($ins_stmt, array(
|
||||
'key' => $key,
|
||||
'secret' => $secret,
|
||||
'aid' => $userinfo['adminid'],
|
||||
'cid' => $cid
|
||||
));
|
||||
$success_message = $lng['apikeys']['apikey_added'];
|
||||
} elseif ($action == 'jqEditApiKey') {
|
||||
$keyid = isset($_POST['id']) ? (int) $_POST['id'] : 0;
|
||||
$allowed_from = isset($_POST['allowed_from']) ? $_POST['allowed_from'] : "";
|
||||
$valid_until = isset($_POST['valid_until']) ? (int) $_POST['valid_until'] : - 1;
|
||||
|
||||
// validate allowed_from
|
||||
$ip_list = array_map('trim', explode(",", $allowed_from));
|
||||
$_check_list = $ip_list;
|
||||
foreach ($_check_list as $idx => $ip) {
|
||||
if (\Froxlor\Validate\Validate::validate_ip2($ip, true, 'invalidip', true, true) == false) {
|
||||
unset($ip_list[$idx]);
|
||||
}
|
||||
}
|
||||
$ip_list = array_map('inet_ntop', array_map('inet_pton', $ip_list));
|
||||
$allowed_from = implode(",", array_unique($ip_list));
|
||||
|
||||
if ($valid_until <= 0 || ! is_numeric($valid_until)) {
|
||||
$valid_until = - 1;
|
||||
}
|
||||
|
||||
$upd_stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_API_KEYS . "` SET
|
||||
`valid_until` = :vu, `allowed_from` = :af
|
||||
WHERE `id` = :keyid AND `adminid` = :aid AND `customerid` = :cid
|
||||
");
|
||||
if (AREA == 'admin') {
|
||||
$cid = 0;
|
||||
} elseif (AREA == 'customer') {
|
||||
$cid = $userinfo['customerid'];
|
||||
}
|
||||
Database::pexecute($upd_stmt, array(
|
||||
'keyid' => $keyid,
|
||||
'af' => $allowed_from,
|
||||
'vu' => $valid_until,
|
||||
'aid' => $userinfo['adminid'],
|
||||
'cid' => $cid
|
||||
));
|
||||
echo json_encode(true);
|
||||
exit();
|
||||
}
|
||||
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed api::api_keys");
|
||||
|
||||
// select all my (accessable) certificates
|
||||
$keys_stmt_query = "SELECT ak.*, c.loginname, a.loginname as adminname
|
||||
FROM `" . TABLE_API_KEYS . "` ak
|
||||
LEFT JOIN `" . TABLE_PANEL_CUSTOMERS . "` c ON `c`.`customerid` = `ak`.`customerid`
|
||||
LEFT JOIN `" . TABLE_PANEL_ADMINS . "` a ON `a`.`adminid` = `ak`.`adminid`
|
||||
WHERE ";
|
||||
|
||||
$qry_params = array();
|
||||
if (AREA == 'admin' && $userinfo['customers_see_all'] == '0') {
|
||||
// admin with only customer-specific permissions
|
||||
$keys_stmt_query .= "ak.adminid = :adminid ";
|
||||
$qry_params['adminid'] = $userinfo['adminid'];
|
||||
$fields = array(
|
||||
'a.loginname' => $lng['login']['username']
|
||||
);
|
||||
} elseif (AREA == 'customer') {
|
||||
// customer-area
|
||||
$keys_stmt_query .= "ak.customerid = :cid ";
|
||||
$qry_params['cid'] = $userinfo['customerid'];
|
||||
$fields = array(
|
||||
'c.loginname' => $lng['login']['username']
|
||||
);
|
||||
} else {
|
||||
// admin who can see all customers / reseller / admins
|
||||
$keys_stmt_query .= "1 ";
|
||||
$fields = array(
|
||||
'a.loginname' => $lng['login']['username']
|
||||
);
|
||||
}
|
||||
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_API_KEYS, $fields);
|
||||
$keys_stmt_query .= $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit();
|
||||
|
||||
$keys_stmt = Database::prepare($keys_stmt_query);
|
||||
Database::pexecute($keys_stmt, $qry_params);
|
||||
$all_keys = $keys_stmt->fetchAll(PDO::FETCH_ASSOC);
|
||||
$apikeys = "";
|
||||
|
||||
if (count($all_keys) == 0) {
|
||||
$count = 0;
|
||||
$message = $lng['apikeys']['no_api_keys'];
|
||||
$sortcode = "";
|
||||
$searchcode = "";
|
||||
$pagingcode = "";
|
||||
eval("\$apikeys.=\"" . \Froxlor\UI\Template::getTemplate("api_keys/keys_error", true) . "\";");
|
||||
} else {
|
||||
$count = count($all_keys);
|
||||
$paging->setEntries($count);
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
|
||||
foreach ($all_keys as $idx => $key) {
|
||||
if ($paging->checkDisplay($idx)) {
|
||||
|
||||
// my own key
|
||||
$isMyKey = false;
|
||||
if ($key['adminid'] == $userinfo['adminid'] && ((AREA == 'admin' && $key['customerid'] == 0) || (AREA == 'customer' && $key['customerid'] == $userinfo['customerid']))) {
|
||||
// this is mine
|
||||
$isMyKey = true;
|
||||
}
|
||||
|
||||
$adminCustomerLink = "";
|
||||
if (AREA == 'admin') {
|
||||
if ($isMyKey) {
|
||||
$adminCustomerLink = $key['adminname'];
|
||||
} else {
|
||||
$adminCustomerLink = '<a href="' . $linker->getLink(array(
|
||||
'section' => (empty($key['customerid']) ? 'admins' : 'customers'),
|
||||
'page' => (empty($key['customerid']) ? 'admins' : 'customers'),
|
||||
'action' => 'su',
|
||||
'id' => (empty($key['customerid']) ? $key['adminid'] : $key['customerid'])
|
||||
)) . '" rel="external">' . (empty($key['customerid']) ? $key['adminname'] : $key['loginname']) . '</a>';
|
||||
}
|
||||
} else {
|
||||
// customer do not need links
|
||||
$adminCustomerLink = $key['loginname'];
|
||||
}
|
||||
|
||||
// escape stuff
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($key);
|
||||
|
||||
// shorten keys
|
||||
$row['_apikey'] = substr($row['apikey'], 0, 20) . '...';
|
||||
$row['_secret'] = substr($row['secret'], 0, 20) . '...';
|
||||
|
||||
// check whether the api key is not valid anymore
|
||||
$isValid = true;
|
||||
if ($row['valid_until'] >= 0) {
|
||||
if ($row['valid_until'] < time()) {
|
||||
$isValid = false;
|
||||
}
|
||||
// format
|
||||
$row['valid_until'] = date('Y-m-d', $row['valid_until']);
|
||||
} else {
|
||||
// infinity
|
||||
$row['valid_until'] = "";
|
||||
}
|
||||
eval("\$apikeys.=\"" . \Froxlor\UI\Template::getTemplate("api_keys/keys_key", true) . "\";");
|
||||
} else {
|
||||
continue;
|
||||
}
|
||||
}
|
||||
}
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("api_keys/keys_list", true) . "\";");
|
||||
278
build.xml
Normal file
@@ -0,0 +1,278 @@
|
||||
<?xml version="1.0" encoding="UTF-8"?>
|
||||
|
||||
<project name="froxlor" default="build">
|
||||
|
||||
<!-- Use this when the tools are managed by Composer in ${basedir}/vendor/bin -->
|
||||
<property name="pdepend" value="${basedir}/vendor/bin/pdepend" />
|
||||
<property name="phpcpd" value="${basedir}/vendor/bin/phpcpd" />
|
||||
<property name="phpcs" value="${basedir}/vendor/bin/phpcs" />
|
||||
<property name="phpdox" value="${basedir}/vendor/bin/phpdox" />
|
||||
<property name="phploc" value="${basedir}/vendor/bin/phploc" />
|
||||
<property name="phpmd" value="${basedir}/vendor/bin/phpmd" />
|
||||
<property name="phpunit" value="${basedir}/vendor/bin/phpunit" />
|
||||
|
||||
<target name="full-build"
|
||||
depends="prepare,composer,static-analysis,phpunit,phpdox,-check-failure"
|
||||
description="Performs static analysis, runs the tests, and generates project documentation" />
|
||||
|
||||
<target name="full-build-parallel"
|
||||
depends="prepare,composer,static-analysis-parallel,phpunit,phpdox,-check-failure"
|
||||
description="Performs static analysis (executing the tools in parallel), runs the tests, and generates project documentation" />
|
||||
|
||||
<target name="quick-build"
|
||||
depends="prepare,composer,lint,phpunit-no-coverage"
|
||||
description="Performs a lint check and runs the tests (without generating code coverage reports)" />
|
||||
|
||||
<target name="static-analysis"
|
||||
depends="composer,lint,phploc-ci,pdepend,phpmd-ci,phpcs-ci,phpcompat-ci,phpcpd-ci"
|
||||
description="Performs static analysis" />
|
||||
|
||||
<!-- Adjust the threadCount attribute's value to the number of CPUs -->
|
||||
<target name="static-analysis-parallel"
|
||||
description="Performs static analysis (executing the tools in parallel)">
|
||||
<parallel threadCount="2">
|
||||
<sequential>
|
||||
<antcall target="pdepend" />
|
||||
<antcall target="phpmd-ci" />
|
||||
</sequential>
|
||||
<antcall target="lint" />
|
||||
<antcall target="phpcpd-ci" />
|
||||
<antcall target="phpcs-ci" />
|
||||
<antcall target="phpcompat-ci" />
|
||||
<antcall target="phploc-ci" />
|
||||
</parallel>
|
||||
</target>
|
||||
|
||||
<target name="clean" unless="clean.done"
|
||||
description="Cleanup build artifacts">
|
||||
<delete dir="${basedir}/build/api" />
|
||||
<delete dir="${basedir}/build/coverage" />
|
||||
<delete dir="${basedir}/build/logs" />
|
||||
<delete dir="${basedir}/build/pdepend" />
|
||||
<delete dir="${basedir}/build/phpdox" />
|
||||
<property name="clean.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="prepare" unless="prepare.done" depends="clean"
|
||||
description="Prepare for build">
|
||||
<mkdir dir="${basedir}/build/api" />
|
||||
<mkdir dir="${basedir}/build/coverage" />
|
||||
<mkdir dir="${basedir}/build/logs" />
|
||||
<mkdir dir="${basedir}/build/pdepend" />
|
||||
<mkdir dir="${basedir}/build/phpdox" />
|
||||
|
||||
<property name="prepare.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="composer"
|
||||
description="Installing composer dependencies" depends="prepare">
|
||||
<exec executable="composer" failonerror="true">
|
||||
<arg value="install" />
|
||||
<arg value="--prefer-dist" />
|
||||
<arg value="--no-progress" />
|
||||
</exec>
|
||||
</target>
|
||||
|
||||
<target name="lint" unless="lint.done"
|
||||
description="Perform syntax check of sourcecode files">
|
||||
<apply executable="php" taskname="lint">
|
||||
<arg value="-l" />
|
||||
|
||||
<fileset dir="${basedir}/lib/Froxlor">
|
||||
<include name="**/*.php" />
|
||||
<modified />
|
||||
</fileset>
|
||||
|
||||
<fileset dir="${basedir}/tests">
|
||||
<include name="**/*.php" />
|
||||
<modified />
|
||||
</fileset>
|
||||
</apply>
|
||||
|
||||
<property name="lint.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phploc" unless="phploc.done"
|
||||
description="Measure project size using PHPLOC and print human readable output. Intended for usage on the command line.">
|
||||
<exec executable="${phploc}" taskname="phploc">
|
||||
<arg value="--count-tests" />
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
<arg path="${basedir}/tests" />
|
||||
</exec>
|
||||
|
||||
<property name="phploc.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phploc-ci" unless="phploc.done" depends="prepare"
|
||||
description="Measure project size using PHPLOC and log result in CSV and XML format. Intended for usage within a continuous integration environment.">
|
||||
<exec executable="${phploc}" taskname="phploc">
|
||||
<arg value="--count-tests" />
|
||||
<arg value="--log-csv" />
|
||||
<arg path="${basedir}/build/logs/phploc.csv" />
|
||||
<arg value="--log-xml" />
|
||||
<arg path="${basedir}/build/logs/phploc.xml" />
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
<arg path="${basedir}/tests" />
|
||||
</exec>
|
||||
|
||||
<property name="phploc.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="pdepend" unless="pdepend.done" depends="prepare"
|
||||
description="Calculate software metrics using PHP_Depend and log result in XML format. Intended for usage within a continuous integration environment.">
|
||||
<exec executable="${pdepend}" taskname="pdepend">
|
||||
<arg value="--jdepend-xml=${basedir}/build/logs/jdepend.xml" />
|
||||
<arg
|
||||
value="--jdepend-chart=${basedir}/build/pdepend/dependencies.svg" />
|
||||
<arg
|
||||
value="--overview-pyramid=${basedir}/build/pdepend/overview-pyramid.svg" />
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
</exec>
|
||||
|
||||
<property name="pdepend.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpmd" unless="phpmd.done"
|
||||
description="Perform project mess detection using PHPMD and print human readable output. Intended for usage on the command line before committing.">
|
||||
<exec executable="${phpmd}" taskname="phpmd">
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
<arg value="text" />
|
||||
<arg path="${basedir}/phpmd.xml" />
|
||||
</exec>
|
||||
|
||||
<property name="phpmd.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpmd-ci" unless="phpmd.done" depends="prepare"
|
||||
description="Perform project mess detection using PHPMD and log result in XML format. Intended for usage within a continuous integration environment.">
|
||||
<exec executable="${phpmd}" taskname="phpmd">
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
<arg value="xml" />
|
||||
<arg path="${basedir}/phpmd.xml" />
|
||||
<arg value="--reportfile" />
|
||||
<arg path="${basedir}/build/logs/pmd.xml" />
|
||||
</exec>
|
||||
|
||||
<property name="phpmd.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpcs" unless="phpcs.done"
|
||||
description="Find coding standard violations using PHP_CodeSniffer and print human readable output. Intended for usage on the command line before committing.">
|
||||
<exec executable="${phpcs}" taskname="phpcs">
|
||||
<arg value="--standard=${basedir}/phpcs.xml" />
|
||||
<arg value="--extensions=php" />
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
<arg path="${basedir}/tests" />
|
||||
</exec>
|
||||
|
||||
<property name="phpcs.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpcs-ci" unless="phpcs.done" depends="prepare"
|
||||
description="Find coding standard violations using PHP_CodeSniffer and log result in XML format. Intended for usage within a continuous integration environment.">
|
||||
<exec executable="${phpcs}" output="/dev/null" taskname="phpcs">
|
||||
<arg value="--report=checkstyle" />
|
||||
<arg
|
||||
value="--report-file=${basedir}/build/logs/checkstyle-standard.xml" />
|
||||
<arg value="--standard=${basedir}/phpcs.xml" />
|
||||
<arg value="--extensions=php" />
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
<arg path="${basedir}/tests" />
|
||||
</exec>
|
||||
|
||||
<property name="phpcs.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpcompat" unless="phpcompat.done"
|
||||
depends="composer"
|
||||
description="Find php violations using PHP_CodeSniffer and print human readable output. Intended for usage on the command line before committing.">
|
||||
<exec executable="${phpcs}" taskname="phpcompat">
|
||||
<arg
|
||||
line="--standard=PHPCompatibility --runtime-set testVersion 5.6 ${basedir}/lib/Froxlor ${basedir}/tests" />
|
||||
</exec>
|
||||
|
||||
<property name="phpcompat.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpcompat-ci" unless="phpcompat.done"
|
||||
depends="composer"
|
||||
description="Find php violations using PHP_CodeSniffer and log result in XML format. Intended for usage within a continuous integration environment.">
|
||||
<exec executable="${phpcs}" output="/dev/null"
|
||||
taskname="phpcompat">
|
||||
<arg
|
||||
line="--standard=PHPCompatibility --runtime-set testVersion 5.6 --report=checkstyle --report-file=${basedir}/build/logs/checkstyle-compat.xml ${basedir}/lib/Froxlor ${basedir}/tests" />
|
||||
</exec>
|
||||
|
||||
<property name="phpcompat.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpcpd" unless="phpcpd.done"
|
||||
description="Find duplicate code using PHPCPD and print human readable output. Intended for usage on the command line before committing.">
|
||||
<exec executable="${phpcpd}" taskname="phpcpd">
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
</exec>
|
||||
|
||||
<property name="phpcpd.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpcpd-ci" unless="phpcpd.done" depends="prepare"
|
||||
description="Find duplicate code using PHPCPD and log result in XML format. Intended for usage within a continuous integration environment.">
|
||||
<exec executable="${phpcpd}" taskname="phpcpd">
|
||||
<arg value="--log-pmd" />
|
||||
<arg path="${basedir}/build/logs/pmd-cpd.xml" />
|
||||
<arg path="${basedir}/lib/Froxlor" />
|
||||
</exec>
|
||||
|
||||
<property name="phpcpd.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpunit" unless="phpunit.done" depends="composer"
|
||||
description="Run unit tests with PHPUnit">
|
||||
<exec executable="${phpunit}" resultproperty="result.phpunit"
|
||||
taskname="phpunit">
|
||||
<arg value="--configuration" />
|
||||
<arg path="${basedir}/phpunit.xml" />
|
||||
<arg value="--testsuite" />
|
||||
<arg value="froxlor" />
|
||||
</exec>
|
||||
|
||||
<property name="phpunit.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpunit-no-coverage" unless="phpunit.done"
|
||||
depends="composer"
|
||||
description="Run unit tests with PHPUnit (without generating code coverage reports)">
|
||||
<exec executable="${phpunit}" failonerror="true"
|
||||
taskname="phpunit">
|
||||
<arg value="--configuration" />
|
||||
<arg path="${basedir}/phpunit.xml" />
|
||||
<arg value="--testsuite" />
|
||||
<arg value="froxlor" />
|
||||
<arg value="--no-coverage" />
|
||||
</exec>
|
||||
|
||||
<property name="phpunit.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="phpdox" unless="phpdox.done"
|
||||
depends="phploc-ci,phpcs-ci,phpcompat-ci,phpmd-ci"
|
||||
description="Generate project documentation using phpDox">
|
||||
<exec executable="${phpdox}" dir="${basedir}/build"
|
||||
taskname="phpdox">
|
||||
<arg value="--file" />
|
||||
<arg path="${basedir}/phpdox.xml" />
|
||||
</exec>
|
||||
|
||||
<property name="phpdox.done" value="true" />
|
||||
</target>
|
||||
|
||||
<target name="-check-failure">
|
||||
<fail message="PHPUnit did not finish successfully">
|
||||
<condition>
|
||||
<not>
|
||||
<equals arg1="${result.phpunit}" arg2="0" />
|
||||
</not>
|
||||
</condition>
|
||||
</fail>
|
||||
</target>
|
||||
</project>
|
||||
1
cache/.gitignore
vendored
@@ -1 +0,0 @@
|
||||
*
|
||||
0
cache/.keep
vendored
81
composer.json
Normal file
@@ -0,0 +1,81 @@
|
||||
{
|
||||
"name": "froxlor/froxlor",
|
||||
"description": "The server administration software for your needs. Developed by experienced server administrators, this panel simplifies the effort of managing your hosting platform.",
|
||||
"keywords": [
|
||||
"server",
|
||||
"administration",
|
||||
"php"
|
||||
],
|
||||
"homepage": "https://www.froxlor.org",
|
||||
"license": "GPL-2.0-or-later",
|
||||
"authors": [
|
||||
{
|
||||
"name": "Michael Kaufmann",
|
||||
"email": "team@froxlor.org",
|
||||
"role": "Lead Developer"
|
||||
},
|
||||
{
|
||||
"name": "Robert Förster",
|
||||
"email": "team@froxlor.org",
|
||||
"role": "Package Maintainer"
|
||||
}
|
||||
],
|
||||
"support": {
|
||||
"email": "team@froxlor.org",
|
||||
"issues": "https://github.com/Froxlor/Froxlor/issues",
|
||||
"forum": "https://forum.froxlor.org/",
|
||||
"wiki": "https://github.com/Froxlor/Froxlor/wiki",
|
||||
"irc": "irc://chat.freenode.net/froxlor",
|
||||
"source": "https://github.com/Froxlor/Froxlor",
|
||||
"docs": "https://github.com/Froxlor/Froxlor/wiki"
|
||||
},
|
||||
"require": {
|
||||
"php": ">=5.6",
|
||||
"ext-session": "*",
|
||||
"ext-ctype": "*",
|
||||
"ext-pdo": "*",
|
||||
"ext-pdo_mysql": "*",
|
||||
"ext-simplexml": "*",
|
||||
"ext-xml": "*",
|
||||
"ext-filter": "*",
|
||||
"ext-posix": "*",
|
||||
"ext-mbstring": "*",
|
||||
"ext-curl": "*",
|
||||
"ext-json": "*",
|
||||
"ext-openssl": "*",
|
||||
"phpmailer/phpmailer": "~6.0",
|
||||
"monolog/monolog": "^1.24",
|
||||
"robthree/twofactorauth": "^1.6",
|
||||
"algo26-matthias/idna-convert": "^2.1"
|
||||
},
|
||||
"require-dev": {
|
||||
"phpunit/phpunit": "6.5.13",
|
||||
"pdepend/pdepend": "2.5.0",
|
||||
"phpmd/phpmd": "2.6.0",
|
||||
"sebastian/phpcpd": "3.0.1",
|
||||
"squizlabs/php_codesniffer": "3.3.2",
|
||||
"phploc/phploc": "3.0.1",
|
||||
"theseer/phpdox": "0.11.2",
|
||||
"phpunit/php-invoker": "1.1.4",
|
||||
"php": ">=7.1",
|
||||
"ext-pcntl": "*",
|
||||
"phpcompatibility/php-compatibility": "*"
|
||||
},
|
||||
"suggest": {
|
||||
"ext-bcmath": "*",
|
||||
"ext-zip": "*",
|
||||
"ext-apcu": "*",
|
||||
"ext-readline": "*"
|
||||
},
|
||||
"autoload": {
|
||||
"psr-4": {
|
||||
"Froxlor\\": [
|
||||
"lib/Froxlor"
|
||||
]
|
||||
}
|
||||
},
|
||||
"scripts": {
|
||||
"post-install-cmd": "if [ -f ./vendor/bin/phpcs ]; then \"vendor/bin/phpcs\" --config-set installed_paths vendor/phpcompatibility/php-compatibility ; fi",
|
||||
"post-update-cmd" : "if [ -f ./vendor/bin/phpcs ]; then \"vendor/bin/phpcs\" --config-set installed_paths vendor/phpcompatibility/php-compatibility ; fi"
|
||||
}
|
||||
}
|
||||
2994
composer.lock
generated
Normal file
|
Before Width: | Height: | Size: 369 B |
|
Before Width: | Height: | Size: 387 B |
|
Before Width: | Height: | Size: 278 B |
|
Before Width: | Height: | Size: 232 B |
|
Before Width: | Height: | Size: 321 B |
|
Before Width: | Height: | Size: 280 B |
|
Before Width: | Height: | Size: 5.1 KiB |
|
Before Width: | Height: | Size: 246 B |
|
Before Width: | Height: | Size: 287 B |
|
Before Width: | Height: | Size: 4.7 KiB |
|
Before Width: | Height: | Size: 4.3 KiB |
BIN
css/images/ui-icons_444444_256x240.png
Normal file
|
After Width: | Height: | Size: 6.8 KiB |
BIN
css/images/ui-icons_555555_256x240.png
Normal file
|
After Width: | Height: | Size: 6.8 KiB |
BIN
css/images/ui-icons_777620_256x240.png
Normal file
|
After Width: | Height: | Size: 4.4 KiB |
BIN
css/images/ui-icons_777777_256x240.png
Normal file
|
After Width: | Height: | Size: 6.8 KiB |
BIN
css/images/ui-icons_cc0000_256x240.png
Normal file
|
After Width: | Height: | Size: 4.4 KiB |
|
Before Width: | Height: | Size: 4.3 KiB |
|
Before Width: | Height: | Size: 4.3 KiB |
|
Before Width: | Height: | Size: 4.7 KiB After Width: | Height: | Size: 6.2 KiB |
1896
css/jquery-ui.min.css
vendored
@@ -16,10 +16,19 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'customer');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\SubDomains as SubDomains;
|
||||
use Froxlor\Api\Commands\Certificates as Certificates;
|
||||
|
||||
// redirect if this customer page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'domains')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
@@ -27,23 +36,25 @@ if (isset($_POST['id'])) {
|
||||
}
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains");
|
||||
eval("echo \"" . getTemplate("domains/domains") . "\";");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_domains");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("domains/domains") . "\";");
|
||||
} elseif ($page == 'domains') {
|
||||
if ($action == '') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains");
|
||||
$fields = array(
|
||||
'd.domain' => $lng['domains']['domainname']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_DOMAINS, $fields);
|
||||
$domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d`
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_DOMAINS, $fields);
|
||||
$domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isbinddomain`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `d`.`letsencrypt`, `d`.`registration_date`, `d`.`termination_date`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d`
|
||||
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id`
|
||||
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id`
|
||||
WHERE `d`.`customerid`= :customerid
|
||||
AND `d`.`email_only`='0'
|
||||
AND `d`.`id` <> :standardsubdomain " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($domains_stmt, array("customerid" => $userinfo['customerid'], "standardsubdomain" => $userinfo['standardsubdomain']));
|
||||
AND `d`.`id` <> :standardsubdomain " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($domains_stmt, array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"standardsubdomain" => $userinfo['standardsubdomain']
|
||||
));
|
||||
$paging->setEntries(Database::num_rows());
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
@@ -69,7 +80,9 @@ if ($page == 'overview') {
|
||||
// nothing (ssl_global)
|
||||
$row['domain_hascert'] = 0;
|
||||
$ssl_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE `domainid` = :domainid");
|
||||
Database::pexecute($ssl_stmt, array("domainid" => $row['id']));
|
||||
Database::pexecute($ssl_stmt, array(
|
||||
"domainid" => $row['id']
|
||||
));
|
||||
$ssl_result = $ssl_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
if (is_array($ssl_result) && isset($ssl_result['ssl_cert_file']) && $ssl_result['ssl_cert_file'] != '') {
|
||||
// own certificate (ssl_customer_green)
|
||||
@@ -78,7 +91,9 @@ if ($page == 'overview') {
|
||||
// check if it's parent has one set (shared)
|
||||
if ($row['parentdomainid'] != 0) {
|
||||
$ssl_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "` WHERE `domainid` = :domainid");
|
||||
Database::pexecute($ssl_stmt, array("domainid" => $row['parentdomainid']));
|
||||
Database::pexecute($ssl_stmt, array(
|
||||
"domainid" => $row['parentdomainid']
|
||||
));
|
||||
$ssl_result = $ssl_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
if (is_array($ssl_result) && isset($ssl_result['ssl_cert_file']) && $ssl_result['ssl_cert_file'] != '') {
|
||||
// parent has a certificate (ssl_shared)
|
||||
@@ -87,6 +102,18 @@ if ($page == 'overview') {
|
||||
}
|
||||
}
|
||||
|
||||
$row['termination_date'] = str_replace("0000-00-00", "", $row['termination_date']);
|
||||
if ($row['termination_date'] != "") {
|
||||
$cdate = strtotime($row['termination_date'] . " 23:59:59");
|
||||
$today = time();
|
||||
|
||||
if ($cdate < $today) {
|
||||
$row['termination_css'] = 'domain-expired';
|
||||
} else {
|
||||
$row['termination_css'] = 'domain-canceled';
|
||||
}
|
||||
}
|
||||
|
||||
$domains_count ++;
|
||||
$domain_array[$row['domain']] = $row;
|
||||
}
|
||||
@@ -102,6 +129,11 @@ if ($page == 'overview') {
|
||||
if ($row['parentdomainid'] == 0) {
|
||||
$domain_sort_array[$sortkey][$sortkey] = $row;
|
||||
} else {
|
||||
// when searching and the results are subdomains only, we need to get
|
||||
// the parent domain to this subdomain
|
||||
if (! isset($domain_id_array[$row['parentdomainid']])) {
|
||||
$domain_id_array[$row['parentdomainid']] = "[parent-domain]";
|
||||
}
|
||||
$domain_sort_array[$domain_id_array[$row['parentdomainid']]][$sortkey] = $row;
|
||||
}
|
||||
}
|
||||
@@ -117,13 +149,16 @@ if ($page == 'overview') {
|
||||
$i = 0;
|
||||
foreach ($domain_sort_array as $sortkey => $domain_array) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$row = htmlentities_array($domain_array[$sortkey]);
|
||||
|
||||
if (isset($domain_array[$sortkey])) {
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($domain_array[$sortkey]);
|
||||
if (Settings::Get('system.awstats_enabled') == '1') {
|
||||
$statsapp = 'awstats';
|
||||
} else {
|
||||
$statsapp = 'webalizer';
|
||||
}
|
||||
eval("\$domains.=\"" . getTemplate("domains/domains_delimiter") . "\";");
|
||||
eval("\$domains.=\"" . \Froxlor\UI\Template::getTemplate("domains/domains_delimiter") . "\";");
|
||||
}
|
||||
|
||||
if ($paging->sortfield == 'd.domain' && $paging->sortorder == 'asc') {
|
||||
ksort($domain_array);
|
||||
@@ -133,282 +168,88 @@ if ($page == 'overview') {
|
||||
|
||||
foreach ($domain_array as $row) {
|
||||
if (strpos($row['documentroot'], $userinfo['documentroot']) === 0) {
|
||||
$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
|
||||
$row['documentroot'] = \Froxlor\FileDir::makeCorrectDir(str_replace($userinfo['documentroot'], "/", $row['documentroot']));
|
||||
}
|
||||
|
||||
// get ssl-ips if activated
|
||||
$show_ssledit = false;
|
||||
if (Settings::Get('system.use_ssl') == '1' && domainHasSslIpPort($row['id']) && $row['caneditdomain'] == '1') {
|
||||
if (Settings::Get('system.use_ssl') == '1' && \Froxlor\Domain\Domain::domainHasSslIpPort($row['id']) && $row['caneditdomain'] == '1' && $row['letsencrypt'] == 0) {
|
||||
$show_ssledit = true;
|
||||
}
|
||||
$row = htmlentities_array($row);
|
||||
eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
eval("\$domains.=\"" . \Froxlor\UI\Template::getTemplate("domains/domains_domain") . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
$i += count($domain_array);
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("domains/domainlist") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("domains/domainlist") . "\";");
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
$stmt = Database::prepare("SELECT `id`, `customerid`, `domain`, `documentroot`, `isemaildomain`, `parentdomainid` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = SubDomains::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
$alias_stmt = Database::prepare("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `aliasdomain` = :aliasdomain");
|
||||
Database::pexecute($alias_stmt, array("aliasdomain" => $id));
|
||||
$alias_check = $alias_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$alias_check = Database::pexecute_first($alias_stmt, array(
|
||||
"aliasdomain" => $id
|
||||
));
|
||||
|
||||
if (isset($result['parentdomainid']) && $result['parentdomainid'] != '0' && $alias_check['count'] == 0) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
if ($result['isemaildomain'] == '1') {
|
||||
$emails_stmt = Database::prepare("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_MAIL_VIRTUAL . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `domainid` = :domainid"
|
||||
);
|
||||
Database::pexecute($emails_stmt, array("customerid" => $userinfo['customerid'], "domainid" => $id));
|
||||
$emails = $emails_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if ($emails['count'] != '0') {
|
||||
standard_error('domains_cantdeletedomainwithemail');
|
||||
try {
|
||||
SubDomains::getLocal($userinfo, $_POST)->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
}
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "deleted subdomain '" . $idna_convert->decode($result['domain']) . "'");
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE
|
||||
`customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `subdomains_used` = `subdomains_used` - 1
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
// remove connections to ips and domainredirects
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_DOMAINTOIP . "`
|
||||
WHERE `id_domain` = :domainid"
|
||||
);
|
||||
Database::pexecute($del_stmt, array('domainid' => $id));
|
||||
|
||||
$del_stmt = Database::prepare("
|
||||
DELETE FROM `" . TABLE_PANEL_DOMAINREDIRECTS . "`
|
||||
WHERE `did` = :domainid"
|
||||
);
|
||||
Database::pexecute($del_stmt, array('domainid' => $id));
|
||||
|
||||
inserttask('1');
|
||||
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('domains_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['domain']));
|
||||
\Froxlor\UI\HTML::askYesNo('domains_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $idna_convert->decode($result['domain']));
|
||||
}
|
||||
} else {
|
||||
standard_error('domains_cantdeletemaindomain');
|
||||
\Froxlor\UI\Response::standard_error('domains_cantdeletemaindomain');
|
||||
}
|
||||
} elseif ($action == 'add') {
|
||||
if ($userinfo['subdomains_used'] < $userinfo['subdomains'] || $userinfo['subdomains'] == '-1') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$subdomain = $idna_convert->encode(preg_replace(array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['subdomain'], 'subdomain', '', 'subdomainiswrong')));
|
||||
$domain = $idna_convert->encode($_POST['domain']);
|
||||
$domain_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `domain` = :domain
|
||||
AND `customerid` = :customerid
|
||||
AND `parentdomainid` = '0'
|
||||
AND `email_only` = '0'
|
||||
AND `caneditdomain` = '1'"
|
||||
);
|
||||
$domain_check = Database::pexecute_first($domain_stmt, array("domain" => $domain, "customerid" => $userinfo['customerid']));
|
||||
|
||||
$completedomain = $subdomain . '.' . $domain;
|
||||
|
||||
if ($completedomain == Settings::Get('system.hostname')) {
|
||||
standard_error('admin_domain_emailsystemhostname');
|
||||
exit;
|
||||
try {
|
||||
SubDomains::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
$completedomain_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `domain` = :domain
|
||||
AND `customerid` = :customerid
|
||||
AND `email_only` = '0'
|
||||
AND `caneditdomain` = '1'"
|
||||
);
|
||||
$completedomain_check = Database::pexecute_first($completedomain_stmt, array("domain" => $completedomain, "customerid" => $userinfo['customerid']));
|
||||
|
||||
$aliasdomain = intval($_POST['alias']);
|
||||
$aliasdomain_check = array('id' => 0);
|
||||
$_doredirect = false;
|
||||
|
||||
if ($aliasdomain != 0) {
|
||||
// also check ip/port combination to be the same, #176
|
||||
$aliasdomain_stmt = Database::prepare("SELECT `d`.`id` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip`
|
||||
WHERE `d`.`aliasdomain` IS NULL
|
||||
AND `d`.`id` = :id
|
||||
AND `c`.`standardsubdomain` <> `d`.`id`
|
||||
AND `d`.`customerid` = :customerid
|
||||
AND `c`.`customerid` = `d`.`customerid`
|
||||
AND `d`.`id` = `dip`.`id_domain`
|
||||
AND `dip`.`id_ipandports`
|
||||
IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."`
|
||||
WHERE `id_domain` = :id )
|
||||
GROUP BY `d`.`domain`
|
||||
ORDER BY `d`.`domain` ASC;"
|
||||
);
|
||||
$aliasdomain_check = Database::pexecute_first($aliasdomain_stmt, array("id" => $aliasdomain, "customerid" => $userinfo['customerid']));
|
||||
}
|
||||
|
||||
if (isset($_POST['url']) && $_POST['url'] != '' && validateUrl($idna_convert->encode($_POST['url']))) {
|
||||
$path = $_POST['url'];
|
||||
$_doredirect = true;
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$path = validate($_POST['path'], 'path');
|
||||
}
|
||||
|
||||
if (!preg_match('/^https?\:\/\//', $path) || !validateUrl($idna_convert->encode($path))) {
|
||||
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
|
||||
// set default path to subdomain or domain name
|
||||
if ((($path == '') || ($path == '/')) && Settings::Get('system.documentroot_use_default_value') == 1) {
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
|
||||
} else {
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
||||
}
|
||||
if (strstr($path, ":") !== FALSE) {
|
||||
standard_error('pathmaynotcontaincolon');
|
||||
}
|
||||
} else {
|
||||
$_doredirect = true;
|
||||
}
|
||||
|
||||
$openbasedir_path = '0';
|
||||
if (isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') {
|
||||
$openbasedir_path = '1';
|
||||
}
|
||||
|
||||
$ssl_redirect = '0';
|
||||
if (isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') {
|
||||
// a ssl-redirect only works of there actually is a
|
||||
// ssl ip/port assigned to the domain
|
||||
if (domainHasSslIpPort($domain_check['id']) == true) {
|
||||
$ssl_redirect = '1';
|
||||
} else {
|
||||
standard_error('sslredirectonlypossiblewithsslipport');
|
||||
}
|
||||
}
|
||||
|
||||
if ($path == '') {
|
||||
standard_error('patherror');
|
||||
} elseif ($subdomain == '') {
|
||||
standard_error(array('stringisempty', 'domainname'));
|
||||
} elseif ($subdomain == 'www' && $domain_check['wwwserveralias'] == '1') {
|
||||
standard_error('wwwnotallowed');
|
||||
} elseif ($domain == '') {
|
||||
standard_error('domaincantbeempty');
|
||||
} elseif (strtolower($completedomain_check['domain']) == strtolower($completedomain)) {
|
||||
standard_error('domainexistalready', $completedomain);
|
||||
} elseif (strtolower($domain_check['domain']) != strtolower($domain)) {
|
||||
standard_error('maindomainnonexist', $domain);
|
||||
} elseif ($aliasdomain_check['id'] != $aliasdomain) {
|
||||
standard_error('domainisaliasorothercustomer');
|
||||
} else {
|
||||
// get the phpsettingid from parentdomain, #107
|
||||
$phpsid_stmt = Database::prepare("SELECT `phpsettingid` FROM `".TABLE_PANEL_DOMAINS."`
|
||||
WHERE `id` = :id"
|
||||
);
|
||||
Database::pexecute($phpsid_stmt, array("id" => $domain_check['id']));
|
||||
$phpsid_result = $phpsid_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if (!isset($phpsid_result['phpsettingid']) || (int)$phpsid_result['phpsettingid'] <= 0) {
|
||||
// assign default config
|
||||
$phpsid_result['phpsettingid'] = 1;
|
||||
}
|
||||
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET
|
||||
`customerid` = :customerid,
|
||||
`domain` = :domain,
|
||||
`documentroot` = :documentroot,
|
||||
`aliasdomain` = :aliasdomain,
|
||||
`parentdomainid` = :parentdomainid,
|
||||
`wwwserveralias` = :wwwserveralias,
|
||||
`isemaildomain` = :isemaildomain,
|
||||
`iswildcarddomain` = :iswildcarddomain,
|
||||
`openbasedir` = :openbasedir,
|
||||
`openbasedir_path` = :openbasedir_path,
|
||||
`speciallogfile` = :speciallogfile,
|
||||
`specialsettings` = :specialsettings,
|
||||
`ssl_redirect` = :ssl_redirect,
|
||||
`phpsettingid` = :phpsettingid"
|
||||
);
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"domain" => $completedomain,
|
||||
"documentroot" => $path,
|
||||
"aliasdomain" => $aliasdomain != 0 ? $aliasdomain : null,
|
||||
"parentdomainid" => $domain_check['id'],
|
||||
"wwwserveralias" => $domain_check['wwwserveralias'] == '1' ? '1' : '0',
|
||||
"iswildcarddomain" => $domain_check['iswildcarddomain'] == '1' ? '1' : '0',
|
||||
"isemaildomain" => $domain_check['subcanemaildomain'] == '3' ? '1' : '0',
|
||||
"openbasedir" => $domain_check['openbasedir'],
|
||||
"openbasedir_path" => $openbasedir_path,
|
||||
"speciallogfile" => $domain_check['speciallogfile'],
|
||||
"specialsettings" => $domain_check['specialsettings'],
|
||||
"ssl_redirect" => $ssl_redirect,
|
||||
"phpsettingid" => $phpsid_result['phpsettingid']
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
if ($_doredirect) {
|
||||
$did = Database::lastInsertId();
|
||||
$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : Settings::Get('customredirect.default');
|
||||
addRedirectToDomain($did, $redirect);
|
||||
}
|
||||
|
||||
$stmt = Database::prepare("INSERT INTO `".TABLE_DOMAINTOIP."`
|
||||
(`id_domain`, `id_ipandports`)
|
||||
SELECT LAST_INSERT_ID(), `id_ipandports`
|
||||
FROM `".TABLE_DOMAINTOIP."`
|
||||
WHERE `id_domain` = :id_domain"
|
||||
);
|
||||
Database::pexecute($stmt, array("id_domain" => $domain_check['id']));
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `subdomains_used` = `subdomains_used` + 1
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
|
||||
inserttask('1');
|
||||
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$stmt = Database::prepare("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
$stmt = Database::prepare("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain`,`letsencrypt` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `parentdomainid` = '0'
|
||||
AND `email_only` = '0'
|
||||
AND `caneditdomain` = '1'
|
||||
ORDER BY `domain` ASC"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
ORDER BY `domain` ASC");
|
||||
Database::pexecute($stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
$domains = '';
|
||||
|
||||
while ($row = $stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$domains .= makeoption($idna_convert->decode($row['domain']), $row['domain']);
|
||||
$domains .= \Froxlor\UI\HTML::makeoption($idna_convert->decode($row['domain']), $row['domain']);
|
||||
}
|
||||
|
||||
$aliasdomains = makeoption($lng['domains']['noaliasdomain'], 0, NULL, true);
|
||||
$aliasdomains = \Froxlor\UI\HTML::makeoption($lng['domains']['noaliasdomain'], 0, NULL, true);
|
||||
$domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c`
|
||||
WHERE `d`.`aliasdomain` IS NULL
|
||||
AND `d`.`id` <> `c`.`standardsubdomain`
|
||||
@@ -416,199 +257,95 @@ if ($page == 'overview') {
|
||||
AND `d`.`customerid`=`c`.`customerid`
|
||||
AND `d`.`email_only`='0'
|
||||
AND `d`.`customerid`= :customerid
|
||||
ORDER BY `d`.`domain` ASC"
|
||||
);
|
||||
Database::pexecute($domains_stmt, array("customerid" => $userinfo['customerid']));
|
||||
ORDER BY `d`.`domain` ASC");
|
||||
Database::pexecute($domains_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
|
||||
while ($row_domain = $domains_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$aliasdomains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
|
||||
$aliasdomains .= \Froxlor\UI\HTML::makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
|
||||
}
|
||||
|
||||
$redirectcode = '';
|
||||
if (Settings::Get('customredirect.enabled') == '1') {
|
||||
$codes = getRedirectCodesArray();
|
||||
$codes = \Froxlor\Domain\Domain::getRedirectCodesArray();
|
||||
foreach ($codes as $rc) {
|
||||
$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id']);
|
||||
$redirectcode .= \Froxlor\UI\HTML::makeoption($rc['code'] . ' (' . $lng['redirect_desc'][$rc['desc']] . ')', $rc['id']);
|
||||
}
|
||||
}
|
||||
|
||||
// check if we at least have one ssl-ip/port, #1179
|
||||
$ssl_ipsandports = '';
|
||||
$ssl_ip_stmt = Database::prepare("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
|
||||
$ssl_ip_stmt = Database::prepare("
|
||||
SELECT COUNT(*) as countSSL
|
||||
FROM `" . TABLE_PANEL_IPSANDPORTS . "` pip
|
||||
LEFT JOIN `" . TABLE_DOMAINTOIP . "` dti ON dti.id_ipandports = pip.id
|
||||
WHERE pip.`ssl`='1'
|
||||
");
|
||||
Database::pexecute($ssl_ip_stmt);
|
||||
$resultX = $ssl_ip_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
if (isset($resultX['countSSL']) && (int) $resultX['countSSL'] > 0) {
|
||||
$ssl_ipsandports = 'notempty';
|
||||
}
|
||||
|
||||
$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
$openbasedir = \Froxlor\UI\HTML::makeoption($lng['domain']['docroot'], 0, NULL, true) . \Froxlor\UI\HTML::makeoption($lng['domain']['homedir'], 1, NULL, true);
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
|
||||
$phpconfigs = '';
|
||||
$has_phpconfigs = false;
|
||||
if (isset($userinfo['allowed_phpconfigs']) && ! empty($userinfo['allowed_phpconfigs'])) {
|
||||
$has_phpconfigs = true;
|
||||
$allowed_cfg = json_decode($userinfo['allowed_phpconfigs'], JSON_OBJECT_AS_ARRAY);
|
||||
$phpconfigs_result_stmt = Database::query("
|
||||
SELECT c.*, fc.description as interpreter
|
||||
FROM `" . TABLE_PANEL_PHPCONFIGS . "` c
|
||||
LEFT JOIN `" . TABLE_PANEL_FPMDAEMONS . "` fc ON fc.id = c.fpmsettingid
|
||||
WHERE c.id IN (" . implode(", ", $allowed_cfg) . ")
|
||||
");
|
||||
while ($phpconfigs_row = $phpconfigs_result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ((int) Settings::Get('phpfpm.enabled') == 1) {
|
||||
$phpconfigs .= \Froxlor\UI\HTML::makeoption($phpconfigs_row['description'] . " [" . $phpconfigs_row['interpreter'] . "]", $phpconfigs_row['id'], Settings::Get('phpfpm.defaultini'), true, true);
|
||||
} else {
|
||||
$phpconfigs .= \Froxlor\UI\HTML::makeoption($phpconfigs_row['description'], $phpconfigs_row['id'], Settings::Get('system.mod_fcgid_defaultini'), true, true);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
$subdomain_add_data = include_once dirname(__FILE__) . '/lib/formfields/customer/domains/formfield.domains_add.php';
|
||||
$subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data);
|
||||
$subdomain_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($subdomain_add_data);
|
||||
|
||||
$title = $subdomain_add_data['domain_add']['title'];
|
||||
$image = $subdomain_add_data['domain_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("domains/domains_add") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("domains/domains_add") . "\";");
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
|
||||
$stmt = Database::prepare("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`wwwserveralias`, `d`.`iswildcarddomain`,
|
||||
`d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `pd`.`subcanemaildomain`
|
||||
FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd`
|
||||
WHERE `d`.`customerid` = :customerid
|
||||
AND `d`.`id` = :id
|
||||
AND ((`d`.`parentdomainid`!='0'
|
||||
AND `pd`.`id` = `d`.`parentdomainid`)
|
||||
OR (`d`.`parentdomainid`='0'
|
||||
AND `pd`.`id` = `d`.`id`))
|
||||
AND `d`.`caneditdomain`='1'");
|
||||
$result = Database::pexecute_first($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
|
||||
$alias_stmt = Database::prepare("SELECT COUNT(`id`) AS count FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `aliasdomain`= :aliasdomain");
|
||||
$alias_check = Database::pexecute_first($alias_stmt, array("aliasdomain" => $result['id']));
|
||||
$alias_check = $alias_check['count'];
|
||||
$_doredirect = false;
|
||||
try {
|
||||
$json_result = SubDomains::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['customerid']) && $result['customerid'] == $userinfo['customerid']) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
if (isset($_POST['url']) && $_POST['url'] != '' && validateUrl($idna_convert->encode($_POST['url']))) {
|
||||
$path = $_POST['url'];
|
||||
$_doredirect = true;
|
||||
} else {
|
||||
$path = validate($_POST['path'], 'path');
|
||||
}
|
||||
|
||||
if (!preg_match('/^https?\:\/\//', $path) || !validateUrl($idna_convert->encode($path))) {
|
||||
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
|
||||
// set default path to subdomain or domain name
|
||||
if ((($path == '') || ($path == '/')) && Settings::Get('system.documentroot_use_default_value') == 1) {
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
|
||||
} else {
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
||||
}
|
||||
if (strstr($path, ":") !== FALSE) {
|
||||
standard_error('pathmaynotcontaincolon');
|
||||
}
|
||||
} else {
|
||||
$_doredirect = true;
|
||||
}
|
||||
|
||||
$aliasdomain = intval($_POST['alias']);
|
||||
|
||||
if (isset($_POST['selectserveralias']) && $result['parentdomainid'] == '0' ) {
|
||||
$iswildcarddomain = ($_POST['selectserveralias'] == '0') ? '1' : '0';
|
||||
$wwwserveralias = ($_POST['selectserveralias'] == '1') ? '1' : '0';
|
||||
} else {
|
||||
$iswildcarddomain = $result['iswildcarddomain'];
|
||||
$wwwserveralias = $result['wwwserveralias'];
|
||||
}
|
||||
|
||||
if ($result['parentdomainid'] != '0' && ($result['subcanemaildomain'] == '1' || $result['subcanemaildomain'] == '2') && isset($_POST['isemaildomain'])) {
|
||||
$isemaildomain = intval($_POST['isemaildomain']);
|
||||
} else {
|
||||
$isemaildomain = $result['isemaildomain'];
|
||||
}
|
||||
|
||||
$aliasdomain_check = array('id' => 0);
|
||||
|
||||
if ($aliasdomain != 0) {
|
||||
$aliasdomain_stmt = Database::prepare("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` `d`,`" . TABLE_PANEL_CUSTOMERS . "` `c`
|
||||
WHERE `d`.`customerid`= :customerid
|
||||
AND `d`.`aliasdomain` IS NULL
|
||||
AND `d`.`id`<>`c`.`standardsubdomain`
|
||||
AND `c`.`customerid`= :customerid
|
||||
AND `d`.`id`= :id"
|
||||
);
|
||||
$aliasdomain_check = Database::pexecute_first($aliasdomain_stmt, array("customerid" => $result['customerid'], "id" => $aliasdomain));
|
||||
}
|
||||
|
||||
if ($aliasdomain_check['id'] != $aliasdomain) {
|
||||
standard_error('domainisaliasorothercustomer');
|
||||
}
|
||||
|
||||
if (isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') {
|
||||
$openbasedir_path = '1';
|
||||
} else {
|
||||
$openbasedir_path = '0';
|
||||
}
|
||||
|
||||
if (isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') {
|
||||
// a ssl-redirect only works of there actually is a
|
||||
// ssl ip/port assigned to the domain
|
||||
if (domainHasSslIpPort($id) == true) {
|
||||
$ssl_redirect = '1';
|
||||
} else {
|
||||
standard_error('sslredirectonlypossiblewithsslipport');
|
||||
}
|
||||
} else {
|
||||
$ssl_redirect = '0';
|
||||
}
|
||||
|
||||
if ($path == '') {
|
||||
standard_error('patherror');
|
||||
} else {
|
||||
if (($result['isemaildomain'] == '1') && ($isemaildomain == '0')) {
|
||||
$params = array("customerid" => $userinfo['customerid'], "domainid" => $id);
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid`= :customerid AND `domainid`= :domainid");
|
||||
Database::pexecute($stmt, $params);
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`= :customerid AND `domainid`= :domainid");
|
||||
Database::pexecute($stmt, $params);
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'");
|
||||
}
|
||||
|
||||
if ($_doredirect) {
|
||||
$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : false;
|
||||
updateRedirectOfDomain($id, $redirect);
|
||||
}
|
||||
|
||||
if ($path != $result['documentroot']
|
||||
|| $isemaildomain != $result['isemaildomain']
|
||||
|| $wwwserveralias != $result['wwwserveralias']
|
||||
|| $iswildcarddomain != $result['iswildcarddomain']
|
||||
|| $aliasdomain != $result['aliasdomain']
|
||||
|| $openbasedir_path != $result['openbasedir_path']
|
||||
|| $ssl_redirect != $result['ssl_redirect']) {
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
|
||||
`documentroot`= :documentroot,
|
||||
`isemaildomain`= :isemaildomain,
|
||||
`wwwserveralias`= :wwwserveralias,
|
||||
`iswildcarddomain`= :iswildcarddomain,
|
||||
`aliasdomain`= :aliasdomain,
|
||||
`openbasedir_path`= :openbasedir_path,
|
||||
`ssl_redirect`= :ssl_redirect
|
||||
WHERE `customerid`= :customerid
|
||||
AND `id`= :id"
|
||||
);
|
||||
$params = array(
|
||||
"documentroot" => $path,
|
||||
"isemaildomain" => $isemaildomain,
|
||||
"wwwserveralias" => $wwwserveralias,
|
||||
"iswildcarddomain" => $iswildcarddomain,
|
||||
"aliasdomain" => ($aliasdomain != 0 && $alias_check == 0) ? $aliasdomain : null,
|
||||
"openbasedir_path" => $openbasedir_path,
|
||||
"ssl_redirect" => $ssl_redirect,
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"id" => $id
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
inserttask('1');
|
||||
|
||||
// Using nameserver, insert a task which rebuilds the server config
|
||||
inserttask('4');
|
||||
|
||||
}
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
try {
|
||||
SubDomains::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$result['domain'] = $idna_convert->decode($result['domain']);
|
||||
|
||||
$domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true);
|
||||
$domains = \Froxlor\UI\HTML::makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true);
|
||||
// also check ip/port combination to be the same, #176
|
||||
$domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `" . TABLE_DOMAINTOIP . "` `dip`
|
||||
WHERE `d`.`aliasdomain` IS NULL
|
||||
@@ -621,47 +358,60 @@ if ($page == 'overview') {
|
||||
AND `dip`.`id_ipandports`
|
||||
IN (SELECT `id_ipandports` FROM `" . TABLE_DOMAINTOIP . "`
|
||||
WHERE `id_domain` = :id)
|
||||
GROUP BY `d`.`domain`
|
||||
ORDER BY `d`.`domain` ASC"
|
||||
);
|
||||
Database::pexecute($domains_stmt, array("id" => $result['id'], "customerid" => $userinfo['customerid']));
|
||||
GROUP BY `d`.`id`, `d`.`domain`
|
||||
ORDER BY `d`.`domain` ASC");
|
||||
Database::pexecute($domains_stmt, array(
|
||||
"id" => $result['id'],
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
|
||||
while ($row_domain = $domains_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id'], $result['aliasdomain']);
|
||||
$domains .= \Froxlor\UI\HTML::makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id'], $result['aliasdomain']);
|
||||
}
|
||||
|
||||
if (preg_match('/^https?\:\/\//', $result['documentroot']) && validateUrl($idna_convert->encode($result['documentroot']))) {
|
||||
if (preg_match('/^https?\:\/\//', $result['documentroot']) && \Froxlor\Validate\Form\Data::validateUrl($result['documentroot'])) {
|
||||
if (Settings::Get('panel.pathedit') == 'Dropdown') {
|
||||
$urlvalue = $result['documentroot'];
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
} else {
|
||||
$urlvalue = '';
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $result['documentroot'], true);
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $result['documentroot'], true);
|
||||
}
|
||||
} else {
|
||||
$urlvalue = '';
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $result['documentroot']);
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $result['documentroot']);
|
||||
}
|
||||
|
||||
$redirectcode = '';
|
||||
if (Settings::Get('customredirect.enabled') == '1') {
|
||||
$def_code = getDomainRedirectId($id);
|
||||
$codes = getRedirectCodesArray();
|
||||
$def_code = \Froxlor\Domain\Domain::getDomainRedirectId($id);
|
||||
$codes = \Froxlor\Domain\Domain::getRedirectCodesArray();
|
||||
foreach ($codes as $rc) {
|
||||
$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $def_code);
|
||||
$redirectcode .= \Froxlor\UI\HTML::makeoption($rc['code'] . ' (' . $lng['redirect_desc'][$rc['desc']] . ')', $rc['id'], $def_code);
|
||||
}
|
||||
}
|
||||
|
||||
// check if we at least have one ssl-ip/port, #1179
|
||||
$ssl_ipsandports = '';
|
||||
$ssl_ip_stmt = Database::prepare("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
|
||||
Database::pexecute($ssl_ip_stmt);
|
||||
$ssl_ip_stmt = Database::prepare("
|
||||
SELECT COUNT(*) as countSSL
|
||||
FROM `" . TABLE_PANEL_IPSANDPORTS . "` pip
|
||||
LEFT JOIN `" . TABLE_DOMAINTOIP . "` dti ON dti.id_ipandports = pip.id
|
||||
WHERE `dti`.`id_domain` = :id_domain AND pip.`ssl`='1'
|
||||
");
|
||||
Database::pexecute($ssl_ip_stmt, array(
|
||||
"id_domain" => $result['id']
|
||||
));
|
||||
$resultX = $ssl_ip_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
if (isset($resultX['countSSL']) && (int) $resultX['countSSL'] > 0) {
|
||||
$ssl_ipsandports = 'notempty';
|
||||
}
|
||||
|
||||
$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
|
||||
// Fudge the result for ssl_redirect to hide the Let's Encrypt steps
|
||||
$result['temporary_ssl_redirect'] = $result['ssl_redirect'];
|
||||
$result['ssl_redirect'] = ($result['ssl_redirect'] == 0 ? 0 : 1);
|
||||
|
||||
$openbasedir = \Froxlor\UI\HTML::makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . \Froxlor\UI\HTML::makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
|
||||
|
||||
// create serveralias options
|
||||
$serveraliasoptions = "";
|
||||
@@ -671,131 +421,88 @@ if ($page == 'overview') {
|
||||
} elseif ($result['wwwserveralias'] == '1') {
|
||||
$_value = '1';
|
||||
}
|
||||
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_wildcard'], '0', $_value, true, true);
|
||||
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_www'], '1', $_value, true, true);
|
||||
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_none'], '2', $_value, true, true);
|
||||
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_wildcard'], '0', $_value, true, true);
|
||||
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_www'], '1', $_value, true, true);
|
||||
$serveraliasoptions .= \Froxlor\UI\HTML::makeoption($lng['domains']['serveraliasoption_none'], '2', $_value, true, true);
|
||||
|
||||
$ips_stmt = Database::prepare("SELECT `p`.`ip` AS `ip` FROM `" . TABLE_PANEL_IPSANDPORTS . "` `p`
|
||||
LEFT JOIN `" . TABLE_DOMAINTOIP . "` `dip`
|
||||
ON ( `dip`.`id_ipandports` = `p`.`id` )
|
||||
WHERE `dip`.`id_domain` = :id_domain
|
||||
GROUP BY `p`.`ip`"
|
||||
);
|
||||
Database::pexecute($ips_stmt, array("id_domain" => $result['id']));
|
||||
GROUP BY `p`.`ip`");
|
||||
Database::pexecute($ips_stmt, array(
|
||||
"id_domain" => $result['id']
|
||||
));
|
||||
$result_ipandport['ip'] = '';
|
||||
while ($rowip = $ips_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$result_ipandport['ip'] .= $rowip['ip'] . "<br />";
|
||||
}
|
||||
|
||||
$phpconfigs = '';
|
||||
$has_phpconfigs = false;
|
||||
if (isset($userinfo['allowed_phpconfigs']) && ! empty($userinfo['allowed_phpconfigs'])) {
|
||||
$has_phpconfigs = true;
|
||||
$allowed_cfg = json_decode($userinfo['allowed_phpconfigs'], JSON_OBJECT_AS_ARRAY);
|
||||
$phpconfigs_result_stmt = Database::query("
|
||||
SELECT c.*, fc.description as interpreter
|
||||
FROM `" . TABLE_PANEL_PHPCONFIGS . "` c
|
||||
LEFT JOIN `" . TABLE_PANEL_FPMDAEMONS . "` fc ON fc.id = c.fpmsettingid
|
||||
WHERE c.id IN (" . implode(", ", $allowed_cfg) . ")
|
||||
");
|
||||
while ($phpconfigs_row = $phpconfigs_result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ((int) Settings::Get('phpfpm.enabled') == 1) {
|
||||
$phpconfigs .= \Froxlor\UI\HTML::makeoption($phpconfigs_row['description'] . " [" . $phpconfigs_row['interpreter'] . "]", $phpconfigs_row['id'], $result['phpsettingid'], true, true);
|
||||
} else {
|
||||
$phpconfigs .= \Froxlor\UI\HTML::makeoption($phpconfigs_row['description'], $phpconfigs_row['id'], $result['phpsettingid'], true, true);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
$alias_stmt = Database::prepare("SELECT COUNT(`id`) AS count FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `aliasdomain`= :aliasdomain");
|
||||
$alias_check = Database::pexecute_first($alias_stmt, array("aliasdomain" => $result['id']));
|
||||
$alias_check = $alias_check['count'];
|
||||
|
||||
$domainip = $result_ipandport['ip'];
|
||||
$result = htmlentities_array($result);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
|
||||
$subdomain_edit_data = include_once dirname(__FILE__) . '/lib/formfields/customer/domains/formfield.domains_edit.php';
|
||||
$subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data);
|
||||
$subdomain_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($subdomain_edit_data);
|
||||
|
||||
$title = $subdomain_edit_data['domain_edit']['title'];
|
||||
$image = $subdomain_edit_data['domain_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("domains/domains_edit") . "\";");
|
||||
}
|
||||
} else {
|
||||
standard_error('domains_canteditdomain');
|
||||
\Froxlor\UI\Response::standard_error('domains_canteditdomain');
|
||||
}
|
||||
}
|
||||
} elseif ($page == 'domainssleditor') {
|
||||
|
||||
if ($action == '' || $action == 'view') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
|
||||
$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
|
||||
$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
|
||||
$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
|
||||
$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
|
||||
$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
|
||||
|
||||
if ($ssl_cert_file != '' && $ssl_key_file == '') {
|
||||
standard_error('sslcertificateismissingprivatekey');
|
||||
}
|
||||
|
||||
$do_verify = true;
|
||||
|
||||
// no cert-file given -> forget everything
|
||||
if ($ssl_cert_file == '') {
|
||||
$ssl_key_file = '';
|
||||
$ssl_ca_file = '';
|
||||
$ssl_cert_chainfile = '';
|
||||
$do_verify = false;
|
||||
}
|
||||
|
||||
// verify certificate content
|
||||
if ($do_verify) {
|
||||
// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
|
||||
// openssl_x509_parse() returns information about the supplied x509cert, including fields such as
|
||||
// subject name, issuer name, purposes, valid from and valid to dates etc.
|
||||
$cert_content = openssl_x509_parse($ssl_cert_file);
|
||||
|
||||
if (is_array($cert_content) && isset($cert_content['subject']) && isset($cert_content['subject']['CN'])) {
|
||||
// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
|
||||
// Checks whether the given key is the private key that corresponds to cert.
|
||||
if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
|
||||
standard_error('sslcertificateinvalidcertkeypair');
|
||||
}
|
||||
|
||||
// check optional stuff
|
||||
if ($ssl_ca_file != '') {
|
||||
$ca_content = openssl_x509_parse($ssl_ca_file);
|
||||
if (!is_array($ca_content)) {
|
||||
// invalid
|
||||
standard_error('sslcertificateinvalidca');
|
||||
}
|
||||
}
|
||||
if ($ssl_cert_chainfile != '') {
|
||||
$chain_content = openssl_x509_parse($ssl_cert_chainfile);
|
||||
if (!is_array($chain_content)) {
|
||||
// invalid
|
||||
standard_error('sslcertificateinvalidchain');
|
||||
}
|
||||
}
|
||||
} else {
|
||||
standard_error('sslcertificateinvalidcert');
|
||||
}
|
||||
}
|
||||
|
||||
// Add/Update database entry
|
||||
$qrystart = "UPDATE ";
|
||||
$qrywhere = "WHERE ";
|
||||
try {
|
||||
if ($do_insert) {
|
||||
$qrystart = "INSERT INTO ";
|
||||
$qrywhere = ", ";
|
||||
Certificates::getLocal($userinfo, $_POST)->add();
|
||||
} else {
|
||||
Certificates::getLocal($userinfo, $_POST)->update();
|
||||
}
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$stmt = Database::prepare($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
|
||||
`ssl_cert_file` = :ssl_cert_file,
|
||||
`ssl_key_file` = :ssl_key_file,
|
||||
`ssl_ca_file` = :ssl_ca_file,
|
||||
`ssl_cert_chainfile` = :ssl_cert_chainfile
|
||||
".$qrywhere." `domainid`= :domainid"
|
||||
);
|
||||
$params = array(
|
||||
"ssl_cert_file" => $ssl_cert_file,
|
||||
"ssl_key_file" => $ssl_key_file,
|
||||
"ssl_ca_file" => $ssl_ca_file,
|
||||
"ssl_cert_chainfile" => $ssl_cert_chainfile,
|
||||
"domainid" => $id
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
// insert task to re-generate webserver-configs (#1260)
|
||||
inserttask('1');
|
||||
|
||||
// back to domain overview
|
||||
redirectTo($filename, array('page' => 'domains', 's' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => 'domains',
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
|
||||
$stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAIN_SSL_SETTINGS . "`
|
||||
WHERE `domainid`= :domainid"
|
||||
);
|
||||
Database::pexecute($stmt, array("domainid" => $id));
|
||||
$result = $stmt->fetch(PDO::FETCH_ASSOC);
|
||||
WHERE `domainid`= :domainid");
|
||||
$result = Database::pexecute_first($stmt, array(
|
||||
"domainid" => $id
|
||||
));
|
||||
|
||||
$do_insert = false;
|
||||
// if no entry can be found, behave like we have empty values
|
||||
@@ -809,14 +516,23 @@ if ($page == 'overview') {
|
||||
$do_insert = true;
|
||||
}
|
||||
|
||||
$result = htmlentities_array($result);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
|
||||
$ssleditor_data = include_once dirname(__FILE__) . '/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
|
||||
$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
|
||||
$ssleditor_form = \Froxlor\UI\HtmlForm::genHTMLForm($ssleditor_data);
|
||||
|
||||
$title = $ssleditor_data['domain_ssleditor']['title'];
|
||||
$image = $ssleditor_data['domain_ssleditor']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("domains/domain_ssleditor") . "\";");
|
||||
}
|
||||
} elseif ($page == 'domaindnseditor' && $userinfo['dnsenabled'] == '1' && Settings::Get('system.dnsenabled') == '1') {
|
||||
|
||||
require_once __DIR__ . '/dns_editor.php';
|
||||
} elseif ($page == 'sslcertificates') {
|
||||
|
||||
require_once __DIR__ . '/ssl_certificates.php';
|
||||
} elseif ($page == 'logfiles') {
|
||||
|
||||
require_once __DIR__ . '/logfiles_viewer.php';
|
||||
}
|
||||
|
||||
@@ -16,10 +16,20 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'customer');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\DirOptions as DirOptions;
|
||||
use Froxlor\Api\Commands\DirProtections as DirProtections;
|
||||
use Froxlor\Api\Commands\CustomerBackups as CustomerBackups;
|
||||
|
||||
// redirect if this customer page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'extras')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
} elseif (isset($_GET['id'])) {
|
||||
@@ -27,20 +37,27 @@ if (isset($_POST['id'])) {
|
||||
}
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras");
|
||||
eval("echo \"" . getTemplate("extras/extras") . "\";");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_extras");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/extras") . "\";");
|
||||
} elseif ($page == 'htpasswds') {
|
||||
|
||||
// redirect if this customer sub-page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'extras.directoryprotection')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
if ($action == '') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras::htpasswds");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_extras::htpasswds");
|
||||
$fields = array(
|
||||
'username' => $lng['login']['username'],
|
||||
'path' => $lng['panel']['path']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_HTPASSWDS, $fields);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_HTPASSWDS, $fields);
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "`
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid']));
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
$paging->setEntries(Database::num_rows());
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
@@ -53,195 +70,120 @@ if ($page == 'overview') {
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
if (strpos($row['path'], $userinfo['documentroot']) === 0) {
|
||||
$row['path'] = substr($row['path'], strlen($userinfo['documentroot']));
|
||||
$row['path'] = str_replace($userinfo['documentroot'], "/", $row['path']);
|
||||
}
|
||||
|
||||
$row = htmlentities_array($row);
|
||||
eval("\$htpasswds.=\"" . getTemplate("extras/htpasswds_htpasswd") . "\";");
|
||||
$row['path'] = \Froxlor\FileDir::makeCorrectDir($row['path']);
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
eval("\$htpasswds.=\"" . \Froxlor\UI\Template::getTemplate("extras/htpasswds_htpasswd") . "\";");
|
||||
$count ++;
|
||||
}
|
||||
|
||||
$i ++;
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("extras/htpasswds") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/htpasswds") . "\";");
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "`
|
||||
WHERE `customerid`= :customerid
|
||||
AND `id`= :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = DirProtections::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['username']) && $result['username'] != '') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_HTPASSWDS . "`
|
||||
WHERE `customerid`= :customerid
|
||||
AND `id`= :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "deleted htpasswd for '" . $result['username'] . " (" . $result['path'] . ")'");
|
||||
inserttask('1');
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
try {
|
||||
DirProtections::getLocal($userinfo, $_POST)->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
if (strpos($result['path'], $userinfo['documentroot']) === 0) {
|
||||
$result['path'] = substr($result['path'], strlen($userinfo['documentroot']));
|
||||
$result['path'] = str_replace($userinfo['documentroot'], "/", $result['path']);
|
||||
}
|
||||
|
||||
ask_yesno('extras_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username'] . ' (' . $result['path'] . ')');
|
||||
\Froxlor\UI\HTML::askYesNo('extras_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['username'] . ' (' . $result['path'] . ')');
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'add') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$path = makeCorrectDir(validate($_POST['path'], 'path'));
|
||||
$userpath = $path;
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
||||
$username = validate($_POST['username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
|
||||
$authname = validate($_POST['directory_authname'], 'directory_authname', '/^[a-zA-Z0-9][a-zA-Z0-9\-_ ]+\$?$/');
|
||||
validate($_POST['directory_password'], 'password');
|
||||
|
||||
$username_path_check_stmt = Database::prepare("SELECT `id`, `username`, `path` FROM `" . TABLE_PANEL_HTPASSWDS . "`
|
||||
WHERE `username`= :username
|
||||
AND `path`= :path
|
||||
AND `customerid`= :customerid"
|
||||
);
|
||||
$params = array(
|
||||
"username" => $username,
|
||||
"path" => $path,
|
||||
"customerid" => $userinfo['customerid']
|
||||
);
|
||||
Database::pexecute($username_path_check_stmt, $params);
|
||||
$username_path_check = $username_path_check_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if (CRYPT_STD_DES == 1) {
|
||||
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
|
||||
$password = crypt($_POST['directory_password'], $saltfordescrypt);
|
||||
} else {
|
||||
$password = crypt($_POST['directory_password']);
|
||||
try {
|
||||
DirProtections::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
if (!$_POST['path']) {
|
||||
standard_error('invalidpath');
|
||||
}
|
||||
|
||||
if ($username == '') {
|
||||
standard_error(array('stringisempty', 'myloginname'));
|
||||
} elseif ($username_path_check['username'] == $username && $username_path_check['path'] == $path) {
|
||||
standard_error('userpathcombinationdupe');
|
||||
} elseif ($_POST['directory_password'] == '') {
|
||||
standard_error(array('stringisempty', 'mypassword'));
|
||||
} elseif ($path == '') {
|
||||
standard_error('patherror');
|
||||
} elseif ($_POST['directory_password'] == $username) {
|
||||
standard_error('passwordshouldnotbeusername');
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_HTPASSWDS . "` SET
|
||||
`customerid` = :customerid,
|
||||
`username` = :username,
|
||||
`password` = :password,
|
||||
`path` = :path,
|
||||
`authname` = :authname"
|
||||
);
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"username" => $username,
|
||||
"password" => $password,
|
||||
"path" => $path,
|
||||
"authname" => $authname
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "added htpasswd for '" . $username . " (" . $path . ")'");
|
||||
inserttask('1');
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
|
||||
$htpasswd_add_data = include_once dirname(__FILE__) . '/lib/formfields/customer/extras/formfield.htpasswd_add.php';
|
||||
$htpasswd_add_form = htmlform::genHTMLForm($htpasswd_add_data);
|
||||
$htpasswd_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($htpasswd_add_data);
|
||||
|
||||
$title = $htpasswd_add_data['htpasswd_add']['title'];
|
||||
$image = $htpasswd_add_data['htpasswd_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("extras/htpasswds_add") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/htpasswds_add") . "\";");
|
||||
}
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_HTPASSWDS . "`
|
||||
WHERE `customerid`= :customerid
|
||||
AND `id`= :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = DirProtections::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['username']) && $result['username'] != '') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
validate($_POST['directory_password'], 'password');
|
||||
$authname = validate($_POST['directory_authname'], 'directory_authname', '/^[a-zA-Z0-9][a-zA-Z0-9\-_ ]+\$?$/');
|
||||
|
||||
if (CRYPT_STD_DES == 1) {
|
||||
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
|
||||
$password = crypt($_POST['directory_password'], $saltfordescrypt);
|
||||
} else {
|
||||
$password = crypt($_POST['directory_password']);
|
||||
}
|
||||
|
||||
if ($_POST['directory_password'] == $result['username']) {
|
||||
standard_error('passwordshouldnotbeusername');
|
||||
}
|
||||
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"id" => $id
|
||||
);
|
||||
|
||||
$pwd_sql = '';
|
||||
if ($_POST['directory_password'] != '') {
|
||||
$pwd_sql = "`password`= :password ";
|
||||
$params["password"] = $password;
|
||||
}
|
||||
|
||||
$auth_sql = '';
|
||||
if ($authname != $result['authname']) {
|
||||
$auth_sql = "`authname`= :authname ";
|
||||
$params["authname"] = $authname;
|
||||
}
|
||||
|
||||
if ($pwd_sql != '' || $auth_sql != '') {
|
||||
if ($pwd_sql !='' && $auth_sql != '') {
|
||||
$pwd_sql.= ', ';
|
||||
}
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_HTPASSWDS . "`
|
||||
SET ".$pwd_sql.$auth_sql."
|
||||
WHERE `customerid`= :customerid
|
||||
AND `id`= :id"
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "edited htpasswd for '" . $result['username'] . " (" . $result['path'] . ")'");
|
||||
inserttask('1');
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
try {
|
||||
DirProtections::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
if (strpos($result['path'], $userinfo['documentroot']) === 0) {
|
||||
$result['path'] = substr($result['path'], strlen($userinfo['documentroot']));
|
||||
$result['path'] = str_replace($userinfo['documentroot'], "/", $result['path']);
|
||||
}
|
||||
|
||||
$result = htmlentities_array($result);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
|
||||
$htpasswd_edit_data = include_once dirname(__FILE__) . '/lib/formfields/customer/extras/formfield.htpasswd_edit.php';
|
||||
$htpasswd_edit_form = htmlform::genHTMLForm($htpasswd_edit_data);
|
||||
$htpasswd_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($htpasswd_edit_data);
|
||||
|
||||
$title = $htpasswd_edit_data['htpasswd_edit']['title'];
|
||||
$image = $htpasswd_edit_data['htpasswd_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("extras/htpasswds_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/htpasswds_edit") . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
} elseif ($page == 'htaccess') {
|
||||
|
||||
// redirect if this customer sub-page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'extras.pathoptions')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
if ($action == '') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_extras::htaccess");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_extras::htaccess");
|
||||
$fields = array(
|
||||
'path' => $lng['panel']['path'],
|
||||
'options_indexes' => $lng['extras']['view_directory'],
|
||||
@@ -250,11 +192,12 @@ if ($page == 'overview') {
|
||||
'error500path' => $lng['extras']['error500path'],
|
||||
'options_cgi' => $lng['extras']['execute_perl']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_HTACCESS, $fields);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_HTACCESS, $fields);
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_HTACCESS . "`
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid']));
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
$paging->setEntries(Database::num_rows());
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
@@ -264,209 +207,194 @@ if ($page == 'overview') {
|
||||
$count = 0;
|
||||
$htaccess = '';
|
||||
|
||||
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
|
||||
$cperlenabled = \Froxlor\Customer\Customer::customerHasPerlEnabled($userinfo['customerid']);
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
if (strpos($row['path'], $userinfo['documentroot']) === 0) {
|
||||
$row['path'] = substr($row['path'], strlen($userinfo['documentroot']));
|
||||
// don't show nothing wehn it's the docroot, show slash
|
||||
if ($row['path'] == '') { $row['path'] = '/'; }
|
||||
$row['path'] = str_replace($userinfo['documentroot'], "/", $row['path']);
|
||||
}
|
||||
|
||||
$row['path'] = \Froxlor\FileDir::makeCorrectDir($row['path']);
|
||||
$row['options_indexes'] = str_replace('1', $lng['panel']['yes'], $row['options_indexes']);
|
||||
$row['options_indexes'] = str_replace('0', $lng['panel']['no'], $row['options_indexes']);
|
||||
$row['options_cgi'] = str_replace('1', $lng['panel']['yes'], $row['options_cgi']);
|
||||
$row['options_cgi'] = str_replace('0', $lng['panel']['no'], $row['options_cgi']);
|
||||
$row = htmlentities_array($row);
|
||||
eval("\$htaccess.=\"" . getTemplate("extras/htaccess_htaccess") . "\";");
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
eval("\$htaccess.=\"" . \Froxlor\UI\Template::getTemplate("extras/htaccess_htaccess") . "\";");
|
||||
$count ++;
|
||||
}
|
||||
|
||||
$i ++;
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate("extras/htaccess") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/htaccess") . "\";");
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_HTACCESS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = DirOptions::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['customerid']) && $result['customerid'] != '' && $result['customerid'] == $userinfo['customerid']) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_HTACCESS . "`
|
||||
WHERE `customerid`= :customerid
|
||||
AND `id`= :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "deleted htaccess for '" . str_replace($userinfo['documentroot'], '', $result['path']) . "'");
|
||||
inserttask('1');
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
try {
|
||||
DirOptions::getLocal($userinfo, $_POST)->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno('extras_reallydelete_pathoptions', $filename, array('id' => $id, 'page' => $page, 'action' => $action), str_replace($userinfo['documentroot'], '', $result['path']));
|
||||
\Froxlor\UI\HTML::askYesNo('extras_reallydelete_pathoptions', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), str_replace($userinfo['documentroot'], '/', $result['path']));
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'add') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$path = makeCorrectDir(validate($_POST['path'], 'path'));
|
||||
$userpath = $path;
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
||||
$path_dupe_check_stmt = Database::prepare("SELECT `id`, `path` FROM `" . TABLE_PANEL_HTACCESS . "`
|
||||
WHERE `path`= :path
|
||||
AND `customerid`= :customerid"
|
||||
);
|
||||
Database::pexecute($path_dupe_check_stmt, array("path" => $path, "customerid" => $userinfo['customerid']));
|
||||
$path_dupe_check = $path_dupe_check_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if (!$_POST['path']) {
|
||||
standard_error('invalidpath');
|
||||
try {
|
||||
DirOptions::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
if (isset($_POST['options_cgi']) && (int)$_POST['options_cgi'] != 0) {
|
||||
$options_cgi = '1';
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$options_cgi = '0';
|
||||
}
|
||||
|
||||
$error404path = '';
|
||||
if (isset($_POST['error404path'])) {
|
||||
$error404path = correctErrorDocument($_POST['error404path']);
|
||||
}
|
||||
|
||||
$error403path = '';
|
||||
if (isset($_POST['error403path'])) {
|
||||
$error403path = correctErrorDocument($_POST['error403path']);
|
||||
}
|
||||
|
||||
$error500path = '';
|
||||
if (isset($_POST['error500path'])) {
|
||||
$error500path = correctErrorDocument($_POST['error500path']);
|
||||
}
|
||||
|
||||
if ($path_dupe_check['path'] == $path) {
|
||||
standard_error('errordocpathdupe', $userpath);
|
||||
} elseif ($path == '') {
|
||||
standard_error('patherror');
|
||||
} else {
|
||||
$stmt = Database::prepare('INSERT INTO `' . TABLE_PANEL_HTACCESS . '` SET
|
||||
`customerid` = :customerid,
|
||||
`path` = :path,
|
||||
`options_indexes` = :options_indexes,
|
||||
`error404path` = :error404path,
|
||||
`error403path` = :error403path,
|
||||
`error500path` = :error500path,
|
||||
`options_cgi` = :options_cgi'
|
||||
);
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"path" => $path,
|
||||
"options_indexes" => $_POST['options_indexes'] == '1' ? '1' : '0',
|
||||
"error403path" => $error403path,
|
||||
"error404path" => $error404path,
|
||||
"error500path" => $error500path,
|
||||
"options_cgi" => $options_cgi
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "added htaccess for '" . $path . "'");
|
||||
inserttask('1');
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
$cperlenabled = \Froxlor\Customer\Customer::customerHasPerlEnabled($userinfo['customerid']);
|
||||
|
||||
$htaccess_add_data = include_once dirname(__FILE__) . '/lib/formfields/customer/extras/formfield.htaccess_add.php';
|
||||
$htaccess_add_form = htmlform::genHTMLForm($htaccess_add_data);
|
||||
$htaccess_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($htaccess_add_data);
|
||||
|
||||
$title = $htaccess_add_data['htaccess_add']['title'];
|
||||
$image = $htaccess_add_data['htaccess_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("extras/htaccess_add") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/htaccess_add") . "\";");
|
||||
}
|
||||
} elseif (($action == 'edit') && ($id != 0)) {
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_HTACCESS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = DirOptions::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if ((isset($result['customerid'])) && ($result['customerid'] != '') && ($result['customerid'] == $userinfo['customerid'])) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$option_indexes = intval($_POST['options_indexes']);
|
||||
$options_cgi = isset($_POST['options_cgi']) ? intval($_POST['options_cgi']) : 0;
|
||||
|
||||
if ($option_indexes != '1') {
|
||||
$option_indexes = '0';
|
||||
try {
|
||||
DirOptions::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
if ($options_cgi != '1') {
|
||||
$options_cgi = '0';
|
||||
}
|
||||
|
||||
$error404path = correctErrorDocument($_POST['error404path']);
|
||||
$error403path = correctErrorDocument($_POST['error403path']);
|
||||
$error500path = correctErrorDocument($_POST['error500path']);
|
||||
|
||||
if (($option_indexes != $result['options_indexes'])
|
||||
|| ($error404path != $result['error404path'])
|
||||
|| ($error403path != $result['error403path'])
|
||||
|| ($error500path != $result['error500path'])
|
||||
|| ($options_cgi != $result['options_cgi'])
|
||||
) {
|
||||
inserttask('1');
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_HTACCESS . "`
|
||||
SET `options_indexes` = :options_indexes,
|
||||
`error404path` = :error404path,
|
||||
`error403path` = :error403path,
|
||||
`error500path` = :error500path,
|
||||
`options_cgi` = :options_cgi
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"options_indexes" => $_POST['options_indexes'] == '1' ? '1' : '0',
|
||||
"error403path" => $error403path,
|
||||
"error404path" => $error404path,
|
||||
"error500path" => $error500path,
|
||||
"options_cgi" => $options_cgi,
|
||||
"id" => $id
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "edited htaccess for '" . str_replace($userinfo['documentroot'], '', $result['path']) . "'");
|
||||
}
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
if (strpos($result['path'], $userinfo['documentroot']) === 0) {
|
||||
$result['path'] = substr($result['path'], strlen($userinfo['documentroot']));
|
||||
// don't show nothing wehn it's the docroot, show slash
|
||||
if ($result['path'] == '') { $result['path'] = '/'; }
|
||||
$result['path'] = str_replace($userinfo['documentroot'], "/", $result['path']);
|
||||
}
|
||||
|
||||
$result['error404path'] = $result['error404path'];
|
||||
$result['error403path'] = $result['error403path'];
|
||||
$result['error500path'] = $result['error500path'];
|
||||
$cperlenabled = customerHasPerlEnabled($userinfo['customerid']);
|
||||
$cperlenabled = \Froxlor\Customer\Customer::customerHasPerlEnabled($userinfo['customerid']);
|
||||
/*
|
||||
$options_indexes = makeyesno('options_indexes', '1', '0', $result['options_indexes']);
|
||||
$options_cgi = makeyesno('options_cgi', '1', '0', $result['options_cgi']);
|
||||
* $options_indexes = \Froxlor\UI\HTML::makeyesno('options_indexes', '1', '0', $result['options_indexes']);
|
||||
* $options_cgi = \Froxlor\UI\HTML::makeyesno('options_cgi', '1', '0', $result['options_cgi']);
|
||||
*/
|
||||
$result = htmlentities_array($result);
|
||||
$result = \Froxlor\PhpHelper::htmlentitiesArray($result);
|
||||
|
||||
$htaccess_edit_data = include_once dirname(__FILE__) . '/lib/formfields/customer/extras/formfield.htaccess_edit.php';
|
||||
$htaccess_edit_form = htmlform::genHTMLForm($htaccess_edit_data);
|
||||
$htaccess_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($htaccess_edit_data);
|
||||
|
||||
$title = $htaccess_edit_data['htaccess_edit']['title'];
|
||||
$image = $htaccess_edit_data['htaccess_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("extras/htaccess_edit") . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/htaccess_edit") . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
} elseif ($page == 'backup') {
|
||||
|
||||
// redirect if this customer sub-page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'extras.backup')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
if (Settings::Get('system.backupenabled') == 1) {
|
||||
if ($action == 'abort' && isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "customer_extras::backup - aborted scheduled backupjob");
|
||||
try {
|
||||
CustomerBackups::getLocal($userinfo, $_POST)->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::standard_success('backupaborted');
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
'action' => '',
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
if ($action == '') {
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_extras::backup");
|
||||
|
||||
// check whether there is a backup-job for this customer
|
||||
try {
|
||||
$json_result = CustomerBackups::getLocal($userinfo)->listing();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
$existing_backupJob = null;
|
||||
if ($result['count'] > 0) {
|
||||
$existing_backupJob = array_shift($result['list']);
|
||||
}
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
CustomerBackups::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::standard_success('backupscheduled');
|
||||
} else {
|
||||
|
||||
if (! empty($existing_backupJob)) {
|
||||
$action = "abort";
|
||||
$row = $existing_backupJob['data'];
|
||||
|
||||
$row['path'] = \Froxlor\FileDir::makeCorrectDir(str_replace($userinfo['documentroot'], "/", $row['destdir']));
|
||||
$row['backup_web'] = ($row['backup_web'] == '1') ? $lng['panel']['yes'] : $lng['panel']['no'];
|
||||
$row['backup_mail'] = ($row['backup_mail'] == '1') ? $lng['panel']['yes'] : $lng['panel']['no'];
|
||||
$row['backup_dbs'] = ($row['backup_dbs'] == '1') ? $lng['panel']['yes'] : $lng['panel']['no'];
|
||||
}
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid']);
|
||||
$backup_data = include_once dirname(__FILE__) . '/lib/formfields/customer/extras/formfield.backup.php';
|
||||
$backup_form = \Froxlor\UI\HtmlForm::genHTMLForm($backup_data);
|
||||
$title = $backup_data['backup']['title'];
|
||||
$image = $backup_data['backup']['image'];
|
||||
|
||||
if (! empty($existing_backupJob)) {
|
||||
// overwrite backup_form after we took everything from it we needed
|
||||
eval("\$backup_form = \"" . \Froxlor\UI\Template::getTemplate("extras/backup_listexisting") . "\";");
|
||||
}
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("extras/backup") . "\";");
|
||||
}
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::standard_error('backupfunctionnotenabled');
|
||||
}
|
||||
}
|
||||
|
||||
429
customer_ftp.php
@@ -16,10 +16,18 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'customer');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\Ftps as Ftps;
|
||||
|
||||
// redirect if this customer page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'ftp')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
$id = 0;
|
||||
if (isset($_POST['id'])) {
|
||||
$id = intval($_POST['id']);
|
||||
@@ -28,22 +36,23 @@ if (isset($_POST['id'])) {
|
||||
}
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
|
||||
eval("echo \"" . getTemplate('ftp/ftp') . "\";");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_ftp");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('ftp/ftp') . "\";");
|
||||
} elseif ($page == 'accounts') {
|
||||
if ($action == '') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_ftp::accounts");
|
||||
$fields = array(
|
||||
'username' => $lng['login']['username'],
|
||||
'homedir' => $lng['panel']['path'],
|
||||
'description' => $lng['panel']['ftpdesc']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_FTP_USERS, $fields);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_FTP_USERS, $fields);
|
||||
|
||||
$result_stmt = Database::prepare("SELECT `id`, `username`, `description`, `homedir` FROM `" . TABLE_FTP_USERS . "`
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid']));
|
||||
$result_stmt = Database::prepare("SELECT `id`, `username`, `description`, `homedir`, `shell` FROM `" . TABLE_FTP_USERS . "`
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
$ftps_count = Database::num_rows();
|
||||
$paging->setEntries($ftps_count);
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
@@ -57,264 +66,77 @@ if ($page == 'overview') {
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
if (strpos($row['homedir'], $userinfo['documentroot']) === 0) {
|
||||
$row['documentroot'] = substr($row['homedir'], strlen($userinfo['documentroot']));
|
||||
$row['documentroot'] = str_replace($userinfo['documentroot'], "/", $row['homedir']);
|
||||
} else {
|
||||
$row['documentroot'] = $row['homedir'];
|
||||
}
|
||||
|
||||
$row['documentroot'] = makeCorrectDir($row['documentroot']);
|
||||
$row['documentroot'] = \Froxlor\FileDir::makeCorrectDir($row['documentroot']);
|
||||
|
||||
$row = htmlentities_array($row);
|
||||
eval("\$accounts.=\"" . getTemplate('ftp/accounts_account') . "\";");
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
eval("\$accounts.=\"" . \Froxlor\UI\Template::getTemplate('ftp/accounts_account') . "\";");
|
||||
$count ++;
|
||||
}
|
||||
|
||||
$i ++;
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('ftp/accounts') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('ftp/accounts') . "\";");
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
$result_stmt = Database::prepare("SELECT `id`, `username`, `homedir`, `up_count`, `up_bytes`, `down_count`, `down_bytes` FROM `" . TABLE_FTP_USERS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = Ftps::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['username']) && $result['username'] != $userinfo['loginname']) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_FTP_USERS . "`
|
||||
SET `up_count` = `up_count` + :up_count,
|
||||
`up_bytes` = `up_bytes` + :up_bytes,
|
||||
`down_count` = `down_count` + :down_count,
|
||||
`down_bytes` = `down_bytes` + :down_bytes
|
||||
WHERE `username` = :username"
|
||||
);
|
||||
$params = array(
|
||||
"up_count" => $result['up_count'],
|
||||
"up_bytes" => $result['up_bytes'],
|
||||
"down_count" => $result['down_count'],
|
||||
"down_bytes" => $result['down_bytes'],
|
||||
"username" => $userinfo['loginname']
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$result_stmt = Database::prepare("SELECT `username`, `homedir` FROM `" . TABLE_FTP_USERS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_FTP_QUOTATALLIES . "` WHERE `name` = :name");
|
||||
Database::pexecute($stmt, array("name" => $result['username']));
|
||||
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_FTP_USERS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
|
||||
$stmt = Database::prepare("
|
||||
UPDATE `" . TABLE_FTP_GROUPS . "` SET
|
||||
`members` = REPLACE(`members`, :username,'')
|
||||
WHERE `customerid` = :customerid
|
||||
");
|
||||
Database::pexecute($stmt, array("username" => ",".$result['username'], "customerid" => $userinfo['customerid']));
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "deleted ftp-account '" . $result['username'] . "'");
|
||||
|
||||
$resetaccnumber = ($userinfo['ftps_used'] == '1') ? " , `ftp_lastaccountnumber`='0'" : '';
|
||||
|
||||
// refs #293
|
||||
if (isset($_POST['delete_userfiles']) && (int)$_POST['delete_userfiles'] == 1) {
|
||||
inserttask('8', $userinfo['loginname'], $result['homedir']);
|
||||
try {
|
||||
Ftps::getLocal($userinfo, $_POST)->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `ftps_used` = `ftps_used` - 1 $resetaccnumber
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
ask_yesno_withcheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $result['username']);
|
||||
\Froxlor\UI\HTML::askYesNoWithCheckbox('ftp_reallydelete', 'admin_customer_alsoremoveftphomedir', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $result['username']);
|
||||
}
|
||||
} else {
|
||||
standard_error('ftp_cantdeletemainaccount');
|
||||
\Froxlor\UI\Response::standard_error('ftp_cantdeletemainaccount');
|
||||
}
|
||||
} elseif ($action == 'add') {
|
||||
if ($userinfo['ftps_used'] < $userinfo['ftps'] || $userinfo['ftps'] == '-1') {
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send') {
|
||||
$description = validate($_POST['ftp_description'], 'description');
|
||||
// @FIXME use a good path-validating regex here (refs #1231)
|
||||
$path = validate($_POST['path'], 'path');
|
||||
$password = validate($_POST['ftp_password'], 'password');
|
||||
$password = validatePassword($password);
|
||||
|
||||
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
|
||||
if ($sendinfomail != 1) {
|
||||
$sendinfomail = 0;
|
||||
}
|
||||
|
||||
if (Settings::Get('customer.ftpatdomain') == '1') {
|
||||
$ftpusername = validate($_POST['ftp_username'], 'username', '/^[a-zA-Z0-9][a-zA-Z0-9\-_]+\$?$/');
|
||||
if ($ftpusername == '') {
|
||||
standard_error(array('stringisempty', 'username'));
|
||||
}
|
||||
$ftpdomain = $idna_convert->encode(validate($_POST['ftp_domain'], 'domain'));
|
||||
$ftpdomain_check_stmt = Database::prepare("SELECT `id`, `domain`, `customerid` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `domain` = :domain
|
||||
AND `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($ftpdomain_check_stmt, array("domain" => $ftpdomain, "customerid" => $userinfo['customerid']));
|
||||
$ftpdomain_check = $ftpdomain_check_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if ($ftpdomain_check['domain'] != $ftpdomain) {
|
||||
standard_error('maindomainnonexist', $domain);
|
||||
}
|
||||
$username = $ftpusername . "@" . $ftpdomain;
|
||||
} else {
|
||||
$username = $userinfo['loginname'] . Settings::Get('customer.ftpprefix') . (intval($userinfo['ftp_lastaccountnumber']) + 1);
|
||||
}
|
||||
|
||||
$username_check_stmt = Database::prepare("SELECT * FROM `" . TABLE_FTP_USERS . "`
|
||||
WHERE `username` = :username"
|
||||
);
|
||||
Database::pexecute($username_check_stmt, array("username" => $username));
|
||||
$username_check = $username_check_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if (!empty($username_check) && $username_check['username'] = $username) {
|
||||
standard_error('usernamealreadyexists', $username);
|
||||
} elseif ($password == '') {
|
||||
standard_error(array('stringisempty', 'mypassword'));
|
||||
} elseif ($path == '') {
|
||||
standard_error('patherror');
|
||||
} elseif ($username == $password) {
|
||||
standard_error('passwordshouldnotbeusername');
|
||||
} else {
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
||||
|
||||
$cryptPassword = makeCryptPassword($password);
|
||||
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_FTP_USERS . "`
|
||||
(`customerid`, `username`, `description`, `password`, `homedir`, `login_enabled`, `uid`, `gid`)
|
||||
VALUES (:customerid, :username, :description, :password, :homedir, 'y', :guid, :guid)"
|
||||
);
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"username" => $username,
|
||||
"description" => $description,
|
||||
"password" => $cryptPassword,
|
||||
"homedir" => $path,
|
||||
"guid" => $userinfo['guid']
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$result_stmt = Database::prepare("SELECT `bytes_in_used` FROM `" . TABLE_FTP_QUOTATALLIES . "`
|
||||
WHERE `name` = :name"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("name" => $userinfo['loginname']));
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_FTP_QUOTATALLIES . "`
|
||||
(`name`, `quota_type`, `bytes_in_used`, `bytes_out_used`, `bytes_xfer_used`, `files_in_used`, `files_out_used`, `files_xfer_used`)
|
||||
VALUES (:name, 'user', :bytes_in_used, '0', '0', '0', '0', '0')"
|
||||
);
|
||||
Database::pexecute($stmt, array("name" => $username, "bytes_in_used" => $row['bytes_in_used']));
|
||||
}
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_FTP_GROUPS . "`
|
||||
SET `members` = CONCAT_WS(',',`members`, :username)
|
||||
WHERE `customerid`= :customerid
|
||||
AND `gid`= :guid"
|
||||
);
|
||||
$params = array(
|
||||
"username" => $username,
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"guid" => $userinfo['guid']
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `ftps_used` = `ftps_used` + 1,
|
||||
`ftp_lastaccountnumber` = `ftp_lastaccountnumber` + 1
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "added ftp-account '" . $username . " (" . $path . ")'");
|
||||
inserttask(5);
|
||||
|
||||
if ($sendinfomail == 1) {
|
||||
$replace_arr = array(
|
||||
'SALUTATION' => getCorrectUserSalutation($userinfo),
|
||||
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
|
||||
'USR_NAME' => $username,
|
||||
'USR_PASS' => $password,
|
||||
'USR_PATH' => makeCorrectDir(substr($path, strlen($userinfo['documentroot'])))
|
||||
);
|
||||
|
||||
$def_language = $userinfo['def_language'];
|
||||
$result_stmt = Database::prepare("SELECT `value` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid
|
||||
AND `language` = :lang
|
||||
AND `templategroup`='mails'
|
||||
AND `varname`='new_ftpaccount_by_customer_subject'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("adminid" => $userinfo['adminid'], "lang" => $def_language));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['new_ftpaccount_by_customer']['subject']), $replace_arr));
|
||||
|
||||
$def_language = $userinfo['def_language'];
|
||||
$result_stmt = Database::prepare("SELECT `value` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid
|
||||
AND `language` = :lang
|
||||
AND `templategroup`='mails'
|
||||
AND `varname`='new_ftpaccount_by_customer_mailbody'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("adminid" => $userinfo['adminid'], "lang" => $def_language));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['new_ftpaccount_by_customer']['mailbody']), $replace_arr));
|
||||
|
||||
$_mailerror = false;
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
try {
|
||||
$mail->Subject = $mail_subject;
|
||||
$mail->AltBody = $mail_body;
|
||||
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
|
||||
$mail->AddAddress($userinfo['email'], getCorrectUserSalutation($userinfo));
|
||||
$mail->Send();
|
||||
} catch(phpmailerException $e) {
|
||||
$mailerr_msg = $e->errorMessage();
|
||||
$_mailerror = true;
|
||||
Ftps::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
$mailerr_msg = $e->getMessage();
|
||||
$_mailerror = true;
|
||||
}
|
||||
|
||||
if ($_mailerror) {
|
||||
$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
|
||||
standard_error('errorsendingmail', $userinfo['email']);
|
||||
}
|
||||
|
||||
$mail->ClearAddresses();
|
||||
}
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], '/');
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], '/');
|
||||
|
||||
if (Settings::Get('customer.ftpatdomain') == '1') {
|
||||
$domainlist = array();
|
||||
$domains = '';
|
||||
|
||||
$result_domains_stmt = Database::prepare("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `customerid`= :customerid"
|
||||
);
|
||||
Database::pexecute($result_domains_stmt, array("customerid" => $userinfo['customerid']));
|
||||
WHERE `customerid`= :customerid");
|
||||
Database::pexecute($result_domains_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
|
||||
while ($row_domain = $result_domains_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$domainlist[] = $row_domain['domain'];
|
||||
@@ -324,127 +146,98 @@ if ($page == 'overview') {
|
||||
|
||||
if (isset($domainlist[0]) && $domainlist[0] != '') {
|
||||
foreach ($domainlist as $dom) {
|
||||
$domains .= makeoption($idna_convert->decode($dom), $dom);
|
||||
$domains .= \Froxlor\UI\HTML::makeoption($idna_convert->decode($dom), $dom);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
//$sendinfomail = makeyesno('sendinfomail', '1', '0', '0');
|
||||
if (Settings::Get('system.allow_customer_shell') == '1') {
|
||||
$shells = \Froxlor\UI\HTML::makeoption("/bin/false", "/bin/false", "/bin/false");
|
||||
$shells_avail = Settings::Get('system.available_shells');
|
||||
if (! empty($shells_avail)) {
|
||||
$shells_avail = explode(",", $shells_avail);
|
||||
$shells_avail = array_map("trim", $shells_avail);
|
||||
foreach ($shells_avail as $_shell) {
|
||||
$shells .= \Froxlor\UI\HTML::makeoption($_shell, $_shell, "/bin/false");
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// $sendinfomail = \Froxlor\UI\HTML::makeyesno('sendinfomail', '1', '0', '0');
|
||||
|
||||
$ftp_add_data = include_once dirname(__FILE__) . '/lib/formfields/customer/ftp/formfield.ftp_add.php';
|
||||
$ftp_add_form = htmlform::genHTMLForm($ftp_add_data);
|
||||
$ftp_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($ftp_add_data);
|
||||
|
||||
$title = $ftp_add_data['ftp_add']['title'];
|
||||
$image = $ftp_add_data['ftp_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate('ftp/accounts_add') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('ftp/accounts_add') . "\";");
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
$result_stmt = Database::prepare("SELECT `id`, `username`, `description`, `homedir`, `uid`, `gid` FROM `" . TABLE_FTP_USERS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = Ftps::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['username']) && $result['username'] != '') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// @FIXME use a good path-validating regex here (refs #1231)
|
||||
$path = validate($_POST['path'], 'path');
|
||||
|
||||
$_setnewpass = false;
|
||||
if (isset($_POST['ftp_password']) && $_POST['ftp_password'] != '') {
|
||||
$password = validate($_POST['ftp_password'], 'password');
|
||||
$password = validatePassword($password);
|
||||
$_setnewpass = true;
|
||||
try {
|
||||
Ftps::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
if ($_setnewpass) {
|
||||
if ($password == '') {
|
||||
standard_error(array('stringisempty', 'mypassword'));
|
||||
exit;
|
||||
} elseif ($result['username'] == $password) {
|
||||
standard_error('passwordshouldnotbeusername');
|
||||
exit;
|
||||
}
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account password for '" . $result['username'] . "'");
|
||||
$cryptPassword = makeCryptPassword($password);
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_FTP_USERS . "`
|
||||
SET `password` = :password
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id, "password" => $cryptPassword));
|
||||
}
|
||||
|
||||
if ($path != '') {
|
||||
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
||||
|
||||
if ($path != $result['homedir']) {
|
||||
if (!file_exists($path)) {
|
||||
// it's the task for "new ftp" but that will
|
||||
// create all directories and correct their permissions
|
||||
inserttask(5);
|
||||
}
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "updated ftp-account homdir for '" . $result['username'] . "'");
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_FTP_USERS . "`
|
||||
SET `homedir` = :homedir
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
$params = array(
|
||||
"homedir" => $path,
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"id" => $id
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
}
|
||||
}
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "edited ftp-account '" . $result['username'] . "'");
|
||||
$description = validate($_POST['ftp_description'], 'description');
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_FTP_USERS . "`
|
||||
SET `description` = :desc
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("desc" => $description, "customerid" => $userinfo['customerid'], "id" => $id));
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
if (strpos($result['homedir'], $userinfo['documentroot']) === 0) {
|
||||
$homedir = substr($result['homedir'], strlen($userinfo['documentroot']));
|
||||
$homedir = str_replace($userinfo['documentroot'], "/", $result['homedir']);
|
||||
} else {
|
||||
$homedir = $result['homedir'];
|
||||
}
|
||||
$homedir = makeCorrectDir($homedir);
|
||||
$homedir = \Froxlor\FileDir::makeCorrectDir($homedir);
|
||||
|
||||
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $homedir);
|
||||
$pathSelect = \Froxlor\FileDir::makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $homedir);
|
||||
|
||||
if (Settings::Get('customer.ftpatdomain') == '1') {
|
||||
$domains = '';
|
||||
|
||||
$result_domains_stmt = Database::prepare("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($result_domains_stmt, array("customerid" => $userinfo['customerid']));
|
||||
WHERE `customerid` = :customerid");
|
||||
Database::pexecute($result_domains_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
|
||||
while ($row_domain = $result_domains_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
|
||||
$domains .= \Froxlor\UI\HTML::makeoption($idna_convert->decode($row_domain['domain']), $row_domain['domain']);
|
||||
}
|
||||
}
|
||||
|
||||
if (Settings::Get('system.allow_customer_shell') == '1') {
|
||||
$shells = \Froxlor\UI\HTML::makeoption("/bin/false", "/bin/false", $result['shell']);
|
||||
$shells_avail = Settings::Get('system.available_shells');
|
||||
if (! empty($shells_avail)) {
|
||||
$shells_avail = explode(",", $shells_avail);
|
||||
$shells_avail = array_map("trim", $shells_avail);
|
||||
foreach ($shells_avail as $_shell) {
|
||||
$shells .= \Froxlor\UI\HTML::makeoption($_shell, $_shell, $result['shell']);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
$ftp_edit_data = include_once dirname(__FILE__) . '/lib/formfields/customer/ftp/formfield.ftp_edit.php';
|
||||
$ftp_edit_form = htmlform::genHTMLForm($ftp_edit_data);
|
||||
$ftp_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($ftp_edit_data);
|
||||
|
||||
$title = $ftp_edit_data['ftp_edit']['title'];
|
||||
$image = $ftp_edit_data['ftp_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate('ftp/accounts_edit') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('ftp/accounts_edit') . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -16,42 +16,47 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'customer');
|
||||
require './lib/init.php';
|
||||
|
||||
if ($action == 'logout') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, 'logged out');
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\Customers as Customers;
|
||||
|
||||
$params = array("customerid" => $userinfo['customerid']);
|
||||
if ($action == 'logout') {
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, 'logged out');
|
||||
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
);
|
||||
if (Settings::Get('session.allow_multiple_login') == '1') {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_SESSIONS . "`
|
||||
WHERE `userid` = :customerid
|
||||
AND `adminsession` = '0'
|
||||
AND `hash` = :hash"
|
||||
);
|
||||
AND `hash` = :hash");
|
||||
$params["hash"] = $s;
|
||||
} else {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_SESSIONS . "`
|
||||
WHERE `userid` = :customerid
|
||||
AND `adminsession` = '0'"
|
||||
);
|
||||
AND `adminsession` = '0'");
|
||||
}
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
redirectTo('index.php');
|
||||
exit;
|
||||
\Froxlor\UI\Response::redirectTo('index.php');
|
||||
}
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_index");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_index");
|
||||
|
||||
$domain_stmt = Database::prepare("SELECT `domain` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `parentdomainid` = '0'
|
||||
AND `id` <> :standardsubdomain
|
||||
");
|
||||
Database::pexecute($domain_stmt, array("customerid" => $userinfo['customerid'], "standardsubdomain" => $userinfo['standardsubdomain']));
|
||||
Database::pexecute($domain_stmt, array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"standardsubdomain" => $userinfo['standardsubdomain']
|
||||
));
|
||||
|
||||
$domains = '';
|
||||
$domainArray = array();
|
||||
@@ -71,7 +76,10 @@ if ($page == 'overview') {
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :standardsubdomain
|
||||
");
|
||||
$std_domain = Database::pexecute_first($std_domain_stmt, array("customerid" => $userinfo['customerid'], "standardsubdomain" => $userinfo['standardsubdomain']));
|
||||
$std_domain = Database::pexecute_first($std_domain_stmt, array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"standardsubdomain" => $userinfo['standardsubdomain']
|
||||
));
|
||||
$stdsubdomain = $std_domain['domain'];
|
||||
}
|
||||
|
||||
@@ -79,121 +87,140 @@ if ($page == 'overview') {
|
||||
$yesterday = time() - (60 * 60 * 24);
|
||||
$month = date('M Y', $yesterday);
|
||||
|
||||
// get disk-space usages for web, mysql and mail
|
||||
$usages_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DISKSPACE . "` WHERE `customerid` = :cid ORDER BY `stamp` DESC LIMIT 1");
|
||||
$usages = Database::pexecute_first($usages_stmt, array(
|
||||
'cid' => $userinfo['customerid']
|
||||
));
|
||||
|
||||
$userinfo['diskspace'] = round($userinfo['diskspace'] / 1024, Settings::Get('panel.decimal_places'));
|
||||
$userinfo['diskspace_used'] = round($userinfo['diskspace_used'] / 1024, Settings::Get('panel.decimal_places'));
|
||||
$userinfo['diskspace_used'] = round($usages['webspace'] / 1024, Settings::Get('panel.decimal_places'));
|
||||
$userinfo['mailspace_used'] = round($usages['mail'] / 1024, Settings::Get('panel.decimal_places'));
|
||||
$userinfo['dbspace_used'] = round($usages['mysql'] / 1024, Settings::Get('panel.decimal_places'));
|
||||
|
||||
$userinfo['traffic'] = round($userinfo['traffic'] / (1024 * 1024), Settings::Get('panel.decimal_places'));
|
||||
$userinfo['traffic_used'] = round($userinfo['traffic_used'] / (1024 * 1024), Settings::Get('panel.decimal_places'));
|
||||
$userinfo = str_replace_array('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps tickets subdomains');
|
||||
$userinfo = \Froxlor\PhpHelper::strReplaceArray('-1', $lng['customer']['unlimited'], $userinfo, 'diskspace traffic mysqls emails email_accounts email_forwarders email_quota ftps subdomains');
|
||||
|
||||
$userinfo['custom_notes'] = ($userinfo['custom_notes'] != '') ? nl2br($userinfo['custom_notes']) : '';
|
||||
|
||||
$services_enabled = "";
|
||||
$se = array();
|
||||
if ($userinfo['imap'] == '1') $se[] = "IMAP";
|
||||
if ($userinfo['pop3'] == '1') $se[] = "POP3";
|
||||
if ($userinfo['phpenabled'] == '1') $se[] = "PHP";
|
||||
if ($userinfo['perlenabled'] == '1') $se[] = "Perl/CGI";
|
||||
if ($userinfo['imap'] == '1')
|
||||
$se[] = "IMAP";
|
||||
if ($userinfo['pop3'] == '1')
|
||||
$se[] = "POP3";
|
||||
if ($userinfo['phpenabled'] == '1')
|
||||
$se[] = "PHP";
|
||||
if ($userinfo['perlenabled'] == '1')
|
||||
$se[] = "Perl/CGI";
|
||||
$services_enabled = implode(", ", $se);
|
||||
|
||||
eval("echo \"" . getTemplate('index/index') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('index/index') . "\";");
|
||||
} elseif ($page == 'change_password') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$old_password = validate($_POST['old_password'], 'old password');
|
||||
if (md5($old_password) != $userinfo['password']) {
|
||||
standard_error('oldpasswordnotcorrect');
|
||||
exit;
|
||||
$old_password = \Froxlor\Validate\Validate::validate($_POST['old_password'], 'old password');
|
||||
if (! \Froxlor\System\Crypt::validatePasswordLogin($userinfo, $old_password, TABLE_PANEL_CUSTOMERS, 'customerid')) {
|
||||
\Froxlor\UI\Response::standard_error('oldpasswordnotcorrect');
|
||||
}
|
||||
|
||||
$new_password = validatePassword($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm');
|
||||
$new_password = \Froxlor\System\Crypt::validatePassword($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = \Froxlor\System\Crypt::validatePassword($_POST['new_password_confirm'], 'new password confirm');
|
||||
|
||||
if ($old_password == '') {
|
||||
standard_error(array('stringisempty', 'oldpassword'));
|
||||
\Froxlor\UI\Response::standard_error(array(
|
||||
'stringisempty',
|
||||
'oldpassword'
|
||||
));
|
||||
} elseif ($new_password == '') {
|
||||
standard_error(array('stringisempty', 'newpassword'));
|
||||
\Froxlor\UI\Response::standard_error(array(
|
||||
'stringisempty',
|
||||
'newpassword'
|
||||
));
|
||||
} elseif ($new_password_confirm == '') {
|
||||
standard_error(array('stringisempty', 'newpasswordconfirm'));
|
||||
\Froxlor\UI\Response::standard_error(array(
|
||||
'stringisempty',
|
||||
'newpasswordconfirm'
|
||||
));
|
||||
} elseif ($new_password != $new_password_confirm) {
|
||||
standard_error('newpasswordconfirmerror');
|
||||
\Froxlor\UI\Response::standard_error('newpasswordconfirmerror');
|
||||
} else {
|
||||
// Update user password
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `password` = :newpassword
|
||||
WHERE `customerid` = :customerid
|
||||
AND `password` = :oldpassword"
|
||||
);
|
||||
$params = array(
|
||||
"newpassword" => md5($new_password),
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"oldpassword" => md5($old_password)
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed password');
|
||||
try {
|
||||
Customers::getLocal($userinfo, array(
|
||||
'id' => $userinfo['customerid'],
|
||||
'new_customer_password' => $new_password
|
||||
))->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, 'changed password');
|
||||
|
||||
// Update ftp password
|
||||
if (isset($_POST['change_main_ftp']) && $_POST['change_main_ftp'] == 'true') {
|
||||
$cryptPassword = makeCryptPassword($new_password);
|
||||
$cryptPassword = \Froxlor\System\Crypt::makeCryptPassword($new_password);
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_FTP_USERS . "`
|
||||
SET `password` = :password
|
||||
WHERE `customerid` = :customerid
|
||||
AND `username` = :username"
|
||||
);
|
||||
AND `username` = :username");
|
||||
$params = array(
|
||||
"password" => $cryptPassword,
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"username" => $userinfo['loginname']
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, 'changed main ftp password');
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, 'changed main ftp password');
|
||||
}
|
||||
|
||||
// Update webalizer password
|
||||
if (isset($_POST['change_webalizer']) && $_POST['change_webalizer'] == 'true') {
|
||||
if (CRYPT_STD_DES == 1) {
|
||||
$saltfordescrypt = substr(md5(uniqid(microtime(), 1)), 4, 2);
|
||||
$new_webalizer_password = crypt($new_password, $saltfordescrypt);
|
||||
} else {
|
||||
$new_webalizer_password = crypt($new_password);
|
||||
}
|
||||
// Update statistics password
|
||||
if (isset($_POST['change_stats']) && $_POST['change_stats'] == 'true') {
|
||||
$new_stats_password = \Froxlor\System\Crypt::makeCryptPassword($new_password, true);
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_HTPASSWDS . "`
|
||||
SET `password` = :password
|
||||
WHERE `customerid` = :customerid
|
||||
AND `username` = :username"
|
||||
);
|
||||
AND `username` = :username");
|
||||
$params = array(
|
||||
"password" => $new_webalizer_password,
|
||||
"password" => $new_stats_password,
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"username" => $userinfo['loginname']
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
}
|
||||
|
||||
redirectTo($filename, array('s' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
} else {
|
||||
eval("echo \"" . getTemplate('index/change_password') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('index/change_password') . "\";");
|
||||
}
|
||||
} elseif ($page == 'change_language') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$def_language = validate($_POST['def_language'], 'default language');
|
||||
$def_language = \Froxlor\Validate\Validate::validate($_POST['def_language'], 'default language');
|
||||
if (isset($languages[$def_language])) {
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `def_language` = :lang
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($stmt, array("lang" => $def_language, "customerid" => $userinfo['customerid']));
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_SESSIONS . "`
|
||||
SET `language` = :lang
|
||||
WHERE `hash` = :hash"
|
||||
);
|
||||
Database::pexecute($stmt, array("lang" => $def_language, "hash" => $s));
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
|
||||
try {
|
||||
Customers::getLocal($userinfo, array(
|
||||
'id' => $userinfo['customerid'],
|
||||
'def_language' => $def_language
|
||||
))->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
redirectTo($filename, array('s' => $s));
|
||||
// also update current session
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_SESSIONS . "`
|
||||
SET `language` = :lang
|
||||
WHERE `hash` = :hash");
|
||||
Database::pexecute($stmt, array(
|
||||
"lang" => $def_language,
|
||||
"hash" => $s
|
||||
));
|
||||
}
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "changed default language to '" . $def_language . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$default_lang = Settings::Get('panel.standardlanguage');
|
||||
if ($userinfo['def_language'] != '') {
|
||||
@@ -201,30 +228,37 @@ if ($page == 'overview') {
|
||||
}
|
||||
|
||||
$language_options = '';
|
||||
while (list($language_file, $language_name) = each($languages)) {
|
||||
$language_options .= makeoption($language_name, $language_file, $default_lang, true);
|
||||
foreach ($languages as $language_file => $language_name) {
|
||||
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, $default_lang, true);
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('index/change_language') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('index/change_language') . "\";");
|
||||
}
|
||||
} elseif ($page == 'change_theme') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$theme = validate($_POST['theme'], 'theme');
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `theme` = :theme
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($stmt, array("theme" => $theme, "customerid" => $userinfo['customerid']));
|
||||
$theme = \Froxlor\Validate\Validate::validate($_POST['theme'], 'theme');
|
||||
try {
|
||||
Customers::getLocal($userinfo, array(
|
||||
'id' => $userinfo['customerid'],
|
||||
'theme' => $theme
|
||||
))->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
// also update current session
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_SESSIONS . "`
|
||||
SET `theme` = :theme
|
||||
WHERE `hash` = :hash"
|
||||
);
|
||||
Database::pexecute($stmt, array("theme" => $theme, "hash" => $s));
|
||||
WHERE `hash` = :hash");
|
||||
Database::pexecute($stmt, array(
|
||||
"theme" => $theme,
|
||||
"hash" => $s
|
||||
));
|
||||
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'");
|
||||
redirectTo($filename, array('s' => $s));
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "changed default theme to '" . $theme . "'");
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$default_theme = Settings::Get('panel.default_theme');
|
||||
if ($userinfo['theme'] != '') {
|
||||
@@ -232,14 +266,13 @@ if ($page == 'overview') {
|
||||
}
|
||||
|
||||
$theme_options = '';
|
||||
$themes_avail = getThemes();
|
||||
$themes_avail = \Froxlor\UI\Template::getThemes();
|
||||
foreach ($themes_avail as $t => $d) {
|
||||
$theme_options.= makeoption($d, $t, $default_theme, true);
|
||||
$theme_options .= \Froxlor\UI\HTML::makeoption($d, $t, $default_theme, true);
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('index/change_theme') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('index/change_theme') . "\";");
|
||||
}
|
||||
|
||||
} elseif ($page == 'send_error_report' && Settings::Get('system.allow_error_report_customer') == '1') {
|
||||
|
||||
// only show this if we really have an exception to report
|
||||
@@ -247,8 +280,8 @@ if ($page == 'overview') {
|
||||
|
||||
$errid = $_GET['errorid'];
|
||||
// read error file
|
||||
$err_dir = makeCorrectDir(FROXLOR_INSTALL_DIR."/logs/");
|
||||
$err_file = makeCorrectFile($err_dir."/".$errid."_sql-error.log");
|
||||
$err_dir = \Froxlor\FileDir::makeCorrectDir(\Froxlor\Froxlor::getInstallDir() . "/logs/");
|
||||
$err_file = \Froxlor\FileDir::makeCorrectFile($err_dir . "/" . $errid . "_sql-error.log");
|
||||
|
||||
if (file_exists($err_file)) {
|
||||
|
||||
@@ -258,9 +291,9 @@ if ($page == 'overview') {
|
||||
$_error = array(
|
||||
'code' => str_replace("\n", "", substr($error[1], 5)),
|
||||
'message' => str_replace("\n", "", substr($error[2], 4)),
|
||||
'file' => str_replace("\n", "", substr($error[3], 5 + strlen(FROXLOR_INSTALL_DIR))),
|
||||
'file' => str_replace("\n", "", substr($error[3], 5 + strlen(\Froxlor\Froxlor::getInstallDir()))),
|
||||
'line' => str_replace("\n", "", substr($error[4], 5)),
|
||||
'trace' => str_replace(FROXLOR_INSTALL_DIR, "", substr($error[5], 6))
|
||||
'trace' => str_replace(\Froxlor\Froxlor::getInstallDir(), "", substr($error[5], 6))
|
||||
);
|
||||
|
||||
// build mail-content
|
||||
@@ -271,14 +304,13 @@ if ($page == 'overview') {
|
||||
$mail_body .= "File: " . $_error['file'] . ':' . $_error['line'] . "\n\n";
|
||||
$mail_body .= "Trace:\n" . trim($_error['trace']) . "\n\n";
|
||||
$mail_body .= "-------------------------------------------------------------\n\n";
|
||||
$mail_body .= "Froxlor-version: ".$version."\n\n";
|
||||
$mail_body .= "Froxlor-version: " . $version . "\n";
|
||||
$mail_body .= "DB-version: " . $dbversion . "\n\n";
|
||||
$mail_body .= "End of report";
|
||||
$mail_html = str_replace("\n", "<br />", $mail_body);
|
||||
|
||||
// send actual report to dev-team
|
||||
if (isset($_POST['send'])
|
||||
&& $_POST['send'] == 'send'
|
||||
) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// send mail and say thanks
|
||||
$_mailerror = false;
|
||||
try {
|
||||
@@ -287,7 +319,7 @@ if ($page == 'overview') {
|
||||
$mail->MsgHTML($mail_html);
|
||||
$mail->AddAddress('error-reports@froxlor.org', 'Froxlor Developer Team');
|
||||
$mail->Send();
|
||||
} catch(phpmailerException $e) {
|
||||
} catch (\PHPMailer\PHPMailer\Exception $e) {
|
||||
$mailerr_msg = $e->errorMessage();
|
||||
$_mailerror = true;
|
||||
} catch (Exception $e) {
|
||||
@@ -297,21 +329,32 @@ if ($page == 'overview') {
|
||||
|
||||
if ($_mailerror) {
|
||||
// error when reporting an error...LOLFUQ
|
||||
standard_error('send_report_error', $mailerr_msg);
|
||||
\Froxlor\UI\Response::standard_error('send_report_error', $mailerr_msg);
|
||||
}
|
||||
|
||||
// finally remove error from fs
|
||||
@unlink($err_file);
|
||||
redirectTo($filename, array('s' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
// show a nice summary of the error-report
|
||||
// before actually sending anything
|
||||
eval("echo \"" . getTemplate("index/send_error_report") . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("index/send_error_report") . "\";");
|
||||
} else {
|
||||
redirectTo($filename, array('s' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
} else {
|
||||
redirectTo($filename, array('s' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
's' => $s
|
||||
));
|
||||
}
|
||||
} elseif ($page == 'apikeys' && Settings::Get('api.enabled') == 1) {
|
||||
require_once __DIR__ . '/api_keys.php';
|
||||
} elseif ($page == 'apihelp' && Settings::Get('api.enabled') == 1) {
|
||||
require_once __DIR__ . '/apihelp.php';
|
||||
} elseif ($page == '2fa' && Settings::Get('2fa.enabled') == 1) {
|
||||
require_once __DIR__ . '/2fa.php';
|
||||
}
|
||||
|
||||
124
customer_logger.php
Normal file
@@ -0,0 +1,124 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2003-2009 the SysCP Team (see authors).
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
define('AREA', 'customer');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
|
||||
// redirect if this customer page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'extras.logger')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
if ($page == 'log') {
|
||||
if ($action == '') {
|
||||
$fields = array(
|
||||
'date' => $lng['logger']['date'],
|
||||
'type' => $lng['logger']['type'],
|
||||
'user' => $lng['logger']['user'],
|
||||
'text' => $lng['logger']['action']
|
||||
);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_LOG, $fields, null, null, 0, 'desc', 30);
|
||||
$query = 'SELECT * FROM `' . TABLE_PANEL_LOG . '` WHERE `user` = :loginname ' . $paging->getSqlWhere(true) . ' ' . $paging->getSqlOrderBy();
|
||||
$result_stmt = Database::prepare($query . ' ' . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt, array(
|
||||
"loginname" => $userinfo['loginname']
|
||||
));
|
||||
$result_cnt_stmt = Database::prepare($query);
|
||||
Database::pexecute($result_cnt_stmt, array(
|
||||
"loginname" => $userinfo['loginname']
|
||||
));
|
||||
$res_cnt = $result_cnt_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$logs_count = $result_cnt_stmt->rowCount();
|
||||
$paging->setEntries($logs_count);
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$clog = array();
|
||||
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
|
||||
if (! isset($clog[$row['action']]) || ! is_array($clog[$row['action']])) {
|
||||
$clog[$row['action']] = array();
|
||||
}
|
||||
$clog[$row['action']][$row['logid']] = $row;
|
||||
}
|
||||
|
||||
if ($paging->sortfield == 'date' && $paging->sortorder == 'desc') {
|
||||
krsort($clog);
|
||||
} else {
|
||||
ksort($clog);
|
||||
}
|
||||
|
||||
$i = 0;
|
||||
$count = 0;
|
||||
$log_count = 0;
|
||||
$log = '';
|
||||
foreach ($clog as $action => $logrows) {
|
||||
$_action = 0;
|
||||
foreach ($logrows as $row) {
|
||||
// if ($paging->checkDisplay($i)) {
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
$row['date'] = date("d.m.y H:i:s", $row['date']);
|
||||
|
||||
if ($_action != $action) {
|
||||
switch ($action) {
|
||||
case \Froxlor\FroxlorLogger::USR_ACTION:
|
||||
$_action = $lng['admin']['customer'];
|
||||
break;
|
||||
case \Froxlor\FroxlorLogger::RES_ACTION:
|
||||
$_action = $lng['logger']['reseller'];
|
||||
break;
|
||||
case \Froxlor\FroxlorLogger::ADM_ACTION:
|
||||
$_action = $lng['logger']['admin'];
|
||||
break;
|
||||
case \Froxlor\FroxlorLogger::CRON_ACTION:
|
||||
$_action = $lng['logger']['cron'];
|
||||
break;
|
||||
case \Froxlor\FroxlorLogger::LOGIN_ACTION:
|
||||
$_action = $lng['logger']['login'];
|
||||
break;
|
||||
case LOG_ERROR:
|
||||
$_action = $lng['logger']['intern'];
|
||||
break;
|
||||
default:
|
||||
$_action = $lng['logger']['unknown'];
|
||||
break;
|
||||
}
|
||||
|
||||
$row['action'] = $_action;
|
||||
eval("\$log.=\"" . \Froxlor\UI\Template::getTemplate('logger/logger_action') . "\";");
|
||||
}
|
||||
|
||||
$log_count ++;
|
||||
$row['type'] = \Froxlor\FroxlorLogger::getInstanceOf()->getLogLevelDesc($row['type']);
|
||||
eval("\$log.=\"" . \Froxlor\UI\Template::getTemplate('logger/logger_log') . "\";");
|
||||
$count ++;
|
||||
$_action = $action;
|
||||
// }
|
||||
$i ++;
|
||||
}
|
||||
$i ++;
|
||||
}
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('logger/logger') . "\";");
|
||||
}
|
||||
}
|
||||
@@ -16,10 +16,18 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'customer');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\Api\Commands\Mysqls as Mysqls;
|
||||
|
||||
// redirect if this customer page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'mysql')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
// get sql-root access data
|
||||
Database::needRoot(true);
|
||||
Database::needSqlData();
|
||||
@@ -33,23 +41,24 @@ if (isset($_POST['id'])) {
|
||||
}
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_mysql");
|
||||
Database::needSqlData();
|
||||
$sql = Database::getSqlData();
|
||||
$lng['mysql']['description'] = str_replace('<SQL_HOST>', $sql['host'], $lng['mysql']['description']);
|
||||
eval("echo \"" . getTemplate('mysql/mysql') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('mysql/mysql') . "\";");
|
||||
} elseif ($page == 'mysqls') {
|
||||
if ($action == '') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
|
||||
$log->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "viewed customer_mysql::mysqls");
|
||||
$fields = array(
|
||||
'databasename' => $lng['mysql']['databasename'],
|
||||
'description' => $lng['mysql']['databasedescription']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_DATABASES, $fields);
|
||||
$paging = new \Froxlor\UI\Paging($userinfo, TABLE_PANEL_DATABASES, $fields);
|
||||
$result_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DATABASES . "`
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid']));
|
||||
WHERE `customerid`= :customerid " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit());
|
||||
Database::pexecute($result_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
$mysqls_count = Database::num_rows();
|
||||
$paging->setEntries($mysqls_count);
|
||||
|
||||
@@ -69,15 +78,16 @@ if ($page == 'overview') {
|
||||
Database::needRoot(true);
|
||||
while ($row = $result_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$row = htmlentities_array($row);
|
||||
$row = \Froxlor\PhpHelper::htmlentitiesArray($row);
|
||||
$mbdata_stmt = Database::prepare("SELECT SUM(data_length + index_length) as MB FROM information_schema.TABLES
|
||||
WHERE table_schema = :table_schema
|
||||
GROUP BY table_schema"
|
||||
);
|
||||
Database::pexecute($mbdata_stmt, array("table_schema" => $row['databasename']));
|
||||
GROUP BY table_schema");
|
||||
Database::pexecute($mbdata_stmt, array(
|
||||
"table_schema" => $row['databasename']
|
||||
));
|
||||
$mbdata = $mbdata_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$row['size'] = size_readable($mbdata['MB'], 'GiB', 'bi', '%01.' . (int)Settings::Get('panel.decimal_places') . 'f %s');
|
||||
eval("\$mysqls.=\"" . getTemplate('mysql/mysqls_database') . "\";");
|
||||
$row['size'] = \Froxlor\PhpHelper::sizeReadable($mbdata['MB'], 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
eval("\$mysqls.=\"" . \Froxlor\UI\Template::getTemplate('mysql/mysqls_database') . "\";");
|
||||
$count ++;
|
||||
}
|
||||
$i ++;
|
||||
@@ -85,15 +95,17 @@ if ($page == 'overview') {
|
||||
Database::needRoot(false);
|
||||
// End root-session
|
||||
|
||||
eval("echo \"" . getTemplate('mysql/mysqls') . "\";");
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('mysql/mysqls') . "\";");
|
||||
} elseif ($action == 'delete' && $id != 0) {
|
||||
$result_stmt = Database::prepare('SELECT `id`, `databasename`, `description`, `dbserver` FROM `' . TABLE_PANEL_DATABASES . '`
|
||||
WHERE `customerid`="' . (int)$userinfo['customerid'] . '"
|
||||
AND `id`="' . (int)$id . '"'
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid']));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
try {
|
||||
$json_result = Mysqls::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['databasename']) && $result['databasename'] != '') {
|
||||
|
||||
@@ -107,168 +119,39 @@ if ($page == 'overview') {
|
||||
}
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// Begin root-session
|
||||
Database::needRoot(true, $result['dbserver']);
|
||||
$dbm = new DbManager($log);
|
||||
$dbm->getManager()->deleteDatabase($result['databasename']);
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "deleted database '" . $result['databasename'] . "'");
|
||||
Database::needRoot(false);
|
||||
// End root-session
|
||||
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_DATABASES . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
|
||||
$resetaccnumber = ($userinfo['mysqls_used'] == '1') ? " , `mysql_lastaccountnumber` = '0' " : '';
|
||||
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `mysqls_used` = `mysqls_used` - 1 " . $resetaccnumber . "
|
||||
WHERE `customerid` = :customerid"
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
try {
|
||||
Mysqls::getLocal($userinfo, $_POST)->delete();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
$dbnamedesc = $result['databasename'];
|
||||
if (isset($result['description']) && $result['description'] != '') {
|
||||
$dbnamedesc .= ' (' . $result['description'] . ')';
|
||||
}
|
||||
ask_yesno('mysql_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $dbnamedesc);
|
||||
\Froxlor\UI\HTML::askYesNo('mysql_reallydelete', $filename, array(
|
||||
'id' => $id,
|
||||
'page' => $page,
|
||||
'action' => $action
|
||||
), $dbnamedesc);
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'add') {
|
||||
if ($userinfo['mysqls_used'] < $userinfo['mysqls'] || $userinfo['mysqls'] == '-1') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$password = validate($_POST['mysql_password'], 'password');
|
||||
$password = validatePassword($password);
|
||||
|
||||
$sendinfomail = isset($_POST['sendinfomail']) ? 1 : 0;
|
||||
if ($sendinfomail != 1) {
|
||||
$sendinfomail = 0;
|
||||
}
|
||||
|
||||
if ($password == '') {
|
||||
standard_error(array('stringisempty', 'mypassword'));
|
||||
} else {
|
||||
$dbserver = 0;
|
||||
$dbservers_stmt = Database::query("SELECT COUNT(DISTINCT `dbserver`) as numservers FROM `".TABLE_PANEL_DATABASES."`");
|
||||
$_dbserver = $dbservers_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$count_mysqlservers = $_dbserver['numservers'];
|
||||
if ($count_mysqlservers > 1) {
|
||||
$dbserver = validate($_POST['mysql_server'], html_entity_decode($lng['mysql']['mysql_server']), '', '', 0);
|
||||
Database::needRoot(true, $dbserver);
|
||||
Database::needSqlData();
|
||||
$sql_root = Database::getSqlData();
|
||||
Database::needRoot(false);
|
||||
if (!isset($sql_root) || !is_array($sql_root)) {
|
||||
$dbserver = 0;
|
||||
}
|
||||
}
|
||||
|
||||
// validate description before actual adding the database, #1052
|
||||
$databasedescription = validate(trim($_POST['description']), 'description');
|
||||
|
||||
// create database, user, set permissions, etc.pp.
|
||||
$dbm = new DbManager($log);
|
||||
$username = $dbm->createDatabase(
|
||||
$userinfo['loginname'],
|
||||
$password,
|
||||
$userinfo['mysql_lastaccountnumber']
|
||||
);
|
||||
|
||||
// we've checked against the password in dbm->createDatabase
|
||||
if ($username == false) {
|
||||
standard_error('passwordshouldnotbeusername');
|
||||
}
|
||||
|
||||
// Statement modified for Database description -- PH 2004-11-29
|
||||
$stmt = Database::prepare('INSERT INTO `' . TABLE_PANEL_DATABASES . '`
|
||||
(`customerid`, `databasename`, `description`, `dbserver`)
|
||||
VALUES (:customerid, :databasename, :description, :dbserver)'
|
||||
);
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"databasename" => $username,
|
||||
"description" => $databasedescription,
|
||||
"dbserver" => $dbserver
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$stmt = Database::prepare('UPDATE `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
SET `mysqls_used` = `mysqls_used` + 1, `mysql_lastaccountnumber` = `mysql_lastaccountnumber` + 1
|
||||
WHERE `customerid` = :customerid'
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
if ($sendinfomail == 1) {
|
||||
$pma = $lng['admin']['notgiven'];
|
||||
if (Settings::Get('panel.phpmyadmin_url') != '') {
|
||||
$pma = Settings::Get('panel.phpmyadmin_url');
|
||||
}
|
||||
|
||||
Database::needRoot(true, $dbserver);
|
||||
Database::needSqlData();
|
||||
$sql_root = Database::getSqlData();
|
||||
Database::needRoot(false);
|
||||
|
||||
$replace_arr = array(
|
||||
'SALUTATION' => getCorrectUserSalutation($userinfo),
|
||||
'CUST_NAME' => getCorrectUserSalutation($userinfo), // < keep this for compatibility
|
||||
'DB_NAME' => $username,
|
||||
'DB_PASS' => $password,
|
||||
'DB_DESC' => $databasedescription,
|
||||
'DB_SRV' => $sql_root['host'],
|
||||
'PMA_URI' => $pma
|
||||
);
|
||||
|
||||
$def_language = $userinfo['def_language'];
|
||||
$result_stmt = Database::prepare("SELECT `value` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid` = :adminid
|
||||
AND `language` = :lang
|
||||
AND `templategroup`='mails'
|
||||
AND `varname`='new_database_by_customer_subject'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("adminid" => $userinfo['adminid'], "lang" => $def_language));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['new_database_by_customer']['subject']), $replace_arr));
|
||||
|
||||
$result_stmt = Database::prepare("SELECT `value` FROM `" . TABLE_PANEL_TEMPLATES . "`
|
||||
WHERE `adminid`= :adminid
|
||||
AND `language`= :lang
|
||||
AND `templategroup` = 'mails'
|
||||
AND `varname` = 'new_database_by_customer_mailbody'"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("adminid" => $userinfo['adminid'], "lang" => $def_language));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['new_database_by_customer']['mailbody']), $replace_arr));
|
||||
|
||||
$_mailerror = false;
|
||||
try {
|
||||
$mail->Subject = $mail_subject;
|
||||
$mail->AltBody = $mail_body;
|
||||
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
|
||||
$mail->AddAddress($userinfo['email'], getCorrectUserSalutation($userinfo));
|
||||
$mail->Send();
|
||||
} catch(phpmailerException $e) {
|
||||
$mailerr_msg = $e->errorMessage();
|
||||
$_mailerror = true;
|
||||
Mysqls::getLocal($userinfo, $_POST)->add();
|
||||
} catch (Exception $e) {
|
||||
$mailerr_msg = $e->getMessage();
|
||||
$_mailerror = true;
|
||||
}
|
||||
|
||||
if ($_mailerror) {
|
||||
$log->logAction(USR_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
|
||||
standard_error('errorsendingmail', $userinfo['email']);
|
||||
}
|
||||
|
||||
$mail->ClearAddresses();
|
||||
}
|
||||
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$dbservers_stmt = Database::query("SELECT DISTINCT `dbserver` FROM `" . TABLE_PANEL_DATABASES . "`");
|
||||
@@ -278,72 +161,41 @@ if ($page == 'overview') {
|
||||
Database::needRoot(true, $dbserver['dbserver']);
|
||||
Database::needSqlData();
|
||||
$sql_root = Database::getSqlData();
|
||||
$mysql_servers .= makeoption($sql_root['caption'], $dbserver['dbserver']);
|
||||
$mysql_servers .= \Froxlor\UI\HTML::makeoption($sql_root['caption'], $dbserver['dbserver']);
|
||||
$count_mysqlservers ++;
|
||||
}
|
||||
Database::needRoot(false);
|
||||
|
||||
$mysql_add_data = include_once dirname(__FILE__) . '/lib/formfields/customer/mysql/formfield.mysql_add.php';
|
||||
$mysql_add_form = htmlform::genHTMLForm($mysql_add_data);
|
||||
$mysql_add_form = \Froxlor\UI\HtmlForm::genHTMLForm($mysql_add_data);
|
||||
|
||||
$title = $mysql_add_data['mysql_add']['title'];
|
||||
$image = $mysql_add_data['mysql_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate('mysql/mysqls_add') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('mysql/mysqls_add') . "\";");
|
||||
}
|
||||
}
|
||||
} elseif ($action == 'edit' && $id != 0) {
|
||||
$result_stmt = Database::prepare("SELECT `id`, `databasename`, `description`, `dbserver` FROM `" . TABLE_PANEL_DATABASES . "`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
try {
|
||||
$json_result = Mysqls::getLocal($userinfo, array(
|
||||
'id' => $id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
|
||||
if (isset($result['databasename']) && $result['databasename'] != '') {
|
||||
if (!isset($sql_root[$result['dbserver']]) || !is_array($sql_root[$result['dbserver']])) {
|
||||
$result['dbserver'] = 0;
|
||||
}
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
// Only change Password if it is set, do nothing if it is empty! -- PH 2004-11-29
|
||||
$password = validate($_POST['mysql_password'], 'password');
|
||||
if ($password != '') {
|
||||
// validate password
|
||||
$password = validatePassword($password);
|
||||
|
||||
if ($password == $result['databasename']) {
|
||||
standard_error('passwordshouldnotbeusername');
|
||||
try {
|
||||
$json_result = Mysqls::getLocal($userinfo, $_POST)->update();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
|
||||
// Begin root-session
|
||||
Database::needRoot(true);
|
||||
foreach (array_map('trim', explode(',', Settings::Get('system.mysql_access_host'))) as $mysql_access_host) {
|
||||
$stmt = Database::prepare("SET PASSWORD FOR :dbname@:host = PASSWORD(:password)");
|
||||
$params = array(
|
||||
"dbname" => $result['databasename'],
|
||||
"host" => $mysql_access_host,
|
||||
"password" => $password
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
}
|
||||
|
||||
$stmt = Database::prepare("FLUSH PRIVILEGES");
|
||||
Database::pexecute($stmt);
|
||||
Database::needRoot(false);
|
||||
// End root-session
|
||||
}
|
||||
|
||||
// Update the Database description -- PH 2004-11-29
|
||||
$log->logAction(USR_ACTION, LOG_INFO, "edited database '" . $result['databasename'] . "'");
|
||||
$databasedescription = validate($_POST['description'], 'description');
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_DATABASES . "`
|
||||
SET `description` = :desc
|
||||
WHERE `customerid` = :customerid
|
||||
AND `id` = :id"
|
||||
);
|
||||
Database::pexecute($stmt, array("desc" => $databasedescription, "customerid" => $userinfo['customerid'], "id" => $id));
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
\Froxlor\UI\Response::redirectTo($filename, array(
|
||||
'page' => $page,
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
|
||||
$dbservers_stmt = Database::query("SELECT COUNT(DISTINCT `dbserver`) as numservers FROM `" . TABLE_PANEL_DATABASES . "`");
|
||||
@@ -356,12 +208,12 @@ if ($page == 'overview') {
|
||||
Database::needRoot(false);
|
||||
|
||||
$mysql_edit_data = include_once dirname(__FILE__) . '/lib/formfields/customer/mysql/formfield.mysql_edit.php';
|
||||
$mysql_edit_form = htmlform::genHTMLForm($mysql_edit_data);
|
||||
$mysql_edit_form = \Froxlor\UI\HtmlForm::genHTMLForm($mysql_edit_data);
|
||||
|
||||
$title = $mysql_edit_data['mysql_edit']['title'];
|
||||
$image = $mysql_edit_data['mysql_edit']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate('mysql/mysqls_edit') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('mysql/mysqls_edit') . "\";");
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -1,387 +0,0 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2003-2009 the SysCP Team (see authors).
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'customer');
|
||||
require './lib/init.php';
|
||||
|
||||
if (isset($_POST['id'])) {
|
||||
|
||||
$id = intval($_POST['id']);
|
||||
|
||||
//Check if the current user is allowed to see the current ticket.
|
||||
$stmt = Database::prepare("SELECT `id` FROM `panel_tickets` WHERE `id` = :id AND `customerid` = :customerid");
|
||||
$result = Database::pexecute_first($stmt, array("id" => $id, "customerid" => $userinfo['customerid']));
|
||||
|
||||
if ($result == null) {
|
||||
// no rights to see the requested ticket
|
||||
standard_error(array('ticketnotaccessible'));
|
||||
}
|
||||
} elseif (isset($_GET['id'])) {
|
||||
$id = intval($_GET['id']);
|
||||
}
|
||||
|
||||
if ($page == 'overview') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets");
|
||||
eval("echo \"" . getTemplate("tickets/ticket") . "\";");
|
||||
} elseif ($page == 'tickets') {
|
||||
if ($action == '') {
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_tickets::tickets");
|
||||
$fields = array(
|
||||
'status' => $lng['ticket']['status'],
|
||||
'lastchange' => $lng['ticket']['lastchange'],
|
||||
'subject' => $lng['ticket']['subject'],
|
||||
'lastreplier' => $lng['ticket']['lastreplier']
|
||||
);
|
||||
$paging = new paging($userinfo, TABLE_PANEL_TICKETS, $fields);
|
||||
$stmt = Database::prepare('SELECT `main`.`id`, (SELECT COUNT(`sub`.`id`) FROM `' . TABLE_PANEL_TICKETS . '` `sub`
|
||||
WHERE `sub`.`answerto` = `main`.`id`) AS `ticket_answers`, `main`.`lastchange`, `main`.`subject`, `main`.`status`, `main`.`lastreplier`, `main`.`priority`
|
||||
FROM `' . TABLE_PANEL_TICKETS . '` as `main`
|
||||
WHERE `main`.`answerto` = "0"
|
||||
AND `archived` = "0"
|
||||
AND `customerid`= :customerid ' . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
$paging->setEntries(Database::num_rows());
|
||||
$sortcode = $paging->getHtmlSortCode($lng);
|
||||
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$searchcode = $paging->getHtmlSearchCode($lng);
|
||||
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
||||
$i = 0;
|
||||
$count = 0;
|
||||
$tickets = '';
|
||||
$tickets_count = 0;
|
||||
|
||||
while ($row = $stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ($paging->checkDisplay($i)) {
|
||||
$tickets_count++;
|
||||
$row = htmlentities_array($row);
|
||||
$row['lastchange'] = date("d.m.y H:i", $row['lastchange']);
|
||||
|
||||
if ($row['status'] >= 0 && $row['status'] <= 2) {
|
||||
$reopen = 0;
|
||||
} else {
|
||||
$reopen = 1;
|
||||
}
|
||||
|
||||
$row['status'] = ticket::getStatusText($lng, $row['status']);
|
||||
$row['priority'] = ticket::getPriorityText($lng, $row['priority']);
|
||||
|
||||
if ($row['lastreplier'] == '1') {
|
||||
$row['lastreplier'] = $lng['ticket']['staff'];
|
||||
$cananswer = 1;
|
||||
} else {
|
||||
$row['lastreplier'] = $lng['ticket']['customer'];
|
||||
$cananswer = 0;
|
||||
}
|
||||
|
||||
$row['subject'] = html_entity_decode($row['subject']);
|
||||
if (strlen($row['subject']) > 30) {
|
||||
$ts = wordwrap($row['subject'], 30, "|");
|
||||
$ts = explode("|", $ts);
|
||||
$row['subject'] = $ts[0]. '...';
|
||||
}
|
||||
|
||||
eval("\$tickets.=\"" . getTemplate("tickets/tickets_tickets") . "\";");
|
||||
$count++;
|
||||
}
|
||||
|
||||
$i++;
|
||||
}
|
||||
|
||||
$supportavailable = 0;
|
||||
$time = date("Hi", time());
|
||||
$day = date("w", time());
|
||||
$start = substr(Settings::Get('ticket.worktime_begin'), 0, 2) . substr(Settings::Get('ticket.worktime_begin'), 3, 2);
|
||||
$end = substr(Settings::Get('ticket.worktime_end'), 0, 2) . substr(Settings::Get('ticket.worktime_end'), 3, 2);
|
||||
|
||||
if ($time >= $start && $time <= $end) {
|
||||
$supportavailable = 1;
|
||||
}
|
||||
|
||||
if (Settings::Get('ticket.worktime_sat') == "0" && $day == "6") {
|
||||
$supportavailable = 0;
|
||||
}
|
||||
|
||||
if (Settings::Get('ticket.worktime_sun') == "0" && $day == "0") {
|
||||
$supportavailable = 0;
|
||||
}
|
||||
|
||||
if (Settings::Get('ticket.worktime_all') == "1") {
|
||||
$supportavailable = 1;
|
||||
}
|
||||
|
||||
$ticketsopen = 0;
|
||||
$stmt = Database::prepare('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `answerto` = "0"
|
||||
AND (`status` = "0" OR `status` = "1" OR `status` = "2")'
|
||||
);
|
||||
$opentickets = Database::pexecute_first($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
if (Settings::Get('ticket.concurrently_open') != - 1 && Settings::Get('ticket.concurrently_open') != '') {
|
||||
$notmorethanxopentickets = strtr($lng['ticket']['notmorethanxopentickets'], array('%s' => Settings::Get('ticket.concurrently_open')));
|
||||
} else {
|
||||
$notmorethanxopentickets = '';
|
||||
}
|
||||
|
||||
$ticketsopen = (int)$opentickets['count'];
|
||||
eval("echo \"" . getTemplate("tickets/tickets") . "\";");
|
||||
|
||||
} elseif ($action == 'new') {
|
||||
if ($userinfo['tickets_used'] < $userinfo['tickets'] || $userinfo['tickets'] == '-1') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$newticket = ticket::getInstanceOf($userinfo, -1);
|
||||
$newticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
|
||||
$newticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
|
||||
$newticket->Set('category', validate($_POST['category'], 'category'), true, false);
|
||||
$newticket->Set('customer', (int)$userinfo['customerid'], true, false);
|
||||
$newticket->Set('admin', (int)$userinfo['adminid'], true, false);
|
||||
$newticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
|
||||
|
||||
if ($newticket->Get('subject') == null) {
|
||||
standard_error(array('stringisempty', 'mysubject'));
|
||||
} elseif ($newticket->Get('message') == null) {
|
||||
standard_error(array('stringisempty', 'mymessage'));
|
||||
} else {
|
||||
$now = time();
|
||||
$newticket->Set('dt', $now, true, true);
|
||||
$newticket->Set('lastchange', $now, true, true);
|
||||
$newticket->Set('ip', $_SERVER['REMOTE_ADDR'], true, true);
|
||||
$newticket->Set('status', '0', true, true);
|
||||
$newticket->Set('lastreplier', '0', true, true);
|
||||
$newticket->Set('by', '0', true, true);
|
||||
$newticket->Insert();
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "opened support-ticket '" . $newticket->Get('subject') . "'");
|
||||
|
||||
$stmt = Database::prepare('UPDATE `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
SET `tickets_used`=`tickets_used` + 1
|
||||
WHERE `customerid`= :customerid'
|
||||
);
|
||||
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
// Customer mail
|
||||
$newticket->sendMail((int)$userinfo['customerid'], 'new_ticket_for_customer_subject', $lng['mails']['new_ticket_for_customer']['subject'], 'new_ticket_for_customer_mailbody', $lng['mails']['new_ticket_for_customer']['mailbody']);
|
||||
|
||||
// Admin mail
|
||||
$newticket->sendMail(-1, 'new_ticket_by_customer_subject', $lng['mails']['new_ticket_by_customer']['subject'], 'new_ticket_by_customer_mailbody', $lng['mails']['new_ticket_by_customer']['mailbody']);
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$categories = '';
|
||||
$result_stmt = Database::prepare('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
|
||||
WHERE `adminid` = :adminid
|
||||
ORDER BY `logicalorder`, `name` ASC'
|
||||
);
|
||||
$result = Database::pexecute_first($result_stmt, array("adminid" => $userinfo['adminid']));
|
||||
|
||||
if (isset($result['name']) && $result['name'] != '') {
|
||||
$result2_stmt = Database::prepare('SELECT `id`, `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
|
||||
WHERE `adminid` = :adminid
|
||||
ORDER BY `logicalorder`, `name` ASC'
|
||||
);
|
||||
Database::pexecute($result2_stmt, array("adminid" => $userinfo['adminid']));
|
||||
|
||||
while ($row = $result2_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$categories.= makeoption($row['name'], $row['id']);
|
||||
}
|
||||
} else {
|
||||
$categories = makeoption($lng['ticket']['no_cat'], '0');
|
||||
}
|
||||
|
||||
$priorities = makeoption($lng['ticket']['high'], '1');
|
||||
$priorities.= makeoption($lng['ticket']['normal'], '2');
|
||||
$priorities.= makeoption($lng['ticket']['low'], '3');
|
||||
$ticketsopen = 0;
|
||||
$opentickets_stmt = Database::prepare('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `answerto` = "0"
|
||||
AND (`status` = "0" OR `status` = "1" OR `status` = "2")'
|
||||
);
|
||||
$opentickets = Database::pexecute_first($opentickets_stmt, array("customerid" => $userinfo['customerid']));
|
||||
|
||||
if (Settings::Get('ticket.concurrently_open') != -1 && Settings::Get('ticket.concurrently_open') != '') {
|
||||
$notmorethanxopentickets = strtr($lng['ticket']['notmorethanxopentickets'], array('%s' => Settings::Get('ticket.concurrently_open')));
|
||||
} else {
|
||||
$notmorethanxopentickets = '';
|
||||
}
|
||||
|
||||
$ticketsopen = (int)$opentickets['count'];
|
||||
|
||||
$ticket_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_add.php';
|
||||
$ticket_add_form = htmlform::genHTMLForm($ticket_add_data);
|
||||
|
||||
$title = $ticket_add_data['ticket_add']['title'];
|
||||
$image = $ticket_add_data['ticket_add']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("tickets/tickets_new") . "\";");
|
||||
}
|
||||
} else {
|
||||
standard_error('nomoreticketsavailable');
|
||||
}
|
||||
} elseif ($action == 'answer' && $id != 0) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$replyticket = ticket::getInstanceOf($userinfo, -1);
|
||||
$replyticket->Set('subject', validate($_POST['subject'], 'subject'), true, false);
|
||||
$replyticket->Set('priority', validate($_POST['priority'], 'priority'), true, false);
|
||||
$replyticket->Set('message', validate(str_replace("\r\n", "\n", $_POST['message']), 'message', '/^[^\0]*$/'), true, false);
|
||||
|
||||
if ($replyticket->Get('message') == null) {
|
||||
standard_error(array('stringisempty', 'mymessage'));
|
||||
} else {
|
||||
$now = time();
|
||||
$replyticket->Set('customer', (int)$userinfo['customerid'], true, true);
|
||||
$replyticket->Set('lastchange', $now, true, true);
|
||||
$replyticket->Set('ip', $_SERVER['REMOTE_ADDR'], true, true);
|
||||
$replyticket->Set('status', '1', true, true);
|
||||
$replyticket->Set('answerto', (int)$id, true, false);
|
||||
$replyticket->Set('by', '0', true, true);
|
||||
$replyticket->Insert();
|
||||
|
||||
// Update priority if changed
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
|
||||
if ($replyticket->Get('priority') != $mainticket->Get('priority')) {
|
||||
$mainticket->Set('priority', $replyticket->Get('priority'), true);
|
||||
}
|
||||
|
||||
$mainticket->Set('lastchange', $now);
|
||||
$mainticket->Set('lastreplier', '0');
|
||||
$mainticket->Set('status', '1');
|
||||
$mainticket->Update();
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "answered support-ticket '" . $mainticket->Get('subject') . "'");
|
||||
$mainticket->sendMail(-1, 'new_reply_ticket_by_customer_subject', $lng['mails']['new_reply_ticket_by_customer']['subject'], 'new_reply_ticket_by_customer_mailbody', $lng['mails']['new_reply_ticket_by_customer']['mailbody']);
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
} else {
|
||||
$ticket_replies = '';
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$dt = date("d.m.Y H:i\h", $mainticket->Get('dt'));
|
||||
$status = ticket::getStatusText($lng, $mainticket->Get('status'));
|
||||
|
||||
if ($mainticket->Get('status') >= 0 && $mainticket->Get('status') <= 2) {
|
||||
$isclosed = 0;
|
||||
} else {
|
||||
$isclosed = 1;
|
||||
}
|
||||
|
||||
if ($mainticket->Get('by') == '1') {
|
||||
$by = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$cid = $mainticket->Get('customer');
|
||||
$usr_stmt = Database::prepare('SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :customerid '
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array("customerid" => $cid));
|
||||
$by = getCorrectFullUserDetails($usr);
|
||||
}
|
||||
|
||||
$subject = $mainticket->Get('subject');
|
||||
$message = $mainticket->Get('message');
|
||||
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_main") . "\";");
|
||||
$result_stmt = Database::prepare('SELECT `name` FROM `' . TABLE_PANEL_TICKET_CATS . '`
|
||||
WHERE `id`= :id '
|
||||
);
|
||||
$row = Database::pexecute_first($result_stmt, array("id" => $mainticket->Get('category')));
|
||||
|
||||
$andere_stmt = Database::prepare('SELECT * FROM `' . TABLE_PANEL_TICKETS . '`
|
||||
WHERE `answerto`= :answerto
|
||||
ORDER BY `lastchange` ASC'
|
||||
);
|
||||
Database::pexecute($andere_stmt, array("answerto" => $id));
|
||||
$numrows_andere = Database::num_rows();
|
||||
|
||||
while ($row2 = $andere_stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
$subticket = ticket::getInstanceOf($userinfo, (int)$row2['id']);
|
||||
$lastchange = date("d.m.Y H:i\h", $subticket->Get('lastchange'));
|
||||
|
||||
if ($subticket->Get('by') == '1') {
|
||||
$by = $lng['ticket']['staff'];
|
||||
} else {
|
||||
$cid = $subticket->Get('customer');
|
||||
$usr_stmt = Database::prepare('
|
||||
SELECT `customerid`, `firstname`, `name`, `company`, `loginname`
|
||||
FROM `' . TABLE_PANEL_CUSTOMERS . '`
|
||||
WHERE `customerid` = :customerid '
|
||||
);
|
||||
$usr = Database::pexecute_first($usr_stmt, array("customerid" => $cid));
|
||||
$by = getCorrectFullUserDetails($usr);
|
||||
}
|
||||
|
||||
$subject = $subticket->Get('subject');
|
||||
$message = $subticket->Get('message');
|
||||
|
||||
$row2 = htmlentities_array($row2);
|
||||
eval("\$ticket_replies.=\"" . getTemplate("tickets/tickets_tickets_list") . "\";");
|
||||
}
|
||||
|
||||
$priorities = makeoption($lng['ticket']['high'], '1', $mainticket->Get('priority'), true, true);
|
||||
$priorities.= makeoption($lng['ticket']['normal'], '2', $mainticket->Get('priority'), true, true);
|
||||
$priorities.= makeoption($lng['ticket']['low'], '3', $mainticket->Get('priority'), true, true);
|
||||
$subject = htmlentities($mainticket->Get('subject'));
|
||||
$ticket_replies_count = $numrows_andere + 1;
|
||||
|
||||
// don't forget the main-ticket!
|
||||
$ticket_reply_data = include_once dirname(__FILE__).'/lib/formfields/customer/tickets/formfield.ticket_reply.php';
|
||||
$ticket_reply_form = htmlform::genHTMLForm($ticket_reply_data);
|
||||
|
||||
$title = $ticket_reply_data['ticket_reply']['title'];
|
||||
$image = $ticket_reply_data['ticket_reply']['image'];
|
||||
|
||||
eval("echo \"" . getTemplate("tickets/tickets_reply") . "\";");
|
||||
}
|
||||
} elseif ($action == 'close' && $id != 0) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$now = time();
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$mainticket->Set('lastchange', $now, true, true);
|
||||
$mainticket->Set('lastreplier', '0', true, true);
|
||||
$mainticket->Set('status', '3', true, true);
|
||||
$mainticket->Update();
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "closed support-ticket '" . $mainticket->Get('subject') . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
} else {
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
ask_yesno('ticket_reallyclose', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $mainticket->Get('subject'));
|
||||
}
|
||||
} elseif ($action == 'reopen' && $id != 0) {
|
||||
$ticketsopen = 0;
|
||||
$opentickets_stmt = Database::prepare('SELECT COUNT(`id`) as `count` FROM `' . TABLE_PANEL_TICKETS . '`
|
||||
WHERE `customerid` = :customerid
|
||||
AND `answerto` = "0"
|
||||
AND (`status` = "0" OR `status` = "1" OR `status` = "2")'
|
||||
);
|
||||
$opentickets = Database::pexecute_first($opentickets_stmt, array("customerid" => $userinfo['customerid']));
|
||||
$ticketsopen = (int)$opentickets['count'];
|
||||
|
||||
if ($ticketsopen > Settings::Get('ticket.concurrently_open') && Settings::Get('ticket.concurrently_open') != - 1 && Settings::Get('ticket.concurrently_open') != '') {
|
||||
standard_error('notmorethanxopentickets', Settings::Get('ticket.concurrently_open'));
|
||||
}
|
||||
|
||||
$now = time();
|
||||
$mainticket = ticket::getInstanceOf($userinfo, (int)$id);
|
||||
$mainticket->Set('lastchange', $now, true, true);
|
||||
$mainticket->Set('lastreplier', '0', true, true);
|
||||
$mainticket->Set('status', '0', true, true);
|
||||
$mainticket->Update();
|
||||
$log->logAction(USR_ACTION, LOG_NOTICE, "reopened support-ticket '" . $mainticket->Get('subject') . "'");
|
||||
redirectTo($filename, array('page' => $page, 's' => $s));
|
||||
}
|
||||
}
|
||||
@@ -16,10 +16,18 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'customer');
|
||||
$intrafficpage = 1;
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
|
||||
// redirect if this customer page is hidden via settings
|
||||
if (Settings::IsInList('panel.customer_hide_options', 'traffic')) {
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php');
|
||||
}
|
||||
|
||||
$traffic = '';
|
||||
$month = null;
|
||||
$year = null;
|
||||
@@ -30,8 +38,7 @@ if (isset($_POST['month']) && isset($_POST['year'])) {
|
||||
} elseif (isset($_GET['month']) && isset($_GET['year'])) {
|
||||
$month = intval($_GET['month']);
|
||||
$year = intval($_GET['year']);
|
||||
}
|
||||
//BAM! $_GET???
|
||||
} // BAM! $_GET???
|
||||
elseif (isset($_GET['page']) && $_GET['page'] == 'current') {
|
||||
if (date('d') != '01') {
|
||||
$month = date('m');
|
||||
@@ -55,8 +62,7 @@ if (!is_null($month) && !is_null($year)) {
|
||||
AND `month` = :month
|
||||
AND `year` = :year
|
||||
GROUP BY `day`
|
||||
ORDER BY `day` DESC"
|
||||
);
|
||||
ORDER BY `day` DESC");
|
||||
$params = array(
|
||||
"customerid" => $userinfo['customerid'],
|
||||
"month" => $month,
|
||||
@@ -96,24 +102,24 @@ if (!is_null($month) && !is_null($year)) {
|
||||
$traf['byte'] = round($traf['byte'] / 1024, Settings::Get('panel.decimal_places'));
|
||||
}
|
||||
|
||||
eval("\$traffic.=\"" . getTemplate('traffic/traffic_month') . "\";");
|
||||
eval("\$traffic.=\"" . \Froxlor\UI\Template::getTemplate('traffic/traffic_month') . "\";");
|
||||
$show = $lng['traffic']['months'][intval($row['month'])] . ' ' . $row['year'];
|
||||
}
|
||||
|
||||
$traffic_complete['http'] = size_readable($traffic_complete['http'] * 1024, 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s');
|
||||
$traffic_complete['ftp'] = size_readable($traffic_complete['ftp'] * 1024, 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s');
|
||||
$traffic_complete['mail'] = size_readable($traffic_complete['mail'] * 1024, 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s');
|
||||
$traffic_complete['http'] = \Froxlor\PhpHelper::sizeReadable($traffic_complete['http'] * 1024, 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
$traffic_complete['ftp'] = \Froxlor\PhpHelper::sizeReadable($traffic_complete['ftp'] * 1024, 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
$traffic_complete['mail'] = \Froxlor\PhpHelper::sizeReadable($traffic_complete['mail'] * 1024, 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
|
||||
eval("echo \"" . getTemplate('traffic/traffic_details') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('traffic/traffic_details') . "\";");
|
||||
} else {
|
||||
$result_stmt = Database::prepare("SELECT `month`, `year`, SUM(`http`) AS http, SUM(`ftp_up`) AS ftp_up, SUM(`ftp_down`) AS ftp_down, SUM(`mail`) AS mail
|
||||
FROM `" . TABLE_PANEL_TRAFFIC . "`
|
||||
WHERE `customerid` = :customerid
|
||||
GROUP BY CONCAT(`year`,`month`)
|
||||
ORDER BY CONCAT(`year`,`month`) DESC
|
||||
LIMIT 12"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("customerid" => $userinfo['customerid']));
|
||||
GROUP BY `year` DESC, `month` DESC
|
||||
LIMIT 12");
|
||||
Database::pexecute($result_stmt, array(
|
||||
"customerid" => $userinfo['customerid']
|
||||
));
|
||||
$traffic_complete['http'] = 0;
|
||||
$traffic_complete['ftp'] = 0;
|
||||
$traffic_complete['mail'] = 0;
|
||||
@@ -149,12 +155,12 @@ if (!is_null($month) && !is_null($year)) {
|
||||
$traf['byte'] = round($traf['byte'] / (1024 * 1024), Settings::Get('panel.decimal_places'));
|
||||
}
|
||||
|
||||
eval("\$traffic.=\"" . getTemplate('traffic/traffic_traffic') . "\";");
|
||||
eval("\$traffic.=\"" . \Froxlor\UI\Template::getTemplate('traffic/traffic_traffic') . "\";");
|
||||
}
|
||||
|
||||
$traffic_complete['http'] = size_readable($traffic_complete['http'] * 1024, 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s');
|
||||
$traffic_complete['ftp'] = size_readable($traffic_complete['ftp'] * 1024, 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s');
|
||||
$traffic_complete['mail'] = size_readable($traffic_complete['mail'] * 1024, 'GiB', 'bi', '%01.'.(int)Settings::Get('panel.decimal_places').'f %s');
|
||||
$traffic_complete['http'] = \Froxlor\PhpHelper::sizeReadable($traffic_complete['http'] * 1024, 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
$traffic_complete['ftp'] = \Froxlor\PhpHelper::sizeReadable($traffic_complete['ftp'] * 1024, 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
$traffic_complete['mail'] = \Froxlor\PhpHelper::sizeReadable($traffic_complete['mail'] * 1024, 'GiB', 'bi', '%01.' . (int) Settings::Get('panel.decimal_places') . 'f %s');
|
||||
|
||||
eval("echo \"" . getTemplate('traffic/traffic') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('traffic/traffic') . "\";");
|
||||
}
|
||||
|
||||
134
dns_editor.php
Normal file
@@ -0,0 +1,134 @@
|
||||
<?php
|
||||
if (! defined('AREA')) {
|
||||
header("Location: index.php");
|
||||
exit();
|
||||
}
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2016 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2016-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Api\Commands\DomainZones as DomainZones;
|
||||
|
||||
// This file is being included in admin_domains and customer_domains
|
||||
// and therefore does not need to require lib/init.php
|
||||
|
||||
$domain_id = isset($_GET['domain_id']) ? (int) $_GET['domain_id'] : null;
|
||||
|
||||
$record = isset($_POST['record']['record']) ? trim($_POST['record']['record']) : null;
|
||||
$type = isset($_POST['record']['type']) ? $_POST['record']['type'] : 'A';
|
||||
$prio = isset($_POST['record']['prio']) ? (int) $_POST['record']['prio'] : null;
|
||||
$content = isset($_POST['record']['content']) ? trim($_POST['record']['content']) : null;
|
||||
$ttl = isset($_POST['record']['ttl']) ? (int) $_POST['record']['ttl'] : 18000;
|
||||
|
||||
// get domain-name
|
||||
$domain = \Froxlor\Dns\Dns::getAllowedDomainEntry($domain_id, AREA, $userinfo);
|
||||
|
||||
// select all entries
|
||||
$sel_stmt = Database::prepare("SELECT * FROM `" . TABLE_DOMAIN_DNS . "` WHERE domain_id = :did");
|
||||
Database::pexecute($sel_stmt, array(
|
||||
'did' => $domain_id
|
||||
));
|
||||
$dom_entries = $sel_stmt->fetchAll(PDO::FETCH_ASSOC);
|
||||
|
||||
$errors = "";
|
||||
$success_message = "";
|
||||
|
||||
// action for adding a new entry
|
||||
if ($action == 'add_record' && ! empty($_POST)) {
|
||||
try {
|
||||
DomainZones::getLocal($userinfo, array(
|
||||
'id' => $domain_id,
|
||||
'record' => $record,
|
||||
'type' => $type,
|
||||
'prio' => $prio,
|
||||
'content' => $content,
|
||||
'ttl' => $ttl
|
||||
))->add();
|
||||
$success_message = $lng['success']['dns_record_added'];
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
} elseif ($action == 'delete') {
|
||||
// remove entry
|
||||
$entry_id = isset($_GET['id']) ? (int) $_GET['id'] : 0;
|
||||
if ($entry_id > 0) {
|
||||
try {
|
||||
DomainZones::getLocal($userinfo, array(
|
||||
'entry_id' => $entry_id,
|
||||
'id' => $domain_id
|
||||
))->delete();
|
||||
} catch (Exception $e) {
|
||||
$errors = str_replace("\n", "<br>", $e->getMessage());
|
||||
}
|
||||
|
||||
if (empty($errors)) {
|
||||
// remove deleted entry from internal data array (no reread of DB necessary)
|
||||
$_t = $dom_entries;
|
||||
foreach ($_t as $idx => $entry) {
|
||||
if ($entry['id'] == $entry_id) {
|
||||
unset($dom_entries[$idx]);
|
||||
break;
|
||||
}
|
||||
}
|
||||
unset($_t);
|
||||
// success message (inline)
|
||||
$success_message = $lng['success']['dns_record_deleted'];
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// show editor
|
||||
$record_list = "";
|
||||
$existing_entries = "";
|
||||
$type_select = "";
|
||||
$entriescount = 0;
|
||||
|
||||
if (! empty($dom_entries)) {
|
||||
$entriescount = count($dom_entries);
|
||||
foreach ($dom_entries as $entry) {
|
||||
$entry['content'] = wordwrap($entry['content'], 100, '<br>', true);
|
||||
eval("\$existing_entries.=\"" . \Froxlor\UI\Template::getTemplate("dns_editor/entry_bit", true) . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
// available types
|
||||
$type_select_values = array(
|
||||
'A',
|
||||
'AAAA',
|
||||
'NS',
|
||||
'MX',
|
||||
'SRV',
|
||||
'TXT',
|
||||
'CNAME'
|
||||
);
|
||||
asort($type_select_values);
|
||||
foreach ($type_select_values as $_type) {
|
||||
$type_select .= \Froxlor\UI\HTML::makeoption($_type, $_type, $type);
|
||||
}
|
||||
|
||||
eval("\$record_list=\"" . \Froxlor\UI\Template::getTemplate("dns_editor/list", true) . "\";");
|
||||
|
||||
try {
|
||||
$json_result = DomainZones::getLocal($userinfo, array(
|
||||
'id' => $domain_id
|
||||
))->get();
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\UI\Response::dynamic_error($e->getMessage());
|
||||
}
|
||||
$result = json_decode($json_result, true)['data'];
|
||||
$zonefile = implode("\n", $result);
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate("dns_editor/index", true) . "\";");
|
||||
208
doc/example/FroxlorAPI.php
Normal file
@@ -0,0 +1,208 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2018 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2018-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package API-example
|
||||
* @since 0.10.0
|
||||
*
|
||||
*/
|
||||
class FroxlorAPI
|
||||
{
|
||||
|
||||
/**
|
||||
* URL to api.php of your froxlor installation
|
||||
*
|
||||
* @var string
|
||||
*/
|
||||
private $host = "";
|
||||
|
||||
/**
|
||||
* your api-key
|
||||
*
|
||||
* @var string
|
||||
*/
|
||||
private $api_key = "";
|
||||
|
||||
/**
|
||||
* your api-secret
|
||||
*
|
||||
* @var string
|
||||
*/
|
||||
private $api_secret = "";
|
||||
|
||||
/**
|
||||
* last cURL error message
|
||||
*
|
||||
* @var string
|
||||
*/
|
||||
private $last_error = "";
|
||||
|
||||
/**
|
||||
* last response header received
|
||||
*
|
||||
* @var array
|
||||
*/
|
||||
private $last_header = array();
|
||||
|
||||
/**
|
||||
* last response data received
|
||||
*
|
||||
* @var array
|
||||
*/
|
||||
private $last_body = array();
|
||||
|
||||
/**
|
||||
* create FroxlorAPI object
|
||||
*
|
||||
* @param string $host
|
||||
* URL to api.php of your froxlor installation
|
||||
* @param string $api_key
|
||||
* your api-key
|
||||
* @param string $api_secret
|
||||
* your api-secret
|
||||
*
|
||||
* @return FroxlorAPI
|
||||
*/
|
||||
public function __construct(string $host, string $api_key, string $api_secret)
|
||||
{
|
||||
$this->host = $host;
|
||||
$this->api_key = $api_key;
|
||||
$this->api_secret = $api_secret;
|
||||
}
|
||||
|
||||
/**
|
||||
* send request to froxlor api
|
||||
*
|
||||
* @param string $command
|
||||
* @param array $params
|
||||
*
|
||||
* @return FroxlorAPI
|
||||
*/
|
||||
public function request(string $command, array $params = array()): FroxlorAPI
|
||||
{
|
||||
// build request array
|
||||
$request = [
|
||||
'header' => [
|
||||
'apikey' => $this->api_key,
|
||||
'secret' => $this->api_secret
|
||||
],
|
||||
'body' => [
|
||||
'command' => $command
|
||||
]
|
||||
];
|
||||
|
||||
// add parameter to request-body if any
|
||||
if (! empty($params)) {
|
||||
$request['body']['params'] = $params;
|
||||
}
|
||||
|
||||
// reset last data
|
||||
$this->last_header = array();
|
||||
$this->last_body = array();
|
||||
|
||||
// send actual request
|
||||
$response = $this->requestCurl(json_encode($request));
|
||||
|
||||
// decode response
|
||||
$resp = json_decode($response[1], true);
|
||||
// set body to data-part of response
|
||||
$this->last_body = $resp['data'];
|
||||
// set header of response
|
||||
$this->last_header = [
|
||||
'status' => $resp['status'],
|
||||
'status_message' => $resp['status_message']
|
||||
];
|
||||
|
||||
// check for error in api response
|
||||
if (isset($this->last_header['status']) && $this->last_header['status'] >= 400) {
|
||||
// set last-error message
|
||||
$this->last_error .= "[" . $this->last_header['status'] . "] " . $this->last_header['status_message'];
|
||||
}
|
||||
|
||||
return $this;
|
||||
}
|
||||
|
||||
/**
|
||||
* returns last response header
|
||||
*
|
||||
* @return array status|status_message
|
||||
*/
|
||||
public function getLastHeader(): array
|
||||
{
|
||||
return $this->last_header;
|
||||
}
|
||||
|
||||
/**
|
||||
* returns last response data
|
||||
*
|
||||
* @return array
|
||||
*/
|
||||
public function getLastResponse(): array
|
||||
{
|
||||
return $this->last_body;
|
||||
}
|
||||
|
||||
/**
|
||||
* return last known error message
|
||||
*
|
||||
* @return string
|
||||
*/
|
||||
public function getLastError(): string
|
||||
{
|
||||
return $this->last_error;
|
||||
}
|
||||
|
||||
/**
|
||||
* send cURL request to api
|
||||
*
|
||||
* @param string $data
|
||||
* json array
|
||||
*
|
||||
* @return array header|body
|
||||
*/
|
||||
private function requestCurl(string $data): array
|
||||
{
|
||||
// reset last error message
|
||||
$this->last_error = "";
|
||||
|
||||
$ch = curl_init($this->host);
|
||||
curl_setopt($ch, CURLOPT_POST, 1);
|
||||
curl_setopt($ch, CURLOPT_POSTFIELDS, $data);
|
||||
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
|
||||
curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE);
|
||||
curl_setopt($ch, CURLOPT_HTTPHEADER, array(
|
||||
'Content-type: application/json'
|
||||
));
|
||||
curl_setopt($ch, CURLOPT_POSTFIELDS, $data);
|
||||
curl_setopt($ch, CURLOPT_VERBOSE, true);
|
||||
curl_setopt($ch, CURLOPT_HEADER, 1);
|
||||
$verbose = fopen('php://temp', 'w+');
|
||||
curl_setopt($ch, CURLOPT_STDERR, $verbose);
|
||||
|
||||
if (! $data = curl_exec($ch)) {
|
||||
$this->last_error = 'Curl execution error: ' . curl_error($ch) . "\n";
|
||||
rewind($verbose);
|
||||
$verboseLog = stream_get_contents($verbose);
|
||||
$this->last_error .= "Verbose information: " . htmlspecialchars($verboseLog) . "\n";
|
||||
}
|
||||
|
||||
$header_size = curl_getinfo($ch, CURLINFO_HEADER_SIZE);
|
||||
$header = substr($data, 0, $header_size);
|
||||
$body = substr($data, $header_size);
|
||||
|
||||
curl_close($ch);
|
||||
return array(
|
||||
$header,
|
||||
$body
|
||||
);
|
||||
}
|
||||
}
|
||||
48
doc/example/create_customer.php
Normal file
@@ -0,0 +1,48 @@
|
||||
<?php
|
||||
|
||||
// include FroxlorAPI helper class
|
||||
require __DIR__ . '/FroxlorAPI.php';
|
||||
|
||||
// create object of FroxlorAPI with URL, apikey and apisecret
|
||||
$fapi = new FroxlorAPI('https://froxlor.your-host.tld/api.php', 'your-api-key', 'your-api-secret');
|
||||
|
||||
// customer data
|
||||
$data = [
|
||||
'new_loginname' => 'test',
|
||||
'email' => 'test@froxlor.org',
|
||||
'firstname' => 'Test',
|
||||
'name' => 'Testman',
|
||||
'customernumber' => 1337,
|
||||
'new_customer_password' => 's0mEcRypt1cpassword' . uniqid()
|
||||
];
|
||||
// send request
|
||||
$fapi->request('Customers.add', $data);
|
||||
|
||||
// check for error
|
||||
if (! empty($fapi->getLastError())) {
|
||||
echo "Error: " . $fapi->getLastError();
|
||||
exit();
|
||||
}
|
||||
|
||||
// get response of request
|
||||
$request = $fapi->getLastResponse();
|
||||
|
||||
// view response data
|
||||
var_dump($request);
|
||||
|
||||
/*
|
||||
array(60) {
|
||||
["customerid"]=>
|
||||
string(1) "1"
|
||||
["loginname"]=>
|
||||
string(4) "test"
|
||||
["password"]=>
|
||||
string(63) "$5$asdasdasd.asdasd"
|
||||
["adminid"]=>
|
||||
string(1) "1"
|
||||
["name"]=>
|
||||
string(7) "Testman"
|
||||
["firstname"]=>
|
||||
string(4) "Test"
|
||||
[...]
|
||||
*/
|
||||
22
doc/example/list_functions.php
Normal file
@@ -0,0 +1,22 @@
|
||||
<?php
|
||||
|
||||
// include FroxlorAPI helper class
|
||||
require __DIR__ . '/FroxlorAPI.php';
|
||||
|
||||
// create object of FroxlorAPI with URL, apikey and apisecret
|
||||
$fapi = new FroxlorAPI('https://froxlor.your-host.tld/api.php', 'your-api-key', 'your-api-secret');
|
||||
|
||||
// send request
|
||||
$fapi->request('Froxlor.listFunctions');
|
||||
|
||||
// check for error
|
||||
if (! empty($fapi->getLastError())) {
|
||||
echo "Error: " . $fapi->getLastError();
|
||||
exit();
|
||||
}
|
||||
|
||||
// get response of request
|
||||
$request = $fapi->getLastResponse();
|
||||
|
||||
// view response data
|
||||
var_dump($request);
|
||||
627
index.php
@@ -16,23 +16,102 @@
|
||||
* @package Panel
|
||||
*
|
||||
*/
|
||||
|
||||
define('AREA', 'login');
|
||||
require './lib/init.php';
|
||||
|
||||
use Froxlor\Database\Database;
|
||||
use Froxlor\Settings;
|
||||
use Froxlor\FroxlorLogger;
|
||||
|
||||
if ($action == '') {
|
||||
$action = 'login';
|
||||
}
|
||||
|
||||
if ($action == 'login') {
|
||||
if (session_status() == PHP_SESSION_NONE) {
|
||||
session_start();
|
||||
}
|
||||
|
||||
if ($action == '2fa_entercode') {
|
||||
// page for entering the 2FA code after successful login
|
||||
if (! isset($_SESSION) || ! isset($_SESSION['secret_2fa'])) {
|
||||
// no session - redirect to index
|
||||
\Froxlor\UI\Response::redirectTo('index.php');
|
||||
exit();
|
||||
}
|
||||
// show template to enter code
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('2fa/entercode', true) . "\";");
|
||||
} elseif ($action == '2fa_verify') {
|
||||
// verify code from 2fa code-enter form
|
||||
if (! isset($_SESSION) || ! isset($_SESSION['secret_2fa'])) {
|
||||
// no session - redirect to index
|
||||
\Froxlor\UI\Response::redirectTo('index.php');
|
||||
exit();
|
||||
}
|
||||
$code = isset($_POST['2fa_code']) ? $_POST['2fa_code'] : null;
|
||||
// verify entered code
|
||||
$tfa = new \Froxlor\FroxlorTwoFactorAuth('Froxlor');
|
||||
$result = ($_SESSION['secret_2fa'] == 'email' ? true : $tfa->verifyCode($_SESSION['secret_2fa'], $code, 3));
|
||||
// either the code is valid when using authenticator-app, or we will select userdata by id and entered code
|
||||
// which is temporarily stored for the customer when using email-2fa
|
||||
if ($result) {
|
||||
// get user-data
|
||||
$table = $_SESSION['uidtable_2fa'];
|
||||
$field = $_SESSION['uidfield_2fa'];
|
||||
$uid = $_SESSION['uid_2fa'];
|
||||
$isadmin = $_SESSION['unfo_2fa'];
|
||||
$sel_param = array(
|
||||
'uid' => $uid
|
||||
);
|
||||
if ($_SESSION['secret_2fa'] == 'email') {
|
||||
// verify code by selecting user by id and the temp. stored code,
|
||||
// so only if it's the correct code, we get the user-data
|
||||
$sel_stmt = Database::prepare("SELECT * FROM $table WHERE `" . $field . "` = :uid AND `data_2fa` = :code");
|
||||
$sel_param['code'] = $code;
|
||||
} else {
|
||||
// Authenticator-verification has already happened at this point, so just get the user-data
|
||||
$sel_stmt = Database::prepare("SELECT * FROM $table WHERE `" . $field . "` = :uid");
|
||||
}
|
||||
$userinfo = Database::pexecute_first($sel_stmt, $sel_param);
|
||||
// whoops, no (valid) user? Start again
|
||||
if (empty($userinfo)) {
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '2'
|
||||
));
|
||||
}
|
||||
// set fields in $userinfo required for finishLogin()
|
||||
$userinfo['adminsession'] = $isadmin;
|
||||
$userinfo['userid'] = $uid;
|
||||
|
||||
// if not successful somehow - start again
|
||||
if (! finishLogin($userinfo)) {
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '2'
|
||||
));
|
||||
}
|
||||
|
||||
// when using email-2fa, remove the one-time-code
|
||||
if ($userinfo['type_2fa'] == '1') {
|
||||
$del_stmt = Database::prepare("UPDATE $table SET `data_2fa` = '' WHERE `" . $field . "` = :uid");
|
||||
$userinfo = Database::pexecute_first($del_stmt, array(
|
||||
'uid' => $uid
|
||||
));
|
||||
}
|
||||
exit();
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '2'
|
||||
));
|
||||
exit();
|
||||
} elseif ($action == 'login') {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$loginname = validate($_POST['loginname'], 'loginname');
|
||||
$password = validate($_POST['password'], 'password');
|
||||
$loginname = \Froxlor\Validate\Validate::validate($_POST['loginname'], 'loginname');
|
||||
$password = \Froxlor\Validate\Validate::validate($_POST['password'], 'password');
|
||||
|
||||
$stmt = Database::prepare("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
WHERE `loginname`= :loginname"
|
||||
);
|
||||
Database::pexecute($stmt, array("loginname" => $loginname));
|
||||
WHERE `loginname`= :loginname");
|
||||
Database::pexecute($stmt, array(
|
||||
"loginname" => $loginname
|
||||
));
|
||||
$row = $stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if ($row['customer'] == $loginname) {
|
||||
@@ -43,20 +122,25 @@ if ($action == 'login') {
|
||||
} else {
|
||||
$is_admin = true;
|
||||
if ((int) Settings::Get('login.domain_login') == 1) {
|
||||
$domainname = $idna_convert->encode(preg_replace(array('/\:(\d)+$/', '/^https?\:\/\//'), '', $loginname));
|
||||
$domainname = $idna_convert->encode(preg_replace(array(
|
||||
'/\:(\d)+$/',
|
||||
'/^https?\:\/\//'
|
||||
), '', $loginname));
|
||||
$stmt = Database::prepare("SELECT `customerid` FROM `" . TABLE_PANEL_DOMAINS . "`
|
||||
WHERE `domain` = :domain"
|
||||
);
|
||||
Database::pexecute($stmt, array("domain" => $domainname));
|
||||
WHERE `domain` = :domain");
|
||||
Database::pexecute($stmt, array(
|
||||
"domain" => $domainname
|
||||
));
|
||||
$row2 = $stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if (isset($row2['customerid']) && $row2['customerid'] > 0) {
|
||||
$loginname = getCustomerDetail($row2['customerid'], 'loginname');
|
||||
$loginname = \Froxlor\Customer\Customer::getCustomerDetail($row2['customerid'], 'loginname');
|
||||
if ($loginname !== false) {
|
||||
$stmt = Database::prepare("SELECT `loginname` AS `customer` FROM `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
WHERE `loginname`= :loginname"
|
||||
);
|
||||
Database::pexecute($stmt, array("loginname" => $loginname));
|
||||
WHERE `loginname`= :loginname");
|
||||
Database::pexecute($stmt, array(
|
||||
"loginname" => $loginname
|
||||
));
|
||||
$row3 = $stmt->fetch(PDO::FETCH_ASSOC);
|
||||
if ($row3['customer'] == $loginname) {
|
||||
$table = "`" . TABLE_PANEL_CUSTOMERS . "`";
|
||||
@@ -69,29 +153,31 @@ if ($action == 'login') {
|
||||
}
|
||||
}
|
||||
|
||||
if (hasUpdates($version) && $is_admin == false) {
|
||||
redirectTo('index.php');
|
||||
exit;
|
||||
if ((\Froxlor\Froxlor::hasUpdates() || \Froxlor\Froxlor::hasDbUpdates()) && $is_admin == false) {
|
||||
\Froxlor\UI\Response::redirectTo('index.php');
|
||||
exit();
|
||||
}
|
||||
|
||||
if ($is_admin) {
|
||||
if (hasUpdates($version)) {
|
||||
if (\Froxlor\Froxlor::hasUpdates() || \Froxlor\Froxlor::hasDbUpdates()) {
|
||||
$stmt = Database::prepare("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "`
|
||||
WHERE `loginname`= :loginname
|
||||
AND `change_serversettings` = '1'"
|
||||
);
|
||||
Database::pexecute($stmt, array("loginname" => $loginname));
|
||||
AND `change_serversettings` = '1'");
|
||||
Database::pexecute($stmt, array(
|
||||
"loginname" => $loginname
|
||||
));
|
||||
$row = $stmt->fetch(PDO::FETCH_ASSOC);
|
||||
if (! isset($row['admin'])) {
|
||||
// not an admin who can see updates
|
||||
redirectTo('index.php');
|
||||
exit;
|
||||
\Froxlor\UI\Response::redirectTo('index.php');
|
||||
exit();
|
||||
}
|
||||
} else {
|
||||
$stmt = Database::prepare("SELECT `loginname` AS `admin` FROM `" . TABLE_PANEL_ADMINS . "`
|
||||
WHERE `loginname`= :loginname"
|
||||
);
|
||||
Database::pexecute($stmt, array("loginname" => $loginname));
|
||||
WHERE `loginname`= :loginname");
|
||||
Database::pexecute($stmt, array(
|
||||
"loginname" => $loginname
|
||||
));
|
||||
$row = $stmt->fetch(PDO::FETCH_ASSOC);
|
||||
}
|
||||
|
||||
@@ -101,145 +187,148 @@ if ($action == 'login') {
|
||||
$adminsession = '1';
|
||||
} else {
|
||||
// Log failed login
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => $_SERVER['REMOTE_ADDR']));
|
||||
$rstlog->logAction(LOGIN_ACTION, LOG_WARNING, "Unknown user '" . $loginname . "' tried to login.");
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array(
|
||||
'loginname' => $_SERVER['REMOTE_ADDR']
|
||||
));
|
||||
$rstlog->logAction(\Froxlor\FroxlorLogger::LOGIN_ACTION, LOG_WARNING, "Unknown user '" . $loginname . "' tried to login.");
|
||||
|
||||
redirectTo('index.php', array('showmessage' => '2'));
|
||||
exit;
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '2'
|
||||
));
|
||||
exit();
|
||||
}
|
||||
}
|
||||
|
||||
$userinfo_stmt = Database::prepare("SELECT * FROM $table
|
||||
WHERE `loginname`= :loginname"
|
||||
);
|
||||
Database::pexecute($userinfo_stmt, array("loginname" => $loginname));
|
||||
WHERE `loginname`= :loginname");
|
||||
Database::pexecute($userinfo_stmt, array(
|
||||
"loginname" => $loginname
|
||||
));
|
||||
$userinfo = $userinfo_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
|
||||
if ($userinfo['loginfail_count'] >= Settings::Get('login.maxloginattempts') && $userinfo['lastlogin_fail'] > (time() - Settings::Get('login.deactivatetime'))) {
|
||||
redirectTo('index.php', array('showmessage' => '3'));
|
||||
exit;
|
||||
} elseif (validatePasswordLogin($userinfo, $password, $table, $uid)) {
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '3'
|
||||
));
|
||||
exit();
|
||||
} elseif (\Froxlor\System\Crypt::validatePasswordLogin($userinfo, $password, $table, $uid)) {
|
||||
// only show "you're banned" if the login was successful
|
||||
// because we don't want to publish that the user does exist
|
||||
if ($userinfo['deactivated']) {
|
||||
unset($userinfo);
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '5'
|
||||
));
|
||||
exit();
|
||||
} else {
|
||||
// login correct
|
||||
// reset loginfail_counter, set lastlogin_succ
|
||||
$stmt = Database::prepare("UPDATE $table
|
||||
SET `lastlogin_succ`= :lastlogin_succ, `loginfail_count`='0'
|
||||
WHERE `$uid`= :uid"
|
||||
);
|
||||
Database::pexecute($stmt, array("lastlogin_succ" => time(), "uid" => $userinfo[$uid]));
|
||||
WHERE `$uid`= :uid");
|
||||
Database::pexecute($stmt, array(
|
||||
"lastlogin_succ" => time(),
|
||||
"uid" => $userinfo[$uid]
|
||||
));
|
||||
$userinfo['userid'] = $userinfo[$uid];
|
||||
$userinfo['adminsession'] = $adminsession;
|
||||
}
|
||||
} else {
|
||||
// login incorrect
|
||||
$stmt = Database::prepare("UPDATE $table
|
||||
SET `lastlogin_fail`= :lastlogin_fail, `loginfail_count`=`loginfail_count`+1
|
||||
WHERE `$uid`= :uid"
|
||||
);
|
||||
Database::pexecute($stmt, array("lastlogin_fail" => time(), "uid" => $userinfo[$uid]));
|
||||
WHERE `$uid`= :uid");
|
||||
Database::pexecute($stmt, array(
|
||||
"lastlogin_fail" => time(),
|
||||
"uid" => $userinfo[$uid]
|
||||
));
|
||||
|
||||
// Log failed login
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => $_SERVER['REMOTE_ADDR']));
|
||||
$rstlog->logAction(LOGIN_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to login with wrong password.");
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array(
|
||||
'loginname' => $_SERVER['REMOTE_ADDR']
|
||||
));
|
||||
$rstlog->logAction(\Froxlor\FroxlorLogger::LOGIN_ACTION, LOG_WARNING, "User '" . $loginname . "' tried to login with wrong password.");
|
||||
|
||||
unset($userinfo);
|
||||
redirectTo('index.php', array('showmessage' => '2'));
|
||||
exit;
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '2'
|
||||
));
|
||||
exit();
|
||||
}
|
||||
|
||||
if (isset($userinfo['userid']) && $userinfo['userid'] != '') {
|
||||
$s = md5(uniqid(microtime(), 1));
|
||||
|
||||
if (isset($_POST['language'])) {
|
||||
$language = validate($_POST['language'], 'language');
|
||||
if ($language == 'profile') {
|
||||
$language = $userinfo['def_language'];
|
||||
} elseif (!isset($languages[$language])) {
|
||||
$language = Settings::Get('panel.standardlanguage');
|
||||
}
|
||||
} else {
|
||||
$language = Settings::Get('panel.standardlanguage');
|
||||
}
|
||||
|
||||
if (isset($userinfo['theme']) && $userinfo['theme'] != '') {
|
||||
$theme = $userinfo['theme'];
|
||||
} else {
|
||||
$theme = Settings::Get('panel.default_theme');
|
||||
}
|
||||
|
||||
if (Settings::Get('session.allow_multiple_login') != '1') {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_SESSIONS . "`
|
||||
WHERE `userid` = :uid
|
||||
AND `adminsession` = :adminsession"
|
||||
// 2FA activated
|
||||
if (Settings::Get('2fa.enabled') == '1' && $userinfo['type_2fa'] > 0) {
|
||||
// redirect to code-enter-page
|
||||
$_SESSION['secret_2fa'] = ($userinfo['type_2fa'] == 2 ? $userinfo['data_2fa'] : 'email');
|
||||
$_SESSION['uid_2fa'] = $userinfo[$uid];
|
||||
$_SESSION['uidfield_2fa'] = $uid;
|
||||
$_SESSION['uidtable_2fa'] = $table;
|
||||
$_SESSION['unfo_2fa'] = $is_admin;
|
||||
// send mail if type_2fa = 1 (email)
|
||||
if ($userinfo['type_2fa'] == 1) {
|
||||
// generate code
|
||||
$tfa = new \Froxlor\FroxlorTwoFactorAuth('Froxlor');
|
||||
$code = $tfa->getCode($tfa->createSecret());
|
||||
// set code for user
|
||||
$stmt = Database::prepare("UPDATE $table SET `data_2fa` = :d2fa WHERE `$uid` = :uid");
|
||||
Database::pexecute($stmt, array(
|
||||
"d2fa" => $code,
|
||||
"uid" => $userinfo[$uid]
|
||||
));
|
||||
// build up & send email
|
||||
$_mailerror = false;
|
||||
$mailerr_msg = "";
|
||||
$replace_arr = array(
|
||||
'CODE' => $code
|
||||
);
|
||||
Database::pexecute($stmt, array("uid" => $userinfo['userid'], "adminsession" => $userinfo['adminsession']));
|
||||
$mail_body = html_entity_decode(\Froxlor\PhpHelper::replaceVariables($lng['mails']['2fa']['mailbody'], $replace_arr));
|
||||
|
||||
try {
|
||||
$mail->Subject = $lng['mails']['2fa']['subject'];
|
||||
$mail->AltBody = $mail_body;
|
||||
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
|
||||
$mail->AddAddress($userinfo['email'], \Froxlor\User::getCorrectUserSalutation($userinfo));
|
||||
$mail->Send();
|
||||
} catch (\PHPMailer\PHPMailer\Exception $e) {
|
||||
$mailerr_msg = $e->errorMessage();
|
||||
$_mailerror = true;
|
||||
} catch (Exception $e) {
|
||||
$mailerr_msg = $e->getMessage();
|
||||
$_mailerror = true;
|
||||
}
|
||||
|
||||
// check for field 'theme' in session-table, refs #607
|
||||
// Changed with #1287 to new method
|
||||
$theme_field = false;
|
||||
$stmt = Database::query("SHOW COLUMNS FROM panel_sessions LIKE 'theme'");
|
||||
while ($row = $stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ($row['Field'] == "theme") {
|
||||
$has_theme = true;
|
||||
}
|
||||
if ($_mailerror) {
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array(
|
||||
'loginname' => '2fa code-sending'
|
||||
));
|
||||
$rstlog->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '4',
|
||||
'customermail' => $userinfo['email']
|
||||
));
|
||||
exit();
|
||||
}
|
||||
|
||||
$params = array(
|
||||
"hash" => $s,
|
||||
"userid" => $userinfo['userid'],
|
||||
"ipaddress" => $remote_addr,
|
||||
"useragent" => $http_user_agent,
|
||||
"lastactivity" => time(),
|
||||
"language" => $language,
|
||||
"adminsession" => $userinfo['adminsession']
|
||||
);
|
||||
$mail->ClearAddresses();
|
||||
}
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'action' => '2fa_entercode'
|
||||
));
|
||||
exit();
|
||||
}
|
||||
|
||||
if ($has_theme) {
|
||||
$params["theme"] = $theme;
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_SESSIONS . "`
|
||||
(`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`)
|
||||
VALUES (:hash, :userid, :ipaddress, :useragent, :lastactivity, :language, :adminsession, :theme)"
|
||||
);
|
||||
} else {
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_SESSIONS . "`
|
||||
(`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`)
|
||||
VALUES (:hash, :userid, :ipaddress, :useragent, :lastactivity, :language, :adminsession)"
|
||||
);
|
||||
if (! finishLogin($userinfo)) {
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '2'
|
||||
));
|
||||
}
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$qryparams = array();
|
||||
if (isset($_POST['qrystr']) && $_POST['qrystr'] != "") {
|
||||
parse_str(urldecode($_POST['qrystr']), $qryparams);
|
||||
}
|
||||
$qryparams['s'] = $s;
|
||||
|
||||
if ($userinfo['adminsession'] == '1') {
|
||||
if (hasUpdates($version)) {
|
||||
redirectTo('admin_updates.php', array('s' => $s));
|
||||
} else {
|
||||
if (isset($_POST['script']) && $_POST['script'] != "") {
|
||||
redirectTo($_POST['script'], $qryparams);
|
||||
} else {
|
||||
redirectTo('admin_index.php', $qryparams);
|
||||
}
|
||||
}
|
||||
} else {
|
||||
if (isset($_POST['script']) && $_POST['script'] != "") {
|
||||
redirectTo($_POST['script'], $qryparams);
|
||||
} else {
|
||||
redirectTo('customer_index.php', $qryparams);
|
||||
}
|
||||
}
|
||||
} else {
|
||||
redirectTo('index.php', array('showmessage' => '2'));
|
||||
}
|
||||
exit;
|
||||
exit();
|
||||
} else {
|
||||
$language_options = '';
|
||||
$language_options .= makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
|
||||
$language_options .= \Froxlor\UI\HTML::makeoption($lng['login']['profile_lng'], 'profile', 'profile', true, true);
|
||||
|
||||
while (list($language_file, $language_name) = each($languages)) {
|
||||
$language_options .= makeoption($language_name, $language_file, 'profile', true);
|
||||
foreach ($languages as $language_file => $language_name) {
|
||||
$language_options .= \Froxlor\UI\HTML::makeoption($language_name, $language_file, 'profile', true);
|
||||
}
|
||||
|
||||
$smessage = isset($_GET['showmessage']) ? (int) $_GET['showmessage'] : 0;
|
||||
@@ -269,10 +358,13 @@ if ($action == 'login') {
|
||||
case 7:
|
||||
$message = $lng['pwdreminder']['wrongcode'];
|
||||
break;
|
||||
case 8:
|
||||
$message = $lng['pwdreminder']['notallowed'];
|
||||
break;
|
||||
}
|
||||
|
||||
$update_in_progress = '';
|
||||
if (hasUpdates($version)) {
|
||||
if (\Froxlor\Froxlor::hasUpdates() || \Froxlor\Froxlor::hasDbUpdates()) {
|
||||
$update_in_progress = $lng['update']['updateinprogress_onlyadmincanlogin'];
|
||||
}
|
||||
|
||||
@@ -287,10 +379,10 @@ if ($action == 'login') {
|
||||
}
|
||||
$lastqrystr = "";
|
||||
if (isset($_REQUEST['qrystr']) && $_REQUEST['qrystr'] != "") {
|
||||
$lastqrystr = strip_tags($_REQUEST['qrystr']);
|
||||
$lastqrystr = htmlspecialchars($_REQUEST['qrystr'], ENT_QUOTES);
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('login') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('login') . "\";");
|
||||
}
|
||||
}
|
||||
|
||||
@@ -299,20 +391,24 @@ if ($action == 'forgotpwd') {
|
||||
$message = '';
|
||||
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$loginname = validate($_POST['loginname'], 'loginname');
|
||||
$email = validateEmail($_POST['loginemail'], 'email');
|
||||
$loginname = \Froxlor\Validate\Validate::validate($_POST['loginname'], 'loginname');
|
||||
$email = \Froxlor\Validate\Validate::validateEmail($_POST['loginemail'], 'email');
|
||||
$result_stmt = Database::prepare("SELECT `adminid`, `customerid`, `firstname`, `name`, `company`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
WHERE `loginname`= :loginname
|
||||
AND `email`= :email"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("loginname" => $loginname, "email" => $email));
|
||||
AND `email`= :email");
|
||||
Database::pexecute($result_stmt, array(
|
||||
"loginname" => $loginname,
|
||||
"email" => $email
|
||||
));
|
||||
|
||||
if (Database::num_rows() == 0) {
|
||||
$result_stmt = Database::prepare("SELECT `adminid`, `name`, `email`, `loginname`, `def_language`, `deactivated` FROM `" . TABLE_PANEL_ADMINS . "`
|
||||
WHERE `loginname`= :loginname
|
||||
AND `email`= :email"
|
||||
);
|
||||
Database::pexecute($result_stmt, array("loginname" => $loginname, "email" => $email));
|
||||
AND `email`= :email");
|
||||
Database::pexecute($result_stmt, array(
|
||||
"loginname" => $loginname,
|
||||
"email" => $email
|
||||
));
|
||||
|
||||
if (Database::num_rows() > 0) {
|
||||
$adminchecked = true;
|
||||
@@ -326,23 +422,24 @@ if ($action == 'forgotpwd') {
|
||||
|
||||
/* Check whether user is banned */
|
||||
if ($user['deactivated']) {
|
||||
$message = $lng['pwdreminder']['notallowed'];
|
||||
redirectTo('index.php', array('showmessage' => '5'));
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '8'
|
||||
));
|
||||
exit();
|
||||
}
|
||||
|
||||
if (($adminchecked && Settings::Get('panel.allow_preset_admin') == '1') || $adminchecked == false) {
|
||||
if ($user !== false) {
|
||||
// build a activation code
|
||||
$timestamp = time();
|
||||
$first = substr(md5($user['loginname'] . $timestamp . rand(0, $timestamp)), 0, 15);
|
||||
$third = substr(md5($user['email'] . $timestamp . rand(0, $timestamp)), -15);
|
||||
$first = substr(md5($user['loginname'] . $timestamp . \Froxlor\PhpHelper::randomStr(16)), 0, 15);
|
||||
$third = substr(md5($user['email'] . $timestamp . \Froxlor\PhpHelper::randomStr(16)), - 15);
|
||||
$activationcode = $first . $timestamp . $third . substr(md5($third . $timestamp), 0, 10);
|
||||
|
||||
// Drop all existing activation codes for this user
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_ACTIVATION . "`
|
||||
WHERE `userid` = :userid
|
||||
AND `admin` = :admin"
|
||||
);
|
||||
AND `admin` = :admin");
|
||||
$params = array(
|
||||
"userid" => $adminchecked ? $user['adminid'] : $user['customerid'],
|
||||
"admin" => $adminchecked ? 1 : 0
|
||||
@@ -352,8 +449,7 @@ if ($action == 'forgotpwd') {
|
||||
// Add new activation code to database
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_ACTIVATION . "`
|
||||
(userid, admin, creation, activationcode)
|
||||
VALUES (:userid, :admin, :creation, :activationcode)"
|
||||
);
|
||||
VALUES (:userid, :admin, :creation, :activationcode)");
|
||||
$params = array(
|
||||
"userid" => $adminchecked ? $user['adminid'] : $user['customerid'],
|
||||
"admin" => $adminchecked ? 1 : 0,
|
||||
@@ -362,8 +458,10 @@ if ($action == 'forgotpwd') {
|
||||
);
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'));
|
||||
$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $user['loginname'] . "' requested a link for setting a new password.");
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array(
|
||||
'loginname' => 'password_reset'
|
||||
));
|
||||
$rstlog->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_WARNING, "User '" . $user['loginname'] . "' requested a link for setting a new password.");
|
||||
|
||||
// Set together our activation link
|
||||
$protocol = empty($_SERVER['HTTPS']) ? 'http' : 'https';
|
||||
@@ -377,12 +475,12 @@ if ($action == 'forgotpwd') {
|
||||
// there can be only one script to handle this so we can use a fixed value here
|
||||
$script = "/index.php"; // $_SERVER['SCRIPT_NAME'];
|
||||
if (Settings::Get('system.froxlordirectlyviahostname') == 0) {
|
||||
$script = makeCorrectFile("/".basename(__DIR__)."/".$script);
|
||||
$script = \Froxlor\FileDir::makeCorrectFile("/" . basename(__DIR__) . "/" . $script);
|
||||
}
|
||||
$activationlink = $protocol . '://' . $host . $port . $script . '?action=resetpwd&resetcode=' . $activationcode;
|
||||
|
||||
$replace_arr = array(
|
||||
'SALUTATION' => getCorrectUserSalutation($user),
|
||||
'SALUTATION' => \Froxlor\User::getCorrectUserSalutation($user),
|
||||
'USERNAME' => $loginname,
|
||||
'LINK' => $activationlink
|
||||
);
|
||||
@@ -392,30 +490,35 @@ if ($action == 'forgotpwd') {
|
||||
WHERE `adminid`= :adminid
|
||||
AND `language`= :lang
|
||||
AND `templategroup`=\'mails\'
|
||||
AND `varname`=\'password_reset_subject\''
|
||||
);
|
||||
Database::pexecute($result_stmt, array("adminid" => $user['adminid'], "lang" => $def_language));
|
||||
AND `varname`=\'password_reset_subject\'');
|
||||
Database::pexecute($result_stmt, array(
|
||||
"adminid" => $user['adminid'],
|
||||
"lang" => $def_language
|
||||
));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$mail_subject = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['password_reset']['subject']), $replace_arr));
|
||||
$mail_subject = html_entity_decode(\Froxlor\PhpHelper::replaceVariables((($result['value'] != '') ? $result['value'] : $lng['mails']['password_reset']['subject']), $replace_arr));
|
||||
|
||||
$result_stmt = Database::prepare('SELECT `value` FROM `' . TABLE_PANEL_TEMPLATES . '`
|
||||
WHERE `adminid`= :adminid
|
||||
AND `language`= :lang
|
||||
AND `templategroup`=\'mails\'
|
||||
AND `varname`=\'password_reset_mailbody\''
|
||||
);
|
||||
Database::pexecute($result_stmt, array("adminid" => $user['adminid'], "lang" => $def_language));
|
||||
AND `varname`=\'password_reset_mailbody\'');
|
||||
Database::pexecute($result_stmt, array(
|
||||
"adminid" => $user['adminid'],
|
||||
"lang" => $def_language
|
||||
));
|
||||
$result = $result_stmt->fetch(PDO::FETCH_ASSOC);
|
||||
$mail_body = html_entity_decode(replace_variables((($result['value'] != '') ? $result['value'] : $lng['mails']['password_reset']['mailbody']), $replace_arr));
|
||||
$mail_body = html_entity_decode(\Froxlor\PhpHelper::replaceVariables((($result['value'] != '') ? $result['value'] : $lng['mails']['password_reset']['mailbody']), $replace_arr));
|
||||
|
||||
$_mailerror = false;
|
||||
$mailerr_msg = "";
|
||||
try {
|
||||
$mail->Subject = $mail_subject;
|
||||
$mail->AltBody = $mail_body;
|
||||
$mail->MsgHTML(str_replace("\n", "<br />", $mail_body));
|
||||
$mail->AddAddress($user['email'], getCorrectUserSalutation($user));
|
||||
$mail->AddAddress($user['email'], \Froxlor\User::getCorrectUserSalutation($user));
|
||||
$mail->Send();
|
||||
} catch(phpmailerException $e) {
|
||||
} catch (\PHPMailer\PHPMailer\Exception $e) {
|
||||
$mailerr_msg = $e->errorMessage();
|
||||
$_mailerror = true;
|
||||
} catch (Exception $e) {
|
||||
@@ -424,18 +527,27 @@ if ($action == 'forgotpwd') {
|
||||
}
|
||||
|
||||
if ($_mailerror) {
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'));
|
||||
$rstlog->logAction(ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
|
||||
redirectTo('index.php', array('showmessage' => '4', 'customermail' => $user['email']));
|
||||
exit;
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array(
|
||||
'loginname' => 'password_reset'
|
||||
));
|
||||
$rstlog->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_ERR, "Error sending mail: " . $mailerr_msg);
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '4',
|
||||
'customermail' => $user['email']
|
||||
));
|
||||
exit();
|
||||
}
|
||||
|
||||
$mail->ClearAddresses();
|
||||
redirectTo('index.php', array('showmessage' => '1'));
|
||||
exit;
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
'showmessage' => '1'
|
||||
));
|
||||
exit();
|
||||
} else {
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'));
|
||||
$rstlog->logAction(USR_ACTION, LOG_WARNING, "User '" . $loginname . "' requested to set a new password, but was not found in database!");
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array(
|
||||
'loginname' => 'password_reset'
|
||||
));
|
||||
$rstlog->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_WARNING, "User '" . $loginname . "' requested to set a new password, but was not found in database!");
|
||||
$message = $lng['login']['combination_not_found'];
|
||||
}
|
||||
|
||||
@@ -457,7 +569,7 @@ if ($action == 'forgotpwd') {
|
||||
}
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('fpwd') . "\";");
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('fpwd') . "\";");
|
||||
}
|
||||
|
||||
if ($action == 'resetpwd') {
|
||||
@@ -465,9 +577,10 @@ if ($action == 'resetpwd') {
|
||||
|
||||
// Remove old activation codes
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_ACTIVATION . "`
|
||||
WHERE creation < :oldest"
|
||||
);
|
||||
Database::pexecute($stmt, array("oldest" => time() - 86400));
|
||||
WHERE creation < :oldest");
|
||||
Database::pexecute($stmt, array(
|
||||
"oldest" => time() - 86400
|
||||
));
|
||||
|
||||
if (isset($_GET['resetcode']) && strlen($_GET['resetcode']) == 50) {
|
||||
// Check if activation code is valid
|
||||
@@ -479,17 +592,18 @@ if ($action == 'resetpwd') {
|
||||
if (substr(md5($third . $timestamp), 0, 10) == $check && $timestamp >= time() - 86400) {
|
||||
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
||||
$stmt = Database::prepare("SELECT `userid`, `admin` FROM `" . TABLE_PANEL_ACTIVATION . "`
|
||||
WHERE `activationcode` = :activationcode"
|
||||
);
|
||||
$result = Database::pexecute_first($stmt, array("activationcode" => $activationcode));
|
||||
WHERE `activationcode` = :activationcode");
|
||||
$result = Database::pexecute_first($stmt, array(
|
||||
"activationcode" => $activationcode
|
||||
));
|
||||
|
||||
if ($result !== false) {
|
||||
if ($result['admin'] == 1) {
|
||||
$new_password = validate($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = validate($_POST['new_password_confirm'], 'new password confirm');
|
||||
$new_password = \Froxlor\Validate\Validate::validate($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = \Froxlor\Validate\Validate::validate($_POST['new_password_confirm'], 'new password confirm');
|
||||
} else {
|
||||
$new_password = validatePassword($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = validatePassword($_POST['new_password_confirm'], 'new password confirm');
|
||||
$new_password = \Froxlor\System\Crypt::validatePassword($_POST['new_password'], 'new password');
|
||||
$new_password_confirm = \Froxlor\System\Crypt::validatePassword($_POST['new_password_confirm'], 'new password confirm');
|
||||
}
|
||||
|
||||
if ($new_password == '') {
|
||||
@@ -503,39 +617,148 @@ if ($action == 'resetpwd') {
|
||||
if ($result['admin'] == 1) {
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_ADMINS . "`
|
||||
SET `password` = :newpassword
|
||||
WHERE `adminid` = :userid"
|
||||
);
|
||||
WHERE `adminid` = :userid");
|
||||
} else {
|
||||
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
||||
SET `password` = :newpassword
|
||||
WHERE `customerid` = :userid"
|
||||
);
|
||||
WHERE `customerid` = :userid");
|
||||
}
|
||||
Database::pexecute($stmt, array("newpassword" => md5($new_password), "userid" => $result['userid']));
|
||||
Database::pexecute($stmt, array(
|
||||
"newpassword" => \Froxlor\System\Crypt::makeCryptPassword($new_password),
|
||||
"userid" => $result['userid']
|
||||
));
|
||||
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array('loginname' => 'password_reset'));
|
||||
$rstlog->logAction(USR_ACTION, LOG_NOTICE, "changed password using password reset.");
|
||||
$rstlog = FroxlorLogger::getInstanceOf(array(
|
||||
'loginname' => 'password_reset'
|
||||
));
|
||||
$rstlog->logAction(\Froxlor\FroxlorLogger::USR_ACTION, LOG_NOTICE, "changed password using password reset.");
|
||||
|
||||
// Remove activation code from DB
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_ACTIVATION . "`
|
||||
WHERE `activationcode` = :activationcode
|
||||
AND `userid` = :userid"
|
||||
AND `userid` = :userid");
|
||||
Database::pexecute($stmt, array(
|
||||
"activationcode" => $activationcode,
|
||||
"userid" => $result['userid']
|
||||
));
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
"showmessage" => '6'
|
||||
));
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
"showmessage" => '7'
|
||||
));
|
||||
}
|
||||
}
|
||||
|
||||
eval("echo \"" . \Froxlor\UI\Template::getTemplate('rpwd') . "\";");
|
||||
} else {
|
||||
\Froxlor\UI\Response::redirectTo('index.php', array(
|
||||
"showmessage" => '7'
|
||||
));
|
||||
}
|
||||
} else {
|
||||
\Froxlor\UI\Response::redirectTo('index.php');
|
||||
}
|
||||
}
|
||||
|
||||
function finishLogin($userinfo)
|
||||
{
|
||||
global $version, $dbversion, $remote_addr, $http_user_agent, $languages;
|
||||
|
||||
if (isset($userinfo['userid']) && $userinfo['userid'] != '') {
|
||||
$s = md5(uniqid(microtime(), 1));
|
||||
|
||||
if (isset($_POST['language'])) {
|
||||
$language = \Froxlor\Validate\Validate::validate($_POST['language'], 'language');
|
||||
if ($language == 'profile') {
|
||||
$language = $userinfo['def_language'];
|
||||
} elseif (! isset($languages[$language])) {
|
||||
$language = Settings::Get('panel.standardlanguage');
|
||||
}
|
||||
} else {
|
||||
$language = Settings::Get('panel.standardlanguage');
|
||||
}
|
||||
|
||||
if (isset($userinfo['theme']) && $userinfo['theme'] != '') {
|
||||
$theme = $userinfo['theme'];
|
||||
} else {
|
||||
$theme = Settings::Get('panel.default_theme');
|
||||
}
|
||||
|
||||
if (Settings::Get('session.allow_multiple_login') != '1') {
|
||||
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_SESSIONS . "`
|
||||
WHERE `userid` = :uid
|
||||
AND `adminsession` = :adminsession");
|
||||
Database::pexecute($stmt, array(
|
||||
"uid" => $userinfo['userid'],
|
||||
"adminsession" => $userinfo['adminsession']
|
||||
));
|
||||
}
|
||||
|
||||
// check for field 'theme' in session-table, refs #607
|
||||
// Changed with #1287 to new method
|
||||
$stmt = Database::query("SHOW COLUMNS FROM panel_sessions LIKE 'theme'");
|
||||
while ($row = $stmt->fetch(PDO::FETCH_ASSOC)) {
|
||||
if ($row['Field'] == "theme") {
|
||||
$has_theme = true;
|
||||
}
|
||||
}
|
||||
|
||||
$params = array(
|
||||
"hash" => $s,
|
||||
"userid" => $userinfo['userid'],
|
||||
"ipaddress" => $remote_addr,
|
||||
"useragent" => $http_user_agent,
|
||||
"lastactivity" => time(),
|
||||
"language" => $language,
|
||||
"adminsession" => $userinfo['adminsession']
|
||||
);
|
||||
Database::pexecute($stmt, array("activationcode" => $activationcode, "userid" => $result['userid']));
|
||||
redirectTo('index.php', array("showmessage" => '6'));
|
||||
|
||||
if ($has_theme) {
|
||||
$params["theme"] = $theme;
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_SESSIONS . "`
|
||||
(`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`, `theme`)
|
||||
VALUES (:hash, :userid, :ipaddress, :useragent, :lastactivity, :language, :adminsession, :theme)");
|
||||
} else {
|
||||
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_SESSIONS . "`
|
||||
(`hash`, `userid`, `ipaddress`, `useragent`, `lastactivity`, `language`, `adminsession`)
|
||||
VALUES (:hash, :userid, :ipaddress, :useragent, :lastactivity, :language, :adminsession)");
|
||||
}
|
||||
Database::pexecute($stmt, $params);
|
||||
|
||||
$qryparams = array();
|
||||
if (isset($_POST['qrystr']) && $_POST['qrystr'] != "") {
|
||||
parse_str(urldecode($_POST['qrystr']), $qryparams);
|
||||
}
|
||||
$qryparams['s'] = $s;
|
||||
|
||||
if ($userinfo['adminsession'] == '1') {
|
||||
if (\Froxlor\Froxlor::hasUpdates() || \Froxlor\Froxlor::hasDbUpdates()) {
|
||||
\Froxlor\UI\Response::redirectTo('admin_updates.php', array(
|
||||
's' => $s
|
||||
));
|
||||
} else {
|
||||
if (isset($_POST['script']) && $_POST['script'] != "") {
|
||||
if (preg_match("/customer\_/", $_POST['script']) === 1) {
|
||||
\Froxlor\UI\Response::redirectTo('admin_customers.php', array(
|
||||
"page" => "customers"
|
||||
));
|
||||
} else {
|
||||
\Froxlor\UI\Response::redirectTo($_POST['script'], $qryparams);
|
||||
}
|
||||
} else {
|
||||
redirectTo('index.php', array("showmessage" => '7'));
|
||||
\Froxlor\UI\Response::redirectTo('admin_index.php', $qryparams);
|
||||
}
|
||||
}
|
||||
|
||||
eval("echo \"" . getTemplate('rpwd') . "\";");
|
||||
|
||||
} else {
|
||||
redirectTo('index.php', array("showmessage" => '7'));
|
||||
}
|
||||
|
||||
if (isset($_POST['script']) && $_POST['script'] != "") {
|
||||
\Froxlor\UI\Response::redirectTo($_POST['script'], $qryparams);
|
||||
} else {
|
||||
redirectTo('index.php');
|
||||
\Froxlor\UI\Response::redirectTo('customer_index.php', $qryparams);
|
||||
}
|
||||
}
|
||||
}
|
||||
return false;
|
||||
}
|
||||
|
||||
@@ -23,7 +23,7 @@ CREATE TABLE `ftp_users` (
|
||||
`shell` varchar(255) NOT NULL default '/bin/false',
|
||||
`login_enabled` enum('N','Y') NOT NULL default 'N',
|
||||
`login_count` int(15) NOT NULL default '0',
|
||||
`last_login` datetime NOT NULL default '0000-00-00 00:00:00',
|
||||
`last_login` datetime default NULL,
|
||||
`up_count` int(15) NOT NULL default '0',
|
||||
`up_bytes` bigint(30) NOT NULL default '0',
|
||||
`down_count` int(15) NOT NULL default '0',
|
||||
@@ -66,7 +66,7 @@ CREATE TABLE `mail_virtual` (
|
||||
`id` int(11) NOT NULL auto_increment,
|
||||
`email` varchar(255) NOT NULL default '',
|
||||
`email_full` varchar(255) NOT NULL default '',
|
||||
`destination` text NOT NULL,
|
||||
`destination` text,
|
||||
`domainid` int(11) NOT NULL default '0',
|
||||
`customerid` int(11) NOT NULL default '0',
|
||||
`popaccountid` int(11) NOT NULL default '0',
|
||||
@@ -95,7 +95,7 @@ CREATE TABLE `panel_admins` (
|
||||
`name` varchar(255) NOT NULL default '',
|
||||
`email` varchar(255) NOT NULL default '',
|
||||
`def_language` varchar(255) NOT NULL default '',
|
||||
`ip` tinyint(4) NOT NULL default '-1',
|
||||
`ip` varchar(500) NOT NULL default '-1',
|
||||
`customers` int(15) NOT NULL default '0',
|
||||
`customers_used` int(15) NOT NULL default '0',
|
||||
`customers_see_all` tinyint(1) NOT NULL default '0',
|
||||
@@ -118,9 +118,6 @@ CREATE TABLE `panel_admins` (
|
||||
`email_quota_used` bigint(13) NOT NULL default '0',
|
||||
`ftps` int(15) NOT NULL default '0',
|
||||
`ftps_used` int(15) NOT NULL default '0',
|
||||
`tickets` int(15) NOT NULL default '-1',
|
||||
`tickets_used` int(15) NOT NULL default '0',
|
||||
`tickets_see_all` tinyint(1) NOT NULL default '0',
|
||||
`subdomains` int(15) NOT NULL default '0',
|
||||
`subdomains_used` int(15) NOT NULL default '0',
|
||||
`traffic` bigint(30) NOT NULL default '0',
|
||||
@@ -133,6 +130,8 @@ CREATE TABLE `panel_admins` (
|
||||
`theme` varchar(255) NOT NULL default 'Sparkle',
|
||||
`custom_notes` text,
|
||||
`custom_notes_show` tinyint(1) NOT NULL default '0',
|
||||
`type_2fa` tinyint(1) NOT NULL default '0',
|
||||
`data_2fa` varchar(500) NOT NULL default '',
|
||||
PRIMARY KEY (`adminid`),
|
||||
UNIQUE KEY `loginname` (`loginname`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
@@ -171,8 +170,6 @@ CREATE TABLE `panel_customers` (
|
||||
`email_quota_used` bigint(13) NOT NULL default '0',
|
||||
`ftps` int(15) NOT NULL default '0',
|
||||
`ftps_used` int(15) NOT NULL default '0',
|
||||
`tickets` int(15) NOT NULL default '0',
|
||||
`tickets_used` int(15) NOT NULL default '0',
|
||||
`subdomains` int(15) NOT NULL default '0',
|
||||
`subdomains_used` int(15) NOT NULL default '0',
|
||||
`traffic` bigint(30) NOT NULL default '0',
|
||||
@@ -191,9 +188,18 @@ CREATE TABLE `panel_customers` (
|
||||
`pop3` tinyint(1) NOT NULL default '1',
|
||||
`imap` tinyint(1) NOT NULL default '1',
|
||||
`perlenabled` tinyint(1) NOT NULL default '0',
|
||||
`dnsenabled` tinyint(1) NOT NULL default '0',
|
||||
`theme` varchar(255) NOT NULL default 'Sparkle',
|
||||
`custom_notes` text,
|
||||
`custom_notes_show` tinyint(1) NOT NULL default '0',
|
||||
`lepublickey` mediumtext default NULL,
|
||||
`leprivatekey` mediumtext default NULL,
|
||||
`leregistered` tinyint(1) NOT NULL default '0',
|
||||
`leaccount` varchar(255) default '',
|
||||
`allowed_phpconfigs` varchar(500) NOT NULL default '',
|
||||
`type_2fa` tinyint(1) NOT NULL default '0',
|
||||
`data_2fa` varchar(500) NOT NULL default '',
|
||||
`logviewenabled` tinyint(1) NOT NULL default '0',
|
||||
PRIMARY KEY (`customerid`),
|
||||
UNIQUE KEY `loginname` (`loginname`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
@@ -233,7 +239,8 @@ CREATE TABLE `panel_domains` (
|
||||
`dkim_privkey` text,
|
||||
`dkim_pubkey` text,
|
||||
`wwwserveralias` tinyint(1) NOT NULL default '1',
|
||||
`parentdomainid` int(11) unsigned NOT NULL default '0',
|
||||
`parentdomainid` int(11) NOT NULL default '0',
|
||||
`phpenabled` tinyint(1) NOT NULL default '0',
|
||||
`openbasedir` tinyint(1) NOT NULL default '0',
|
||||
`openbasedir_path` tinyint(1) NOT NULL default '0',
|
||||
`speciallogfile` tinyint(1) NOT NULL default '0',
|
||||
@@ -242,11 +249,21 @@ CREATE TABLE `panel_domains` (
|
||||
`deactivated` tinyint(1) NOT NULL default '0',
|
||||
`bindserial` varchar(10) NOT NULL default '2000010100',
|
||||
`add_date` int( 11 ) NOT NULL default '0',
|
||||
`registration_date` date NOT NULL,
|
||||
`registration_date` date DEFAULT NULL,
|
||||
`termination_date` date DEFAULT NULL,
|
||||
`phpsettingid` INT( 11 ) UNSIGNED NOT NULL DEFAULT '1',
|
||||
`mod_fcgid_starter` int(4) default '-1',
|
||||
`mod_fcgid_maxrequests` int(4) default '-1',
|
||||
`ismainbutsubto` int(11) unsigned NOT NULL default '0',
|
||||
`letsencrypt` tinyint(1) NOT NULL default '0',
|
||||
`hsts` varchar(10) NOT NULL default '0',
|
||||
`hsts_sub` tinyint(1) NOT NULL default '0',
|
||||
`hsts_preload` tinyint(1) NOT NULL default '0',
|
||||
`ocsp_stapling` tinyint(1) DEFAULT '0',
|
||||
`http2` tinyint(1) DEFAULT '0',
|
||||
`notryfiles` tinyint(1) DEFAULT '0',
|
||||
`writeaccesslog` tinyint(1) DEFAULT '1',
|
||||
`writeerrorlog` tinyint(1) DEFAULT '1',
|
||||
PRIMARY KEY (`id`),
|
||||
KEY `customerid` (`customerid`),
|
||||
KEY `parentdomain` (`parentdomainid`),
|
||||
@@ -266,13 +283,14 @@ CREATE TABLE `panel_ipsandports` (
|
||||
`vhostcontainer_servername_statement` tinyint(1) NOT NULL default '0',
|
||||
`specialsettings` text,
|
||||
`ssl` tinyint(4) NOT NULL default '0',
|
||||
`ssl_cert_file` varchar(255) NOT NULL,
|
||||
`ssl_key_file` varchar(255) NOT NULL,
|
||||
`ssl_ca_file` varchar(255) NOT NULL,
|
||||
`ssl_cert_file` varchar(255) NOT NULL default '',
|
||||
`ssl_key_file` varchar(255) NOT NULL default '',
|
||||
`ssl_ca_file` varchar(255) NOT NULL default '',
|
||||
`default_vhostconf_domain` text,
|
||||
`ssl_cert_chainfile` varchar(255) NOT NULL,
|
||||
`ssl_cert_chainfile` varchar(255) NOT NULL default '',
|
||||
`docroot` varchar(255) NOT NULL default '',
|
||||
PRIMARY KEY (`id`)
|
||||
PRIMARY KEY (`id`),
|
||||
UNIQUE KEY `ip_port` (`ip`,`port`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
@@ -344,17 +362,6 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('customer', 'ftpatdomain', '0'),
|
||||
('customer', 'show_news_feed', '0'),
|
||||
('customer', 'news_feed_url', ''),
|
||||
('ticket', 'noreply_email', 'NO-REPLY@SERVERNAME'),
|
||||
('ticket', 'worktime_all', '1'),
|
||||
('ticket', 'worktime_begin', '00:00'),
|
||||
('ticket', 'worktime_end', '23:59'),
|
||||
('ticket', 'worktime_sat', '0'),
|
||||
('ticket', 'worktime_sun', '0'),
|
||||
('ticket', 'archiving_days', '5'),
|
||||
('ticket', 'enabled', '1'),
|
||||
('ticket', 'concurrently_open', '5'),
|
||||
('ticket', 'noreply_name', 'Hosting Support'),
|
||||
('ticket', 'reset_cycle', '2'),
|
||||
('logger', 'enabled', '1'),
|
||||
('logger', 'log_cron', '0'),
|
||||
('logger', 'logfile', ''),
|
||||
@@ -365,23 +372,20 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('dkim', 'dkim_domains', 'domains'),
|
||||
('dkim', 'dkim_dkimkeys', 'dkim-keys.conf'),
|
||||
('dkim', 'dkimrestart_command', '/etc/init.d/dkim-filter restart'),
|
||||
('admin', 'show_news_feed', '1'),
|
||||
('admin', 'show_news_feed', '0'),
|
||||
('admin', 'show_version_login', '0'),
|
||||
('admin', 'show_version_footer', '0'),
|
||||
('spf', 'use_spf', '0'),
|
||||
('spf', 'spf_entry', '@ IN TXT "v=spf1 a mx -all"'),
|
||||
('spf', 'spf_entry', '"v=spf1 a mx -all"'),
|
||||
('dkim', 'dkim_algorithm', 'all'),
|
||||
('dkim', 'dkim_add_adsp', '1'),
|
||||
('dkim', 'dkim_keylength', '1024'),
|
||||
('dkim', 'dkim_servicetype', '0'),
|
||||
('dkim', 'dkim_add_adsppolicy', '1'),
|
||||
('dkim', 'dkim_notes', ''),
|
||||
('defaultwebsrverrhandler', 'enabled', '0'),
|
||||
('defaultwebsrverrhandler', 'err401', ''),
|
||||
('defaultwebsrverrhandler', 'err403', ''),
|
||||
('defaultwebsrverrhandler', 'err404', ''),
|
||||
('defaultwebsrverrhandler', 'err500', ''),
|
||||
('ticket', 'default_priority', '2'),
|
||||
('customredirect', 'enabled', '1'),
|
||||
('customredirect', 'default', '1'),
|
||||
('perl', 'suexecworkaround', '0'),
|
||||
@@ -390,25 +394,113 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('login', 'maxloginattempts', '3'),
|
||||
('login', 'deactivatetime', '900'),
|
||||
('phpfpm', 'enabled', '0'),
|
||||
('phpfpm', 'configdir', '/etc/php-fpm.d/'),
|
||||
('phpfpm', 'reload', '/etc/init.d/php-fpm restart'),
|
||||
('phpfpm', 'pm', 'static'),
|
||||
('phpfpm', 'max_children', '1'),
|
||||
('phpfpm', 'start_servers', '20'),
|
||||
('phpfpm', 'min_spare_servers', '5'),
|
||||
('phpfpm', 'max_spare_servers', '35'),
|
||||
('phpfpm', 'max_requests', '0'),
|
||||
('phpfpm', 'tmpdir', '/var/customers/tmp/'),
|
||||
('phpfpm', 'peardir', '/usr/share/php/:/usr/share/php5/'),
|
||||
('phpfpm', 'envpath', '/usr/local/bin:/usr/bin:/bin'),
|
||||
('phpfpm', 'enabled_ownvhost', '0'),
|
||||
('phpfpm', 'vhost_httpuser', 'froxlorlocal'),
|
||||
('phpfpm', 'vhost_httpgroup', 'froxlorlocal'),
|
||||
('phpfpm', 'idle_timeout', '30'),
|
||||
('phpfpm', 'aliasconfigdir', '/var/www/php-fpm/'),
|
||||
('phpfpm', 'defaultini', '1'),
|
||||
('phpfpm', 'vhost_defaultini', '2'),
|
||||
('phpfpm', 'fastcgi_ipcdir', '/var/lib/apache2/fastcgi/'),
|
||||
('phpfpm', 'use_mod_proxy', '0'),
|
||||
('phpfpm', 'ini_flags', 'asp_tags
|
||||
display_errors
|
||||
display_startup_errors
|
||||
html_errors
|
||||
log_errors
|
||||
magic_quotes_gpc
|
||||
magic_quotes_runtime
|
||||
magic_quotes_sybase
|
||||
mail.add_x_header
|
||||
session.cookie_secure
|
||||
session.use_cookies
|
||||
short_open_tag
|
||||
track_errors
|
||||
xmlrpc_errors
|
||||
suhosin.simulation
|
||||
suhosin.session.encrypt
|
||||
suhosin.session.cryptua
|
||||
suhosin.session.cryptdocroot
|
||||
suhosin.cookie.encrypt
|
||||
suhosin.cookie.cryptua
|
||||
suhosin.cookie.cryptdocroot
|
||||
suhosin.executor.disable_eval
|
||||
mbstring.func_overload'),
|
||||
('phpfpm', 'ini_values', 'auto_append_file
|
||||
auto_prepend_file
|
||||
date.timezone
|
||||
default_charset
|
||||
error_reporting
|
||||
include_path
|
||||
log_errors_max_len
|
||||
mail.log
|
||||
max_execution_time
|
||||
session.cookie_domain
|
||||
session.cookie_lifetime
|
||||
session.cookie_path
|
||||
session.name
|
||||
session.serialize_handler
|
||||
upload_max_filesize
|
||||
xmlrpc_error_number
|
||||
session.auto_start
|
||||
always_populate_raw_post_data
|
||||
suhosin.session.cryptkey
|
||||
suhosin.session.cryptraddr
|
||||
suhosin.session.checkraddr
|
||||
suhosin.cookie.cryptkey
|
||||
suhosin.cookie.plainlist
|
||||
suhosin.cookie.cryptraddr
|
||||
suhosin.cookie.checkraddr
|
||||
suhosin.executor.func.blacklist
|
||||
suhosin.executor.eval.whitelist'),
|
||||
('phpfpm', 'ini_admin_flags', 'allow_call_time_pass_reference
|
||||
allow_url_fopen
|
||||
allow_url_include
|
||||
auto_detect_line_endings
|
||||
cgi.fix_pathinfo
|
||||
cgi.force_redirect
|
||||
enable_dl
|
||||
expose_php
|
||||
file_uploads
|
||||
ignore_repeated_errors
|
||||
ignore_repeated_source
|
||||
log_errors
|
||||
register_argc_argv
|
||||
report_memleaks
|
||||
opcache.enable
|
||||
opcache.consistency_checks
|
||||
opcache.dups_fix
|
||||
opcache.load_comments
|
||||
opcache.revalidate_path
|
||||
opcache.save_comments
|
||||
opcache.use_cwd
|
||||
opcache.validate_timestamps
|
||||
opcache.fast_shutdown'),
|
||||
('phpfpm', 'ini_admin_values', 'cgi.redirect_status_env
|
||||
date.timezone
|
||||
disable_classes
|
||||
disable_functions
|
||||
error_log
|
||||
gpc_order
|
||||
max_input_time
|
||||
max_input_vars
|
||||
memory_limit
|
||||
open_basedir
|
||||
output_buffering
|
||||
post_max_size
|
||||
precision
|
||||
sendmail_path
|
||||
session.gc_divisor
|
||||
session.gc_probability
|
||||
variables_order
|
||||
opcache.log_verbosity_level
|
||||
opcache.restrict_api
|
||||
opcache.revalidate_freq
|
||||
opcache.max_accelerated_files
|
||||
opcache.memory_consumption
|
||||
opcache.interned_strings_buffer'),
|
||||
('nginx', 'fastcgiparams', '/etc/nginx/fastcgi_params'),
|
||||
('system', 'lastaccountnumber', '0'),
|
||||
('system', 'lastguid', '9999'),
|
||||
@@ -428,9 +520,10 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('system', 'mysql_access_host', 'localhost'),
|
||||
('system', 'lastcronrun', ''),
|
||||
('system', 'defaultip', '1'),
|
||||
('system', 'defaultsslip', ''),
|
||||
('system', 'phpappendopenbasedir', '/tmp/'),
|
||||
('system', 'deactivateddocroot', ''),
|
||||
('system', 'mailpwcleartext', '1'),
|
||||
('system', 'mailpwcleartext', '0'),
|
||||
('system', 'last_tasks_run', '000000'),
|
||||
('system', 'nameservers', ''),
|
||||
('system', 'mxservers', ''),
|
||||
@@ -486,11 +579,13 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('system', 'mod_fcgid_defaultini_ownvhost', '2'),
|
||||
('system', 'awstats_icons', '/usr/share/awstats/icon/'),
|
||||
('system', 'ssl_cert_chainfile', ''),
|
||||
('system', 'ssl_cipher_list', 'ECDHE-RSA-AES128-SHA256:AES128-GCM-SHA256:RC4:HIGH:!MD5:!aNULL:!EDH'),
|
||||
('system', 'ssl_cipher_list', 'ECDH+AESGCM:ECDH+AES256:!aNULL:!MD5:!DSS:!DH:!AES128'),
|
||||
('system', 'nginx_php_backend', '127.0.0.1:8888'),
|
||||
('system', 'http2_support', '0'),
|
||||
('system', 'perl_server', 'unix:/var/run/nginx/cgiwrap-dispatch.sock'),
|
||||
('system', 'phpreload_command', ''),
|
||||
('system', 'apache24', '0'),
|
||||
('system', 'apache24', '1'),
|
||||
('system', 'apache24_ocsp_cache_path', 'shmcb:/var/run/apache2/ocsp-stapling.cache(131072)'),
|
||||
('system', 'documentroot_use_default_value', '0'),
|
||||
('system', 'passwordcryptfunc', '3'),
|
||||
('system', 'axfrservers', ''),
|
||||
@@ -504,10 +599,55 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('system', 'mailtraffic_enabled', '1'),
|
||||
('system', 'cronconfig', '/etc/cron.d/froxlor'),
|
||||
('system', 'crondreload', '/etc/init.d/cron reload'),
|
||||
('system', 'croncmdline', '/usr/bin/nice -n 5 /usr/bin/php5 -q'),
|
||||
('system', 'croncmdline', '/usr/bin/nice -n 5 /usr/bin/php -q'),
|
||||
('system', 'cron_allowautoupdate', '0'),
|
||||
('system', 'dns_createhostnameentry', '0'),
|
||||
('system', 'send_cron_errors', '0'),
|
||||
('system', 'apacheitksupport', '0'),
|
||||
('system', 'leprivatekey', 'unset'),
|
||||
('system', 'lepublickey', 'unset'),
|
||||
('system', 'letsencryptca', 'production'),
|
||||
('system', 'letsencryptcountrycode', 'DE'),
|
||||
('system', 'letsencryptstate', 'Hessen'),
|
||||
('system', 'letsencryptchallengepath', '/var/www/froxlor'),
|
||||
('system', 'letsencryptkeysize', '4096'),
|
||||
('system', 'letsencryptreuseold', 0),
|
||||
('system', 'leenabled', '0'),
|
||||
('system', 'leapiversion', '1'),
|
||||
('system', 'backupenabled', '0'),
|
||||
('system', 'dnsenabled', '0'),
|
||||
('system', 'dns_server', 'Bind'),
|
||||
('system', 'apacheglobaldiropt', ''),
|
||||
('system', 'allow_customer_shell', '0'),
|
||||
('system', 'available_shells', ''),
|
||||
('system', 'le_froxlor_enabled', '0'),
|
||||
('system', 'le_froxlor_redirect', '0'),
|
||||
('system', 'letsencryptacmeconf', '/etc/apache2/conf-enabled/acme.conf'),
|
||||
('system', 'mail_use_smtp', '0'),
|
||||
('system', 'mail_smtp_host', 'localhost'),
|
||||
('system', 'mail_smtp_port', '25'),
|
||||
('system', 'mail_smtp_usetls', '1'),
|
||||
('system', 'mail_smtp_auth', '1'),
|
||||
('system', 'mail_smtp_user', ''),
|
||||
('system', 'mail_smtp_passwd', ''),
|
||||
('system', 'hsts_maxage', '0'),
|
||||
('system', 'hsts_incsub', '0'),
|
||||
('system', 'hsts_preload', '0'),
|
||||
('system', 'leregistered', '0'),
|
||||
('system', 'leaccount', ''),
|
||||
('system', 'nssextrausers', '0'),
|
||||
('system', 'disable_le_selfcheck', '0'),
|
||||
('system', 'ssl_protocols', 'TLSv1,TLSv1.2'),
|
||||
('system', 'logfiles_format', ''),
|
||||
('system', 'logfiles_type', '1'),
|
||||
('system', 'logfiles_piped', '0'),
|
||||
('system', 'logfiles_script', ''),
|
||||
('system', 'dhparams_file', ''),
|
||||
('system', 'errorlog_level', 'warn'),
|
||||
('system', 'leecc', '0'),
|
||||
('system', 'froxloraliases', ''),
|
||||
('api', 'enabled', '0'),
|
||||
('2fa', 'enabled', '1'),
|
||||
('panel', 'decimal_places', '4'),
|
||||
('panel', 'adminmail', 'admin@SERVERNAME'),
|
||||
('panel', 'phpmyadmin_url', ''),
|
||||
@@ -538,14 +678,17 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
|
||||
('panel', 'password_numeric', '0'),
|
||||
('panel', 'password_special_char_required', '0'),
|
||||
('panel', 'password_special_char', '!?<>§$%+#=@'),
|
||||
('panel', 'version', '0.9.33-rc2');
|
||||
('panel', 'customer_hide_options', ''),
|
||||
('panel', 'is_configured', '0'),
|
||||
('panel', 'version', '0.10.0-rc1'),
|
||||
('panel', 'db_version', '201904100');
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `panel_tasks`;
|
||||
CREATE TABLE `panel_tasks` (
|
||||
`id` int(11) unsigned NOT NULL auto_increment,
|
||||
`type` int(11) NOT NULL default '0',
|
||||
`data` text NOT NULL,
|
||||
`data` text,
|
||||
PRIMARY KEY (`id`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
@@ -650,46 +793,11 @@ CREATE TABLE `panel_languages` (
|
||||
INSERT INTO `panel_languages` (`id`, `language`, `iso`, `file`) VALUES
|
||||
(1, 'Deutsch', 'de', 'lng/german.lng.php'),
|
||||
(2, 'English', 'en', 'lng/english.lng.php'),
|
||||
(3, 'Français', 'fr', 'lng/french.lng.php'),
|
||||
(3, 'Français', 'fr', 'lng/french.lng.php'),
|
||||
(4, 'Português', 'pt', 'lng/portugues.lng.php'),
|
||||
(5, 'Italian', 'it', 'lng/italian.lng.php'),
|
||||
(6, 'Dutch', 'nl', 'lng/dutch.lng.php'),
|
||||
(7, 'Swedish', 'sv', 'lng/swedish.lng.php');
|
||||
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `panel_tickets`;
|
||||
CREATE TABLE `panel_tickets` (
|
||||
`id` int(11) unsigned NOT NULL auto_increment,
|
||||
`customerid` int(11) NOT NULL,
|
||||
`adminid` int(11) NOT NULL,
|
||||
`category` smallint(5) unsigned NOT NULL default '1',
|
||||
`priority` enum('1','2','3') NOT NULL default '3',
|
||||
`subject` varchar(70) NOT NULL,
|
||||
`message` text NOT NULL,
|
||||
`dt` int(15) NOT NULL,
|
||||
`lastchange` int(15) NOT NULL,
|
||||
`ip` varchar(39) NOT NULL default '',
|
||||
`status` enum('0','1','2','3') NOT NULL default '1',
|
||||
`lastreplier` enum('0','1') NOT NULL default '0',
|
||||
`answerto` int(11) unsigned NOT NULL,
|
||||
`by` enum('0','1') NOT NULL default '0',
|
||||
`archived` enum('0','1') NOT NULL default '0',
|
||||
PRIMARY KEY (`id`),
|
||||
KEY `customerid` (`customerid`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `panel_ticket_categories`;
|
||||
CREATE TABLE `panel_ticket_categories` (
|
||||
`id` smallint(5) unsigned NOT NULL auto_increment,
|
||||
`name` varchar(60) NOT NULL,
|
||||
`adminid` int(11) NOT NULL,
|
||||
`logicalorder` int(3) NOT NULL default '1',
|
||||
PRIMARY KEY (`id`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
(5, 'Italiano', 'it', 'lng/italian.lng.php'),
|
||||
(6, 'Nederlands', 'nl', 'lng/dutch.lng.php'),
|
||||
(7, 'Svenska', 'sv', 'lng/swedish.lng.php');
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `panel_syslog`;
|
||||
@@ -704,6 +812,33 @@ CREATE TABLE IF NOT EXISTS `panel_syslog` (
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `panel_fpmdaemons`;
|
||||
CREATE TABLE `panel_fpmdaemons` (
|
||||
`id` int(11) unsigned NOT NULL auto_increment,
|
||||
`description` varchar(50) NOT NULL,
|
||||
`reload_cmd` varchar(255) NOT NULL,
|
||||
`config_dir` varchar(255) NOT NULL,
|
||||
`pm` varchar(15) NOT NULL DEFAULT 'static',
|
||||
`max_children` int(4) NOT NULL DEFAULT '1',
|
||||
`start_servers` int(4) NOT NULL DEFAULT '20',
|
||||
`min_spare_servers` int(4) NOT NULL DEFAULT '5',
|
||||
`max_spare_servers` int(4) NOT NULL DEFAULT '35',
|
||||
`max_requests` int(4) NOT NULL DEFAULT '0',
|
||||
`idle_timeout` int(4) NOT NULL DEFAULT '30',
|
||||
`limit_extensions` varchar(255) NOT NULL default '.php',
|
||||
PRIMARY KEY (`id`),
|
||||
UNIQUE KEY `reload` (`reload_cmd`),
|
||||
UNIQUE KEY `config` (`config_dir`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
|
||||
INSERT INTO `panel_fpmdaemons` (`id`, `description`, `reload_cmd`, `config_dir`) VALUES
|
||||
(1, 'System default', 'service php7.0-fpm restart', '/etc/php/7.0/fpm/pool.d/');
|
||||
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `panel_phpconfigs`;
|
||||
CREATE TABLE `panel_phpconfigs` (
|
||||
`id` int(11) unsigned NOT NULL auto_increment,
|
||||
@@ -712,18 +847,31 @@ CREATE TABLE `panel_phpconfigs` (
|
||||
`file_extensions` varchar(255) NOT NULL,
|
||||
`mod_fcgid_starter` int(4) NOT NULL DEFAULT '-1',
|
||||
`mod_fcgid_maxrequests` int(4) NOT NULL DEFAULT '-1',
|
||||
`mod_fcgid_umask` varchar(15) NOT NULL DEFAULT '022',
|
||||
`fpm_slowlog` tinyint(1) NOT NULL default '0',
|
||||
`fpm_reqterm` varchar(15) NOT NULL default '60s',
|
||||
`fpm_reqslow` varchar(15) NOT NULL default '5s',
|
||||
`phpsettings` text NOT NULL,
|
||||
PRIMARY KEY (`id`)
|
||||
`fpmsettingid` int(11) NOT NULL DEFAULT '1',
|
||||
`pass_authorizationheader` tinyint(1) NOT NULL default '0',
|
||||
`override_fpmconfig` tinyint(1) NOT NULL DEFAULT '0',
|
||||
`pm` varchar(15) NOT NULL DEFAULT 'static',
|
||||
`max_children` int(4) NOT NULL DEFAULT '1',
|
||||
`start_servers` int(4) NOT NULL DEFAULT '20',
|
||||
`min_spare_servers` int(4) NOT NULL DEFAULT '5',
|
||||
`max_spare_servers` int(4) NOT NULL DEFAULT '35',
|
||||
`max_requests` int(4) NOT NULL DEFAULT '0',
|
||||
`idle_timeout` int(4) NOT NULL DEFAULT '30',
|
||||
`limit_extensions` varchar(255) NOT NULL default '.php',
|
||||
PRIMARY KEY (`id`),
|
||||
KEY `fpmsettingid` (`fpmsettingid`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
|
||||
INSERT INTO `panel_phpconfigs` (`id`, `description`, `binary`, `file_extensions`, `mod_fcgid_starter`, `mod_fcgid_maxrequests`, `phpsettings`) VALUES
|
||||
(1, 'Default Config', '/usr/bin/php-cgi', 'php', '-1', '-1', 'allow_call_time_pass_reference = Off\r\nallow_url_fopen = Off\r\nasp_tags = Off\r\ndisable_classes =\r\ndisable_functions = curl_exec,curl_multi_exec,exec,parse_ini_file,passthru,popen,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate,shell_exec,show_source,system\r\ndisplay_errors = Off\r\ndisplay_startup_errors = Off\r\nenable_dl = Off\r\nerror_reporting = E_ALL & ~E_NOTICE\r\nexpose_php = Off\r\nfile_uploads = On\r\ncgi.force_redirect = 1\r\ngpc_order = "GPC"\r\nhtml_errors = Off\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\ninclude_path = ".:{PEAR_DIR}"\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\nmax_execution_time = 30\r\nmax_input_time = 60\r\nmemory_limit = 16M\r\n{OPEN_BASEDIR_C}open_basedir = "{OPEN_BASEDIR}"\r\noutput_buffering = 4096\r\npost_max_size = 16M\r\nprecision = 14\r\nregister_argc_argv = Off\r\nregister_globals = Off\r\nreport_memleaks = On\r\nsendmail_path = "/usr/sbin/sendmail -t -i -f {CUSTOMER_EMAIL}"\r\nsession.auto_start = 0\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.cache_expire = 180\r\nsession.cache_limiter = nocache\r\nsession.cookie_domain =\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.entropy_file = /dev/urandom\r\nsession.entropy_length = 16\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.gc_probability = 1\r\nsession.name = PHPSESSID\r\nsession.referer_check =\r\nsession.save_handler = files\r\nsession.save_path = "{TMP_DIR}"\r\nsession.serialize_handler = php\r\nsession.use_cookies = 1\r\nsession.use_trans_sid = 0\r\nshort_open_tag = On\r\nsuhosin.mail.protect = 1\r\nsuhosin.simulation = Off\r\ntrack_errors = Off\r\nupload_max_filesize = 32M\r\nupload_tmp_dir = "{TMP_DIR}"\r\nvariables_order = "GPCS"\r\n;mail.add_x_header = On\r\n;mail.log = "/var/log/phpmail.log"\r\n'),
|
||||
(2, 'Froxlor Vhost Config', '/usr/bin/php-cgi', 'php', '-1', '-1', 'allow_call_time_pass_reference = Off\r\nallow_url_fopen = On\r\nasp_tags = Off\r\ndisable_classes =\r\ndisable_functions = curl_multi_exec,exec,parse_ini_file,passthru,popen,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate,shell_exec,show_source,system\r\ndisplay_errors = Off\r\ndisplay_startup_errors = Off\r\nenable_dl = Off\r\nerror_reporting = E_ALL & ~E_NOTICE\r\nexpose_php = Off\r\nfile_uploads = On\r\ncgi.force_redirect = 1\r\ngpc_order = "GPC"\r\nhtml_errors = Off\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\ninclude_path = ".:{PEAR_DIR}"\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\nmax_execution_time = 60\r\nmax_input_time = 60\r\nmemory_limit = 16M\r\nnoutput_buffering = 4096\r\npost_max_size = 16M\r\nprecision = 14\r\nregister_argc_argv = Off\r\nregister_globals = Off\r\nreport_memleaks = On\r\nsendmail_path = "/usr/sbin/sendmail -t -i -f {CUSTOMER_EMAIL}"\r\nsession.auto_start = 0\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.cache_expire = 180\r\nsession.cache_limiter = nocache\r\nsession.cookie_domain =\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.entropy_file = /dev/urandom\r\nsession.entropy_length = 16\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.gc_probability = 1\r\nsession.name = PHPSESSID\r\nsession.referer_check =\r\nsession.save_handler = files\r\nsession.save_path = "{TMP_DIR}"\r\nsession.serialize_handler = php\r\nsession.use_cookies = 1\r\nsession.use_trans_sid = 0\r\nshort_open_tag = On\r\nsuhosin.mail.protect = 1\r\nsuhosin.simulation = Off\r\ntrack_errors = Off\r\nupload_max_filesize = 32M\r\nupload_tmp_dir = "{TMP_DIR}"\r\nvariables_order = "GPCS"\r\n;mail.add_x_header = On\r\n;mail.log = "/var/log/phpmail.log"\r\n');
|
||||
(1, 'Default Config', '/usr/bin/php-cgi', 'php', '-1', '-1', 'allow_call_time_pass_reference = Off\r\nallow_url_fopen = Off\r\nasp_tags = Off\r\ndisable_classes =\r\ndisable_functions = curl_exec,curl_multi_exec,exec,parse_ini_file,passthru,popen,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate,shell_exec,show_source,system\r\ndisplay_errors = Off\r\ndisplay_startup_errors = Off\r\nenable_dl = Off\r\nerror_reporting = E_ALL & ~E_NOTICE\r\nexpose_php = Off\r\nfile_uploads = On\r\ncgi.force_redirect = 1\r\ngpc_order = "GPC"\r\nhtml_errors = Off\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\ninclude_path = ".:{PEAR_DIR}"\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\nmax_execution_time = 30\r\nmax_input_time = 60\r\nmemory_limit = 128M\r\n{OPEN_BASEDIR_C}open_basedir = "{OPEN_BASEDIR}"\r\noutput_buffering = 4096\r\npost_max_size = 16M\r\nprecision = 14\r\nregister_argc_argv = Off\r\nregister_globals = Off\r\nreport_memleaks = On\r\nsendmail_path = "/usr/sbin/sendmail -t -i -f {CUSTOMER_EMAIL}"\r\nsession.auto_start = 0\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.cache_expire = 180\r\nsession.cache_limiter = nocache\r\nsession.cookie_domain =\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.entropy_file = /dev/urandom\r\nsession.entropy_length = 16\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.gc_probability = 1\r\nsession.name = PHPSESSID\r\nsession.referer_check =\r\nsession.save_handler = files\r\nsession.save_path = "{TMP_DIR}"\r\nsession.serialize_handler = php\r\nsession.use_cookies = 1\r\nsession.use_trans_sid = 0\r\nshort_open_tag = On\r\nsuhosin.mail.protect = 1\r\nsuhosin.simulation = Off\r\ntrack_errors = Off\r\nupload_max_filesize = 32M\r\nupload_tmp_dir = "{TMP_DIR}"\r\nvariables_order = "GPCS"\r\n;mail.add_x_header = On\r\n;mail.log = "/var/log/phpmail.log"\r\nopcache.restrict_api = "{DOCUMENT_ROOT}"\r\n'),
|
||||
(2, 'Froxlor Vhost Config', '/usr/bin/php-cgi', 'php', '-1', '-1', 'allow_call_time_pass_reference = Off\r\nallow_url_fopen = On\r\nasp_tags = Off\r\ndisable_classes =\r\ndisable_functions = curl_multi_exec,exec,parse_ini_file,passthru,popen,proc_close,proc_get_status,proc_nice,proc_open,proc_terminate,shell_exec,show_source,system\r\ndisplay_errors = Off\r\ndisplay_startup_errors = Off\r\nenable_dl = Off\r\nerror_reporting = E_ALL & ~E_NOTICE\r\nexpose_php = Off\r\nfile_uploads = On\r\ncgi.force_redirect = 1\r\ngpc_order = "GPC"\r\nhtml_errors = Off\r\nignore_repeated_errors = Off\r\nignore_repeated_source = Off\r\ninclude_path = ".:{PEAR_DIR}"\r\nlog_errors = On\r\nlog_errors_max_len = 1024\r\nmagic_quotes_gpc = Off\r\nmagic_quotes_runtime = Off\r\nmagic_quotes_sybase = Off\r\nmax_execution_time = 60\r\nmax_input_time = 60\r\nmemory_limit = 128M\r\noutput_buffering = 4096\r\npost_max_size = 16M\r\nprecision = 14\r\nregister_argc_argv = Off\r\nregister_globals = Off\r\nreport_memleaks = On\r\nsendmail_path = "/usr/sbin/sendmail -t -i -f {CUSTOMER_EMAIL}"\r\nsession.auto_start = 0\r\nsession.bug_compat_42 = 0\r\nsession.bug_compat_warn = 1\r\nsession.cache_expire = 180\r\nsession.cache_limiter = nocache\r\nsession.cookie_domain =\r\nsession.cookie_lifetime = 0\r\nsession.cookie_path = /\r\nsession.entropy_file = /dev/urandom\r\nsession.entropy_length = 16\r\nsession.gc_divisor = 1000\r\nsession.gc_maxlifetime = 1440\r\nsession.gc_probability = 1\r\nsession.name = PHPSESSID\r\nsession.referer_check =\r\nsession.save_handler = files\r\nsession.save_path = "{TMP_DIR}"\r\nsession.serialize_handler = php\r\nsession.use_cookies = 1\r\nsession.use_trans_sid = 0\r\nshort_open_tag = On\r\nsuhosin.mail.protect = 1\r\nsuhosin.simulation = Off\r\ntrack_errors = Off\r\nupload_max_filesize = 32M\r\nupload_tmp_dir = "{TMP_DIR}"\r\nvariables_order = "GPCS"\r\n;mail.add_x_header = On\r\n;mail.log = "/var/log/phpmail.log"\r\nopcache.restrict_api = ""\r\n');
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `cronjobs_run`;
|
||||
@@ -731,6 +879,7 @@ CREATE TABLE IF NOT EXISTS `cronjobs_run` (
|
||||
`id` bigint(20) NOT NULL auto_increment,
|
||||
`module` varchar(250) NOT NULL,
|
||||
`cronfile` varchar(250) NOT NULL,
|
||||
`cronclass` varchar(500) NOT NULL,
|
||||
`lastrun` int(15) NOT NULL DEFAULT '0',
|
||||
`interval` varchar(100) NOT NULL DEFAULT '5 MINUTE',
|
||||
`isactive` tinyint(1) DEFAULT '1',
|
||||
@@ -739,13 +888,13 @@ CREATE TABLE IF NOT EXISTS `cronjobs_run` (
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
INSERT INTO `cronjobs_run` (`id`, `module`, `cronfile`, `interval`, `isactive`, `desc_lng_key`) VALUES
|
||||
(1, 'froxlor/core', 'tasks', '5 MINUTE', '1', 'cron_tasks'),
|
||||
(2, 'froxlor/core', 'traffic', '1 DAY', '1', 'cron_traffic'),
|
||||
(3, 'froxlor/ticket', 'used_tickets_reset', '1 DAY', '1', 'cron_ticketsreset'),
|
||||
(4, 'froxlor/ticket', 'ticketarchive', '1 MONTH', '1', 'cron_ticketarchive'),
|
||||
(5, 'froxlor/reports', 'usage_report', '1 DAY', '1', 'cron_usage_report'),
|
||||
(6, 'froxlor/core', 'mailboxsize', '6 HOUR', '1', 'cron_mailboxsize');
|
||||
INSERT INTO `cronjobs_run` (`id`, `module`, `cronfile`, `cronclass`, `interval`, `isactive`, `desc_lng_key`) VALUES
|
||||
(1, 'froxlor/core', 'tasks', '\\Froxlor\\Cron\\System\\TasksCron', '5 MINUTE', '1', 'cron_tasks'),
|
||||
(2, 'froxlor/core', 'traffic', '\\Froxlor\\Cron\\Traffic\\TrafficCron', '1 DAY', '1', 'cron_traffic'),
|
||||
(3, 'froxlor/reports', 'usage_report', '\\Froxlor\\Cron\\Traffic\\ReportsCron', '1 DAY', '1', 'cron_usage_report'),
|
||||
(4, 'froxlor/core', 'mailboxsize', '\\Froxlor\\Cron\\System\\MailboxsizeCron', '6 HOUR', '1', 'cron_mailboxsize'),
|
||||
(5, 'froxlor/letsencrypt', 'letsencrypt', '\\Froxlor\\Cron\\Http\\LetsEncrypt\\AcmeSh', '5 MINUTE', '0', 'cron_letsencrypt'),
|
||||
(6, 'froxlor/backup', 'backup', '\\Froxlor\\Cron\\System\\BackupCron', '1 DAY', '1', 'cron_backup');
|
||||
|
||||
|
||||
|
||||
@@ -816,10 +965,13 @@ DROP TABLE IF EXISTS `domain_ssl_settings`;
|
||||
CREATE TABLE IF NOT EXISTS `domain_ssl_settings` (
|
||||
`id` int(5) NOT NULL auto_increment,
|
||||
`domainid` int(11) NOT NULL,
|
||||
`ssl_cert_file` text NOT NULL,
|
||||
`ssl_key_file` text NOT NULL,
|
||||
`ssl_ca_file` text,
|
||||
`ssl_cert_chainfile` text,
|
||||
`ssl_cert_file` mediumtext,
|
||||
`ssl_key_file` mediumtext,
|
||||
`ssl_ca_file` mediumtext,
|
||||
`ssl_cert_chainfile` mediumtext,
|
||||
`ssl_csr_file` mediumtext,
|
||||
`ssl_fullchain_file` mediumtext,
|
||||
`expirationdate` datetime DEFAULT NULL,
|
||||
PRIMARY KEY (`id`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
@@ -831,3 +983,44 @@ CREATE TABLE IF NOT EXISTS `panel_domaintoip` (
|
||||
PRIMARY KEY (`id_domain`,`id_ipandports`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `domain_dns_entries`;
|
||||
CREATE TABLE `domain_dns_entries` (
|
||||
`id` int(20) NOT NULL auto_increment,
|
||||
`domain_id` int(15) NOT NULL,
|
||||
`record` varchar(255) NOT NULL,
|
||||
`type` varchar(10) NOT NULL DEFAULT 'A',
|
||||
`content` text NOT NULL,
|
||||
`ttl` int(11) NOT NULL DEFAULT '18000',
|
||||
`prio` int(11) DEFAULT NULL,
|
||||
PRIMARY KEY (`id`)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `panel_plans`;
|
||||
CREATE TABLE `panel_plans` (
|
||||
`id` int(11) NOT NULL auto_increment,
|
||||
`adminid` int(11) NOT NULL default '0',
|
||||
`name` varchar(255) NOT NULL default '',
|
||||
`description` text NOT NULL,
|
||||
`value` longtext NOT NULL,
|
||||
`ts` int(15) NOT NULL default '0',
|
||||
PRIMARY KEY (id),
|
||||
KEY adminid (adminid)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
DROP TABLE IF EXISTS `api_keys`;
|
||||
CREATE TABLE `api_keys` (
|
||||
`id` int(11) NOT NULL auto_increment,
|
||||
`adminid` int(11) NOT NULL default '0',
|
||||
`customerid` int(11) NOT NULL default '0',
|
||||
`apikey` varchar(500) NOT NULL default '',
|
||||
`secret` varchar(500) NOT NULL default '',
|
||||
`allowed_from` text NOT NULL,
|
||||
`valid_until` int(15) NOT NULL default '0',
|
||||
PRIMARY KEY (id),
|
||||
KEY adminid (adminid),
|
||||
KEY customerid (customerid)
|
||||
) ENGINE=MyISAM CHARSET=utf8 COLLATE=utf8_general_ci;
|
||||
|
||||
|
||||
@@ -15,8 +15,8 @@
|
||||
* @package Install
|
||||
*
|
||||
*/
|
||||
|
||||
require 'lib/class.FroxlorInstall.php';
|
||||
require dirname(__DIR__) . '/vendor/autoload.php';
|
||||
require __DIR__ . '/lib/class.FroxlorInstall.php';
|
||||
|
||||
$frxinstall = new FroxlorInstall();
|
||||
$frxinstall->run();
|
||||
|
||||
89
install/lib/updateFunctions.php
Normal file
@@ -0,0 +1,89 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2010 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2010-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Functions
|
||||
*
|
||||
*/
|
||||
|
||||
/**
|
||||
* Function showUpdateStep
|
||||
*
|
||||
* outputs and logs the current
|
||||
* update progress
|
||||
*
|
||||
* @param
|
||||
* string task/status
|
||||
* @param
|
||||
* bool needs_status (if false, a linebreak will be added)
|
||||
*
|
||||
* @return string formatted output and log-entry
|
||||
*/
|
||||
function showUpdateStep($task = null, $needs_status = true)
|
||||
{
|
||||
if (! $needs_status)
|
||||
echo "<b>";
|
||||
|
||||
// output
|
||||
echo $task;
|
||||
|
||||
if (! $needs_status) {
|
||||
echo "</b><br />";
|
||||
}
|
||||
|
||||
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, $task);
|
||||
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, $task);
|
||||
}
|
||||
|
||||
/**
|
||||
* Function lastStepStatus
|
||||
*
|
||||
* outputs [OK] (success), [??] (warning) or [!!] (failure)
|
||||
* of the last update-step
|
||||
*
|
||||
* @param
|
||||
* int status (0 = success, 1 = warning, 2 = failure)
|
||||
*
|
||||
* @return string formatted output and log-entry
|
||||
*/
|
||||
function lastStepStatus($status = -1, $message = '')
|
||||
{
|
||||
switch ($status) {
|
||||
|
||||
case 0:
|
||||
$status_sign = ($message != '') ? '[' . $message . ']' : '[OK]';
|
||||
$status_color = 'ok';
|
||||
break;
|
||||
case 1:
|
||||
$status_sign = ($message != '') ? '[' . $message . ']' : '[??]';
|
||||
$status_color = 'warn';
|
||||
break;
|
||||
case 2:
|
||||
$status_sign = ($message != '') ? '[' . $message . ']' : '[!!]';
|
||||
$status_color = 'err';
|
||||
break;
|
||||
default:
|
||||
$status_sign = '[unknown]';
|
||||
$status_color = 'unknown';
|
||||
break;
|
||||
}
|
||||
|
||||
// output
|
||||
echo "<span class=\"update-step update-step-" . $status_color . "\">" . $status_sign . "</span><br />";
|
||||
|
||||
if ($status == - 1 || $status == 2) {
|
||||
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, 'Attention - last update task failed!!!');
|
||||
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, 'Attention - last update task failed!!!');
|
||||
} elseif ($status == 0 || $status == 1) {
|
||||
\Froxlor\FroxlorLogger::getInstanceOf()->logAction(\Froxlor\FroxlorLogger::ADM_ACTION, LOG_WARNING, 'Success');
|
||||
}
|
||||
}
|
||||
@@ -16,26 +16,32 @@
|
||||
* @package Language
|
||||
*
|
||||
*/
|
||||
|
||||
$lng['requirements']['title'] = 'Checking system requirements...';
|
||||
$lng['requirements']['installed'] = 'installed';
|
||||
$lng['requirements']['not_true'] = 'no';
|
||||
$lng['requirements']['notfound'] = 'not found';
|
||||
$lng['requirements']['notinstalled'] = 'not installed';
|
||||
$lng['requirements']['activated'] = 'enabled';
|
||||
$lng['requirements']['phpversion'] = 'PHP version >= 5.3';
|
||||
$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime...';
|
||||
$lng['requirements']['phpmagic_quotes_runtime_description'] = 'PHP setting "magic_quotes_runtime" must be set to "Off". We have disabled it temporary for now please fix the coresponding php.ini.';
|
||||
$lng['requirements']['phpversion'] = 'PHP version >= 5.6';
|
||||
$lng['requirements']['newerphpprefered'] = 'Good, but php-7.0 is prefered.';
|
||||
$lng['requirements']['phppdo'] = 'PHP PDO extension and PDO-MySQL driver...';
|
||||
$lng['requirements']['phpsession'] = 'PHP session-extension...';
|
||||
$lng['requirements']['phpctype'] = 'PHP ctype-extension...';
|
||||
$lng['requirements']['phpsimplexml'] = 'PHP SimpleXML-extension...';
|
||||
$lng['requirements']['phpxml'] = 'PHP XML-extension...';
|
||||
$lng['requirements']['phpfilter'] = 'PHP filter-extension...';
|
||||
$lng['requirements']['phpposix'] = 'PHP posix-extension...';
|
||||
$lng['requirements']['phpbcmath'] = 'PHP bcmath-extension...';
|
||||
$lng['requirements']['phpcurl'] = 'PHP curl-extension...';
|
||||
$lng['requirements']['phpmbstring'] = 'PHP mbstring-extension...';
|
||||
$lng['requirements']['phpzip'] = 'PHP zip-extension...';
|
||||
$lng['requirements']['phpjson'] = 'PHP json-extension...';
|
||||
$lng['requirements']['bcmathdescription'] = 'Traffic-calculation related functions will not work correctly!';
|
||||
$lng['requirements']['curldescription'] = 'Version-check and news-feed may not work correctly!';
|
||||
$lng['requirements']['zipdescription'] = 'The auto-update feature requires the zip extension.';
|
||||
$lng['requirements']['openbasedir'] = 'open_basedir...';
|
||||
$lng['requirements']['openbasedirenabled'] = 'Froxlor will not work properly with open_basedir enabled. Please disable open_basedir for Froxlor in the coresponding php.ini';
|
||||
$lng['requirements']['mysqldump'] = 'MySQL dump tool';
|
||||
$lng['requirements']['mysqldumpmissing'] = 'Automatic backup of possible existing database is not possible. Please install mysql-client tools';
|
||||
$lng['requirements']['diedbecauseofrequirements'] = 'Cannot install Froxlor without these requirements! Try to fix them and retry.';
|
||||
$lng['requirements']['froxlor_succ_checks'] = 'All requirements are satisfied';
|
||||
|
||||
@@ -55,11 +61,13 @@ $lng['install']['admin_account'] = 'Administrator Account';
|
||||
$lng['install']['admin_user'] = 'Administrator Username';
|
||||
$lng['install']['admin_pass1'] = 'Administrator Password';
|
||||
$lng['install']['admin_pass2'] = 'Administrator-Password (confirm)';
|
||||
$lng['install']['activate_newsfeed'] = 'Enable the official newsfeed<br><small>(https://inside.froxlor.org/news/)</small>';
|
||||
$lng['install']['serversettings'] = 'Server settings';
|
||||
$lng['install']['servername'] = 'Server name (FQDN, no ip-address)';
|
||||
$lng['install']['serverip'] = 'Server IP';
|
||||
$lng['install']['webserver'] = 'Webserver';
|
||||
$lng['install']['apache2'] = 'Apache 2';
|
||||
$lng['install']['apache2'] = 'Apache 2.2';
|
||||
$lng['install']['apache24'] = 'Apache 2.4';
|
||||
$lng['install']['lighttpd'] = 'LigHTTPd';
|
||||
$lng['install']['nginx'] = 'NGINX';
|
||||
$lng['install']['httpuser'] = 'HTTP username';
|
||||
@@ -78,8 +86,8 @@ $lng['install']['changing_data'] = 'Adjusting settings...';
|
||||
$lng['install']['creating_entries'] = 'Inserting new values...';
|
||||
$lng['install']['adding_admin_user'] = 'Creating admin-account...';
|
||||
$lng['install']['creating_configfile'] = 'Creating configfile...';
|
||||
$lng['install']['creating_configfile_temp'] = 'File was saved in /tmp/userdata.inc.php, please move to lib/.';
|
||||
$lng['install']['creating_configfile_failed'] = 'Could not create lib/userdata.inc.php, please create it manually with the following content:';
|
||||
$lng['install']['creating_configfile_temp'] = 'File was saved in /tmp/userdata.inc.php, please move to ' . dirname(dirname(__DIR__)) . '/lib/.';
|
||||
$lng['install']['creating_configfile_failed'] = 'Could not create ' . dirname(dirname(__DIR__)) . '/lib/userdata.inc.php, please create it manually with the following content:';
|
||||
$lng['install']['froxlor_succ_installed'] = 'Froxlor was installed successfully.';
|
||||
|
||||
$lng['click_here_to_refresh'] = 'Click here to check again';
|
||||
|
||||
@@ -16,24 +16,21 @@
|
||||
* @package Language
|
||||
*
|
||||
*/
|
||||
|
||||
$lng['requirements']['title'] = 'Vérification des prérequis système...';
|
||||
$lng['requirements']['installed'] = 'installé';
|
||||
$lng['requirements']['not_true'] = 'non';
|
||||
$lng['requirements']['notfound'] = 'introuvable';
|
||||
$lng['requirements']['notinstalled'] = 'non installé';
|
||||
$lng['requirements']['activated'] = 'activé';
|
||||
$lng['requirements']['phpversion'] = 'PHP version >= 5.3';
|
||||
$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime...';
|
||||
$lng['requirements']['phpmagic_quotes_runtime_description'] = 'Le réglage PHP "magic_quotes_runtime" doit être positionné à "Off". Nous l\'avons désactivé temporairement pour l\'instant; merci de corriger le php.ini correspondant.';
|
||||
$lng['requirements']['phpversion'] = 'PHP version >= 5.6';
|
||||
$lng['requirements']['phppdo'] = 'extension PHP PDO et pilote PDO-MySQL ...';
|
||||
$lng['requirements']['phpxml'] = 'extension PHP XML...';
|
||||
$lng['requirements']['phpfilter'] = 'extension PHP filter ...';
|
||||
$lng['requirements']['phpposix'] = 'extension PHP posix ...';
|
||||
$lng['requirements']['phpbcmath'] = 'extension PHP bcmath ...';
|
||||
$lng['requirements']['phpcurl'] = 'extension PHP curl...';
|
||||
$lng['requirements']['phpmbstring'] = 'extension PHP mbstring...';
|
||||
$lng['requirements']['bcmathdescription'] = 'Les fonctions de calcul de traffic ne fonctionneront pas correctement!';
|
||||
$lng['requirements']['curldescription'] = 'Les vérifications de version et les flux d\'information peuvent ne pas fonctionner correctement!';
|
||||
$lng['requirements']['openbasedir'] = 'open_basedir...';
|
||||
$lng['requirements']['openbasedirenabled'] = 'Froxlor ne fonctionnera pas correctement avec open_basedir activé. Merci de désactiver open_basedir pour Froxlor dans le php.ini correspondant';
|
||||
$lng['requirements']['diedbecauseofrequirements'] = 'Impossible d\'installer Froxlor sans ces prérequis! Essayez de les corriger et essayez à nouveau.';
|
||||
@@ -60,6 +57,7 @@ $lng['install']['servername'] = 'Nom du serveur (FQDN, pas d\'adresse IP)';
|
||||
$lng['install']['serverip'] = 'Adresse IP du serveur';
|
||||
$lng['install']['webserver'] = 'Serveur Web';
|
||||
$lng['install']['apache2'] = 'Apache 2';
|
||||
$lng['install']['apache24'] = 'Apache 2.4';
|
||||
$lng['install']['lighttpd'] = 'LigHTTPd';
|
||||
$lng['install']['nginx'] = 'NGINX';
|
||||
$lng['install']['httpuser'] = 'Nom d\'utilisateur HTTP';
|
||||
@@ -78,8 +76,8 @@ $lng['install']['changing_data'] = 'Ajustement des paramètres...';
|
||||
$lng['install']['creating_entries'] = 'Insertion des nouvelles valeurs...';
|
||||
$lng['install']['adding_admin_user'] = 'Création du compte administrateur...';
|
||||
$lng['install']['creating_configfile'] = 'Création du fichier de configuration...';
|
||||
$lng['install']['creating_configfile_temp'] = 'Le fichier a été enregistré dans /tmp/userdata.inc.php, merci de le déplacer dans lib/.';
|
||||
$lng['install']['creating_configfile_failed'] = 'Impossible de créer lib/userdata.inc.php, merci de le créer manuellement avec le contenu suivant:';
|
||||
$lng['install']['creating_configfile_temp'] = 'Le fichier a été enregistré dans /tmp/userdata.inc.php, merci de le déplacer dans ' . dirname(dirname(__DIR__)) . '/lib/.';
|
||||
$lng['install']['creating_configfile_failed'] = 'Impossible de créer ' . dirname(dirname(__DIR__)) . '/lib/userdata.inc.php, merci de le créer manuellement avec le contenu suivant:';
|
||||
$lng['install']['froxlor_succ_installed'] = 'Froxlor a été installé avec succès.';
|
||||
|
||||
$lng['click_here_to_refresh'] = 'Cliquez ici pour vérifier à nouveau';
|
||||
|
||||
@@ -16,26 +16,32 @@
|
||||
* @package Language
|
||||
*
|
||||
*/
|
||||
|
||||
$lng['requirements']['title'] = 'Prüfe Systemvoraussetzungen...';
|
||||
$lng['requirements']['installed'] = 'installiert';
|
||||
$lng['requirements']['not_true'] = 'nein';
|
||||
$lng['requirements']['notfound'] = 'nicht gefunden';
|
||||
$lng['requirements']['notinstalled'] = 'nicht installiert';
|
||||
$lng['requirements']['activated'] = 'ist aktiviert.';
|
||||
$lng['requirements']['phpversion'] = 'PHP Version >= 5.3';
|
||||
$lng['requirements']['phpmagic_quotes_runtime'] = 'magic_quotes_runtime';
|
||||
$lng['requirements']['phpmagic_quotes_runtime_description'] = 'Die PHP Einstellung "magic_quotes_runtime" muss deaktiviert sein ("Off"). Die Einstellung wurde temporär deaktiviert, bitte ändern Sie diese in der entsprechenden php.ini.';
|
||||
$lng['requirements']['phpversion'] = 'PHP Version >= 5.6';
|
||||
$lng['requirements']['newerphpprefered'] = 'Passt, aber php-7.0 wird bevorzugt.';
|
||||
$lng['requirements']['phppdo'] = 'PHP PDO Erweiterung und PDO-MySQL Treiber...';
|
||||
$lng['requirements']['phpsession'] = 'PHP session-Erweiterung...';
|
||||
$lng['requirements']['phpctype'] = 'PHP ctype-Erweiterung...';
|
||||
$lng['requirements']['phpsimplexml'] = 'PHP SimpleXML-Erweiterung...';
|
||||
$lng['requirements']['phpxml'] = 'PHP XML-Erweiterung...';
|
||||
$lng['requirements']['phpfilter'] = 'PHP filter-Erweiterung...';
|
||||
$lng['requirements']['phpposix'] = 'PHP posix-Erweiterung...';
|
||||
$lng['requirements']['phpbcmath'] = 'PHP bcmath-Erweiterung...';
|
||||
$lng['requirements']['phpcurl'] = 'PHP curl-Erweiterung...';
|
||||
$lng['requirements']['phpmbstring'] = 'PHP mbstring-Erweiterung...';
|
||||
$lng['requirements']['phpzip'] = 'PHP zip-Erweiterung...';
|
||||
$lng['requirements']['phpjson'] = 'PHP json-Erweiterung...';
|
||||
$lng['requirements']['bcmathdescription'] = 'Traffic-Berechnungs bezogene Funktionen stehen nicht vollständig zur Verfügung!';
|
||||
$lng['requirements']['curldescription'] = 'Versions-Prüfung und News-Feed stehen nicht vollständig zur Verfügung!';
|
||||
$lng['requirements']['zipdescription'] = 'Die Auto-Update Funktion benötigt die zip Erweiterung.';
|
||||
$lng['requirements']['openbasedir'] = 'open_basedir genutzt wird...';
|
||||
$lng['requirements']['openbasedirenabled'] = 'Froxlor wird mit aktiviertem open_basedir nicht vollständig funktionieren. Bitte deaktivieren Sie open_basedir für Froxlor in der entsprechenden php.ini';
|
||||
$lng['requirements']['mysqldump'] = 'MySQL dump Tool';
|
||||
$lng['requirements']['mysqldumpmissing'] = 'Ein automatisches Backup einer möglicherweise schon existierenden Datenbank nicht möglich. Bitte mysql-client installieren';
|
||||
$lng['requirements']['diedbecauseofrequirements'] = 'Kann Froxlor ohne diese Voraussetzungen nicht installieren! Beheben Sie die angezeigten Probleme und versuchen Sie es erneut.';
|
||||
$lng['requirements']['froxlor_succ_checks'] = 'Alle Vorraussetzungen sind erfüllt';
|
||||
|
||||
@@ -55,11 +61,13 @@ $lng['install']['admin_account'] = 'Admin-Zugang';
|
||||
$lng['install']['admin_user'] = 'Administrator-Benutzername';
|
||||
$lng['install']['admin_pass1'] = 'Administrator-Passwort';
|
||||
$lng['install']['admin_pass2'] = 'Administrator-Passwort (Bestätigung)';
|
||||
$lng['install']['activate_newsfeed'] = 'Aktiviere das offizielle Newsfeed<br><small>(https://inside.froxlor.org/news/)</small>';
|
||||
$lng['install']['serversettings'] = 'Servereinstellungen';
|
||||
$lng['install']['servername'] = 'Servername (FQDN, keine IP-Adresse)';
|
||||
$lng['install']['serverip'] = 'Server-IP';
|
||||
$lng['install']['webserver'] = 'Webserver';
|
||||
$lng['install']['apache2'] = 'Apache 2';
|
||||
$lng['install']['apache24'] = 'Apache 2.4';
|
||||
$lng['install']['lighttpd'] = 'LigHTTPd';
|
||||
$lng['install']['nginx'] = 'NGINX';
|
||||
$lng['install']['httpuser'] = 'HTTP Username';
|
||||
@@ -78,8 +86,8 @@ $lng['install']['changing_data'] = 'Einstellungen anpassen...';
|
||||
$lng['install']['creating_entries'] = 'Trage neue Werte ein...';
|
||||
$lng['install']['adding_admin_user'] = 'Erstelle Admin-Benutzer...';
|
||||
$lng['install']['creating_configfile'] = 'Erstelle Konfigurationsdatei...';
|
||||
$lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach lib/ verschieben.';
|
||||
$lng['install']['creating_configfile_failed'] = 'Konnte lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:';
|
||||
$lng['install']['creating_configfile_temp'] = 'Datei wurde in /tmp/userdata.inc.php gespeichert, bitte nach ' . dirname(dirname(__DIR__)) . '/lib/ verschieben.';
|
||||
$lng['install']['creating_configfile_failed'] = 'Konnte ' . dirname(dirname(__DIR__)) . '/lib/userdata.inc.php nicht erstellen, bitte manuell mit folgendem Inhalt anlegen:';
|
||||
$lng['install']['froxlor_succ_installed'] = 'Froxlor wurde erfolgreich installiert.';
|
||||
|
||||
$lng['click_here_to_refresh'] = 'Hier klicken, um erneut zu prüfen';
|
||||
|
||||
31
install/scripts/config-services.php
Executable file
@@ -0,0 +1,31 @@
|
||||
#!/usr/bin/php
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2018 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2018-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Cron
|
||||
*
|
||||
*/
|
||||
|
||||
// Check if we're in the CLI
|
||||
if (@php_sapi_name() !== 'cli') {
|
||||
die('This script will only work in the shell.');
|
||||
}
|
||||
|
||||
require dirname(dirname(__DIR__)) . '/vendor/autoload.php';
|
||||
|
||||
// give control to command line handler
|
||||
try {
|
||||
\Froxlor\Cli\ConfigServicesCmd::processParameters($argc, $argv);
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\Cli\ConfigServicesCmd::printerr($e->getMessage());
|
||||
}
|
||||
@@ -1,160 +0,0 @@
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the SysCP project.
|
||||
* Copyright (c) 2003-2007 the SysCP Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.syscp.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Martin Burchert <eremit@syscp.org>
|
||||
* @license GPLv2 http://files.syscp.org/misc/COPYING.txt
|
||||
* @package System
|
||||
*
|
||||
*/
|
||||
|
||||
// some configs
|
||||
$baseLanguage = 'english.lng.php';
|
||||
|
||||
// Check if we're in the CLI
|
||||
if(@php_sapi_name() != 'cli'
|
||||
&& @php_sapi_name() != 'cgi'
|
||||
&& @php_sapi_name() != 'cgi-fcgi'
|
||||
) {
|
||||
die('This script will only work in the shell.');
|
||||
}
|
||||
|
||||
// Check argument count
|
||||
/*
|
||||
if (sizeof($argv) != 2) {
|
||||
print_help($argv);
|
||||
exit;
|
||||
}
|
||||
*/
|
||||
|
||||
// Load the contents of the given path
|
||||
$path = $argv[1];
|
||||
$_f = isset($argv[2]) ? $argv[2] : null;
|
||||
$files = array();
|
||||
|
||||
if ($dh = opendir($path)) {
|
||||
while (false !== ($file = readdir($dh))) {
|
||||
if ($file != "."
|
||||
&& $file != ".."
|
||||
&& !is_dir($file)
|
||||
&& preg_match('/(.+)\.lng\.php/i', $file)
|
||||
) {
|
||||
if (is_null($_f) || (!is_null($_f) && ($file == $_f || $file == $baseLanguage))) {
|
||||
$files[$file] = str_replace('//', '/', $path . '/' . $file);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
closedir($dh);
|
||||
} else {
|
||||
print "ERROR: The path you requested cannot be read! \n ";
|
||||
print "\n";
|
||||
print_help();
|
||||
exit;
|
||||
}
|
||||
|
||||
// check if there is the default language defined
|
||||
if (!isset($files[$baseLanguage])) {
|
||||
print "ERROR: The baselanguage cannot be found! \n";
|
||||
print "\n";
|
||||
print_help();
|
||||
exit;
|
||||
}
|
||||
|
||||
// import the baselanguage
|
||||
$base = import($files[$baseLanguage]);
|
||||
|
||||
// and unset it in the files, because we don't need to compare base to base
|
||||
unset($files[$baseLanguage]);
|
||||
|
||||
// compare each language with the baselanguage
|
||||
foreach ($files as $key => $file) {
|
||||
$comp = import($file);
|
||||
|
||||
print "\n\nComparing " . $baseLanguage . " to " . $key . "\n";
|
||||
$result = compare($base, $comp);
|
||||
|
||||
if (is_array($result)
|
||||
&& sizeof($result) > 0
|
||||
) {
|
||||
print " found missing strings: \n";
|
||||
foreach ($result as $value) {
|
||||
print " " . $value . "\n";
|
||||
}
|
||||
} else {
|
||||
print " no missing strings found! \n ";
|
||||
}
|
||||
|
||||
print "\nReverse Checking " . $key . " to " . $baseLanguage . "\n";
|
||||
$result = compare($comp, $base);
|
||||
|
||||
if (is_array($result)
|
||||
&& sizeof($result) > 0
|
||||
) {
|
||||
print " found strings not in basefile: \n";
|
||||
foreach ($result as $key => $value) {
|
||||
print " " . $value . "\n";
|
||||
}
|
||||
} else {
|
||||
print " There are no strings which are not in the basefile! \n ";
|
||||
}
|
||||
}
|
||||
|
||||
//-----------------------------------------------------------------------------------------
|
||||
// FUNCTIONS
|
||||
//-----------------------------------------------------------------------------------------
|
||||
|
||||
/**
|
||||
* prints the help screen
|
||||
*
|
||||
* @param array $argv
|
||||
*/
|
||||
function print_help($argv) {
|
||||
print "Usage: php " . $argv[0] . " /PATH/TO/LNG \n";
|
||||
print " \n ";
|
||||
}
|
||||
|
||||
function import($file) {
|
||||
|
||||
$input = file($file);
|
||||
$return = array();
|
||||
|
||||
foreach ($input as $key => $value) {
|
||||
|
||||
if (!preg_match('/^\$/', $value)) {
|
||||
unset($input[$key]);
|
||||
} else {
|
||||
// generate the key
|
||||
$key = preg_replace('/^\$lng\[\'(.*)=(.*)$/U', '\\1', $value);
|
||||
$key = str_replace('[\'', '/', $key);
|
||||
$key = trim(str_replace('\']', '', $key));
|
||||
|
||||
//generate the value
|
||||
$value = trim($value);
|
||||
|
||||
// set the result
|
||||
$return[$key] = $value;
|
||||
}
|
||||
}
|
||||
return $return;
|
||||
}
|
||||
|
||||
function compare($array1, $array2) {
|
||||
|
||||
$result = array();
|
||||
|
||||
foreach ($array1 as $key => $value) {
|
||||
|
||||
if (!isset($array2[$key])) {
|
||||
$result[$key] = $value;
|
||||
}
|
||||
}
|
||||
return $result;
|
||||
}
|
||||
31
install/scripts/switch-server-ip.php
Executable file
@@ -0,0 +1,31 @@
|
||||
#!/usr/bin/php
|
||||
<?php
|
||||
|
||||
/**
|
||||
* This file is part of the Froxlor project.
|
||||
* Copyright (c) 2016 the Froxlor Team (see authors).
|
||||
*
|
||||
* For the full copyright and license information, please view the COPYING
|
||||
* file that was distributed with this source code. You can also view the
|
||||
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
||||
*
|
||||
* @copyright (c) the authors
|
||||
* @author Froxlor team <team@froxlor.org> (2016-)
|
||||
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
||||
* @package Cron
|
||||
*
|
||||
*/
|
||||
|
||||
// Check if we're in the CLI
|
||||
if (@php_sapi_name() !== 'cli') {
|
||||
die('This script will only work in the shell.');
|
||||
}
|
||||
|
||||
require dirname(dirname(__DIR__)) . '/vendor/autoload.php';
|
||||
|
||||
// give control to command line handler
|
||||
try {
|
||||
\Froxlor\Cli\SwitchServerIpCmd::processParameters($argc, $argv);
|
||||
} catch (Exception $e) {
|
||||
\Froxlor\Cli\SwitchServerIpCmd::printerr($e->getMessage());
|
||||
}
|
||||
158
install/templates/assets/css/install.css
Executable file → Normal file
@@ -1,16 +1,44 @@
|
||||
@charset "UTF-8";
|
||||
/* RESET */
|
||||
html,body,div,ul,ol,li,dl,dt,dd,h1,h2,h3,h4,h5,h6,pre,form,p,blockquote,fieldset,input { margin:0; padding:0; }
|
||||
h1,h2,h3,h4,h5,h6,pre,code,address,caption,cite,code,em,strong,th { font-size:1em; font-weight:400; font-style:normal; }
|
||||
ul,ol { list-style:none; }
|
||||
fieldset,img { border:none; }
|
||||
caption,th { text-align:left; }
|
||||
table { border-collapse:collapse; border-spacing:0; }
|
||||
article,aside,details,figcaption,figure,footer,header,hgroup,menu,nav,section { display:block; }
|
||||
html, body, div, ul, ol, li, dl, dt, dd, h1, h2, h3, h4, h5, h6, pre,
|
||||
form, p, blockquote, fieldset, input {
|
||||
margin: 0;
|
||||
padding: 0;
|
||||
}
|
||||
|
||||
h1, h2, h3, h4, h5, h6, pre, code, address, caption, cite, code, em,
|
||||
strong, th {
|
||||
font-size: 1em;
|
||||
font-weight: 400;
|
||||
font-style: normal;
|
||||
}
|
||||
|
||||
ul, ol {
|
||||
list-style: none;
|
||||
}
|
||||
|
||||
fieldset, img {
|
||||
border: none;
|
||||
}
|
||||
|
||||
caption, th {
|
||||
text-align: left;
|
||||
}
|
||||
|
||||
table {
|
||||
border-collapse: collapse;
|
||||
border-spacing: 0;
|
||||
}
|
||||
|
||||
article, aside, details, figcaption, figure, footer, header, hgroup,
|
||||
menu, nav, section {
|
||||
display: block;
|
||||
}
|
||||
|
||||
/* TYPE */
|
||||
html, body {
|
||||
font:12px/18px 'Lucida Grande','Lucida Sans Unicode',Helvetica,Arial,Verdana,sans-serif;
|
||||
font: 12px/18px 'Lucida Grande', 'Lucida Sans Unicode', Helvetica, Arial,
|
||||
Verdana, sans-serif;
|
||||
background-color: #f5f5f5;
|
||||
color: #444;
|
||||
-webkit-font-smoothing: subpixel-antialiased;
|
||||
@@ -48,7 +76,6 @@ h3 {
|
||||
font-size: 15px;
|
||||
}
|
||||
|
||||
|
||||
img {
|
||||
border: 0;
|
||||
vertical-align: middle;
|
||||
@@ -60,7 +87,7 @@ td a {
|
||||
|
||||
.bradius {
|
||||
border-radius: 5px 5px 5px 5px;
|
||||
box-shadow: rgba(0, 0, 0, 0.34902) 0px 1px 3px 0px;
|
||||
box-shadow: rgba(0, 0, 0, 0.34902) 0 1px 3px 0;
|
||||
}
|
||||
|
||||
/* FOOTER */
|
||||
@@ -78,10 +105,7 @@ footer a,footer a:active,footer a:visited {
|
||||
|
||||
.install {
|
||||
background-color: #fff;
|
||||
margin: 20px;
|
||||
margin-left: auto;
|
||||
margin-right: auto;
|
||||
margin-bottom: 12px;
|
||||
margin: 20px auto 12px;
|
||||
width: 800px;
|
||||
}
|
||||
|
||||
@@ -124,6 +148,10 @@ p {
|
||||
padding: 0;
|
||||
}
|
||||
|
||||
.installsec fieldset p, .installsec fieldset h3 {
|
||||
clear: both;
|
||||
}
|
||||
|
||||
.installsec legend {
|
||||
display: none;
|
||||
}
|
||||
@@ -185,13 +213,14 @@ p.submit {
|
||||
* error message display
|
||||
*/
|
||||
.errorcontainer {
|
||||
background:url(../img/icons/error_big.png) 10px center no-repeat #ffedef;
|
||||
background: url(../img/icons/error_big.png) 10px center no-repeat
|
||||
#ffedef;
|
||||
border: 1px solid #ffc2ca;
|
||||
padding: 10px 10px 10px 68px !important;
|
||||
margin: 10px 0 10px 0 !important;
|
||||
text-align: left !important;
|
||||
overflow: hidden;
|
||||
box-shadow: 0px 0px 0px black;
|
||||
box-shadow: 0 0 0 black;
|
||||
}
|
||||
|
||||
.errortitle {
|
||||
@@ -208,14 +237,16 @@ p.submit {
|
||||
* warning message display
|
||||
*/
|
||||
.warningcontainer, .ui-dialog {
|
||||
background:url(../img/icons/warning_big.png) 10px center no-repeat #fffecc;
|
||||
background: url(../img/icons/warning_big.png) 10px center no-repeat
|
||||
#fffecc;
|
||||
border: 1px solid #f3c37e;
|
||||
padding: 10px 10px 10px 68px !important;
|
||||
margin: 10px 0 10px 0 !important;
|
||||
text-align: left !important;
|
||||
overflow: hidden;
|
||||
box-shadow: 0px 0px 0px black;
|
||||
box-shadow: 0 0 0 black;
|
||||
}
|
||||
|
||||
.ui-dialog {
|
||||
padding: 10px !important;
|
||||
}
|
||||
@@ -239,7 +270,7 @@ p.submit {
|
||||
margin: 10px 0 10px 0 !important;
|
||||
text-align: left !important;
|
||||
overflow: hidden;
|
||||
box-shadow: 0px 0px 0px black;
|
||||
box-shadow: 0 0 0 black;
|
||||
}
|
||||
|
||||
.successtitle {
|
||||
@@ -261,7 +292,7 @@ p.submit {
|
||||
margin: 10px 0 10px 0 !important;
|
||||
text-align: left !important;
|
||||
overflow: hidden;
|
||||
box-shadow: 0px 0px 0px black;
|
||||
box-shadow: 0 0 0 black;
|
||||
}
|
||||
|
||||
.neutraltitle {
|
||||
@@ -292,10 +323,7 @@ a:hover {
|
||||
* main container
|
||||
*/
|
||||
.main {
|
||||
margin-left:240px;
|
||||
margin-right:10px;
|
||||
margin-top:105px;
|
||||
margin-bottom:0;
|
||||
margin: 105px 10px 0 240px;
|
||||
background-color: #fff;
|
||||
padding: 30px 30px 30px 30px;
|
||||
min-height: 400px;
|
||||
@@ -317,17 +345,18 @@ table {
|
||||
border-spacing: 0;
|
||||
border: 1px solid #d1d5d8;
|
||||
border-collapse: separate;
|
||||
box-shadow:0px 0px 0px black !important;
|
||||
box-shadow: 0 0 0 black !important;
|
||||
}
|
||||
|
||||
table thead th, table th {
|
||||
border-top: 1px solid #d1d5d8;
|
||||
border-bottom: 1px solid #d1d5d8;
|
||||
height: 25px !important;
|
||||
padding: 5px 0px 5px 8px;
|
||||
padding: 5px 0 5px 8px;
|
||||
background-color: #e9edf0;
|
||||
font-weight: bold;
|
||||
}
|
||||
|
||||
table thead:first-child th, table:first-child th {
|
||||
border-top: none !important;
|
||||
}
|
||||
@@ -335,16 +364,21 @@ table thead:first-child th, table:first-child th {
|
||||
table th {
|
||||
border-top: 0;
|
||||
}
|
||||
|
||||
th a:hover {
|
||||
text-decoration: none;
|
||||
}
|
||||
|
||||
th a img {
|
||||
|
||||
}
|
||||
|
||||
th a:nth-child(odd) img {
|
||||
position: relative;
|
||||
top: -5px;
|
||||
left: 4px;
|
||||
}
|
||||
|
||||
th a:nth-child(even) img {
|
||||
position: relative;
|
||||
top: 3px;
|
||||
@@ -362,6 +396,7 @@ table thead:first-child th {
|
||||
table tbody td {
|
||||
border-bottom: 1px dotted #ccc;
|
||||
}
|
||||
|
||||
table tbody tr:last-child td {
|
||||
border-bottom: 0;
|
||||
}
|
||||
@@ -390,10 +425,7 @@ table tbody tr:last-child td {
|
||||
}
|
||||
|
||||
td {
|
||||
padding-top:5px;
|
||||
padding-left:10px;
|
||||
padding-right: 10px;
|
||||
padding-bottom:5px;
|
||||
padding: 5px 10px;
|
||||
min-height: 20px;
|
||||
}
|
||||
|
||||
@@ -447,45 +479,55 @@ input[type="button"],input[type="submit"],input[type="reset"] {
|
||||
min-width: 80px;
|
||||
height: 26px;
|
||||
background-image: none;
|
||||
border-width: 0px;
|
||||
}
|
||||
.loginsec input[type="button"], .loginsec input[type="submit"], .loginsec input[type="reset"] {
|
||||
|
||||
.loginsec input[type="button"], .loginsec input[type="submit"],
|
||||
.loginsec input[type="reset"] {
|
||||
margin: 0 1px;
|
||||
}
|
||||
input[type="button"]:hover,input[type="submit"]:hover,input[type="reset"]:hover {
|
||||
|
||||
input[type="button"]:hover, input[type="submit"]:hover, input[type="reset"]:hover
|
||||
{
|
||||
color: #333;
|
||||
background-color: #dcdcdc;
|
||||
}
|
||||
input[type="button"]:active,input[type="submit"]:active,input[type="reset"]:active {
|
||||
|
||||
input[type="button"]:active, input[type="submit"]:active, input[type="reset"]:active
|
||||
{
|
||||
-webkit-box-shadow: inset 0 1px 8px rgba(0, 0, 0, 0.25);
|
||||
-moz-box-shadow: inset 0 1px 8px rgba(0, 0, 0, 0.25);
|
||||
box-shadow: inset 0 1px 8px rgba(0, 0, 0, 0.25);
|
||||
color: white !important;
|
||||
}
|
||||
|
||||
input[type="submit"], input[class="yesbutton"] {
|
||||
color: white;
|
||||
background-color: #35aa47;
|
||||
}
|
||||
|
||||
input[type="submit"]:hover, input[class="yesbutton"]:hover {
|
||||
color: white;
|
||||
background-color: #1d943b;
|
||||
}
|
||||
|
||||
input[class="submit"]:active, input[class="yesbutton"]:active {
|
||||
background-color: #35aa47;
|
||||
}
|
||||
|
||||
input[class="nobutton"], input[type="reset"] {
|
||||
color: white;
|
||||
background-color: #d84a38;
|
||||
}
|
||||
|
||||
input[class="nobutton"]:hover, input[type="reset"]:hover {
|
||||
color: white;
|
||||
background-color: #c53727;
|
||||
}
|
||||
|
||||
input[class="nobutton"]:active, input[type="reset"]:active {
|
||||
background-color: #dd4b39;
|
||||
}
|
||||
|
||||
|
||||
input[type="checkbox"] {
|
||||
background: #dae7ee;
|
||||
padding: 0;
|
||||
@@ -495,6 +537,7 @@ input[type="checkbox"] {
|
||||
}
|
||||
|
||||
input[type="radio"] {
|
||||
vertical-align: middle;
|
||||
margin: 0 10px 0 10px;
|
||||
height: 22px;
|
||||
}
|
||||
@@ -507,13 +550,15 @@ select {
|
||||
margin-bottom: 5px;
|
||||
min-width: 100px;
|
||||
}
|
||||
|
||||
select.dropdown {
|
||||
padding: 2px 4px 2px 24px;
|
||||
height: 26px;
|
||||
border: 1px solid #d9d9d9;
|
||||
margin-bottom: 5px;
|
||||
border-radius: 3px;
|
||||
background: url(../../../../templates/Sparkle/assets/img/icons/down.png) no-repeat 9px;
|
||||
background: url(../../../../templates/Sparkle/assets/img/icons/down.png)
|
||||
no-repeat 9px;
|
||||
-webkit-appearance: none;
|
||||
-moz-appearance: none;
|
||||
appearance: none;
|
||||
@@ -546,22 +591,47 @@ select.dropdown {
|
||||
margin-bottom: .5em;
|
||||
font-size: 120%;
|
||||
}
|
||||
|
||||
.installprogress {
|
||||
width: 100%;
|
||||
background-color: #e4e4e4;
|
||||
height: 5px;
|
||||
border-bottom: 1px solid #d1d5d8;
|
||||
}
|
||||
|
||||
.installprogress .bar {
|
||||
background-color: #35aa47;
|
||||
height: 5px;
|
||||
}
|
||||
|
||||
.red { color: #ff0000; }
|
||||
.green { color: green; }
|
||||
.orange { color: orange; }
|
||||
.blue { color: blue; }
|
||||
.install-block { width: 65%; }
|
||||
.install-step { width: 250px; }
|
||||
.install-h3 { text-align: center; }
|
||||
.install-text { margin: 20px 20px 0 !important; }
|
||||
.red {
|
||||
color: #ff0000;
|
||||
}
|
||||
|
||||
.green {
|
||||
color: green;
|
||||
}
|
||||
|
||||
.orange {
|
||||
color: orange;
|
||||
}
|
||||
|
||||
.blue {
|
||||
color: blue;
|
||||
}
|
||||
|
||||
.install-block {
|
||||
width: 65%;
|
||||
}
|
||||
|
||||
.install-step {
|
||||
width: 250px;
|
||||
}
|
||||
|
||||
.install-h3 {
|
||||
text-align: center;
|
||||
}
|
||||
|
||||
.install-text {
|
||||
margin: 20px 20px 0 !important;
|
||||
}
|
||||
0
install/templates/assets/img/favicon.ico
Executable file → Normal file
|
Before Width: | Height: | Size: 1.4 KiB After Width: | Height: | Size: 1.4 KiB |