setting version to 0.9.33.2 for bugfix release

Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>

actions/admin/settings/210.security.php

@@ -45,7 +45,7 @@ return array(
 					'type' => 'option',
 					'default' => 0,
 					'option_mode' => 'one',
-					'option_options' => array(0 => $lng['serversettings']['systemdefault'], 1 => 'MD5', 2 => 'BLOWFISH', 3 => 'SHA-256', 4 => 'SHA-512'),
+					'option_options_method' => 'getAvailablePasswordHashes',
 					'save_method' => 'storeSettingField',
 					),
 				'system_allow_error_report_admin' => array(

admin_admins.php

@@ -202,7 +202,10 @@ if ($page == 'admins'
 			$email = $idna_convert->encode(validate($_POST['email'], 'email'));
 
 			$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
-			$custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+			$custom_notes_show = 0;
+			if (isset($_POST['custom_notes_show'])) {
+			    $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+			}
 
 			$loginname = validate($_POST['loginname'], 'loginname');
 			$password = validate($_POST['admin_password'], 'password');
@@ -498,7 +501,10 @@ if ($page == 'admins'
 				$email = $idna_convert->encode(validate($_POST['email'], 'email'));
 
 				$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
-				$custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+				$custom_notes_show = $result['custom_notes_show'];
+				if (isset($_POST['custom_notes_show'])) {
+				    $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+				}
 
 				if ($result['adminid'] == $userinfo['userid']) {
 

admin_customers.php

@@ -420,7 +420,10 @@ if ($page == 'customers'
 				$gender = intval_ressource($_POST['gender']);
 
 				$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
-				$custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+				$custom_notes_show = 0;
+				if (isset($_POST['custom_notes_show'])) {
+				    $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+				}
 
 				$diskspace = intval_ressource($_POST['diskspace']);
 				if (isset($_POST['diskspace_ul'])) {
@@ -889,7 +892,7 @@ if ($page == 'customers'
 							`domain` = :domain,
 							`customerid` = :customerid,
 							`adminid` = :adminid,
-							`parentdomainid` = '-1',
+							`parentdomainid` = '0',
 							`documentroot` = :docroot,
 							`zonefile` = '',
 							`isemaildomain` = '0',
@@ -1037,7 +1040,7 @@ if ($page == 'customers'
 		 */
 		$available_admins_stmt = Database::prepare("
                         SELECT * FROM `" . TABLE_PANEL_ADMINS . "`
-                        WHERE (`customers` = '-1' OR `customers` < `customers_used`)"
+                        WHERE (`customers` = '-1' OR `customers` > `customers_used`)"
 		);
 		Database::pexecute($available_admins_stmt);
 		$admin_select = makeoption("-----", 0, true, true, true);
@@ -1073,7 +1076,10 @@ if ($page == 'customers'
 				$move_to_admin = isset($_POST['move_to_admin']) ? intval_ressource($_POST['move_to_admin']) : 0;
 
 				$custom_notes = validate(str_replace("\r\n", "\n", $_POST['custom_notes']), 'custom_notes', '/^[^\0]*$/');
-				$custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+				$custom_notes_show = $result['custom_notes_show'];
+				if (isset($_POST['custom_notes_show'])) {
+				    $custom_notes_show = intval_ressource($_POST['custom_notes_show']);
+				}
 
 				$diskspace = intval_ressource($_POST['diskspace']);
 				if (isset($_POST['diskspace_ul'])) {
@@ -1248,7 +1254,7 @@ if ($page == 'customers'
 							`domain` = :domain,
 							`customerid` = :customerid,
 							`adminid` = :adminid,
-							`parentdomainid` = '-1',
+							`parentdomainid` = '0',
 							`documentroot` = :docroot,
 							`zonefile` = '',
 							`isemaildomain` = '0',

index.php

@@ -119,15 +119,23 @@ if ($action == 'login') {
 			redirectTo('index.php', array('showmessage' => '3'));
 			exit;
 		} elseif (validatePasswordLogin($userinfo, $password, $table, $uid)) {
-			// login correct
-			// reset loginfail_counter, set lastlogin_succ
-			$stmt = Database::prepare("UPDATE $table
-				SET `lastlogin_succ`= :lastlogin_succ, `loginfail_count`='0'
-				WHERE `$uid`= :uid"
-			);
-			Database::pexecute($stmt, array("lastlogin_succ" => time(), "uid" => $userinfo[$uid]));
-			$userinfo['userid'] = $userinfo[$uid];
-			$userinfo['adminsession'] = $adminsession;
+		    // only show "you're banned" if the login was successfull
+		    // because we don't want to publish that the user does exist
+		    if ($userinfo['deactivated']) {
+		        unset($userinfo);
+		        redirectTo('index.php', array('showmessage' => '5'));
+		        exit;
+		    } else {
+		        // login correct
+		        // reset loginfail_counter, set lastlogin_succ
+		        $stmt = Database::prepare("UPDATE $table
+		              SET `lastlogin_succ`= :lastlogin_succ, `loginfail_count`='0'
+		              WHERE `$uid`= :uid"
+		        );
+		        Database::pexecute($stmt, array("lastlogin_succ" => time(), "uid" => $userinfo[$uid]));
+		        $userinfo['userid'] = $userinfo[$uid];
+		        $userinfo['adminsession'] = $adminsession;
+		    }
 		} else {
 			// login incorrect
 			$stmt = Database::prepare("UPDATE $table
@@ -269,6 +277,9 @@ if ($action == 'login') {
 		case 7:
 			$message = $lng['pwdreminder']['wrongcode'];
 			break;
+		case 8:
+		    $message = $lng['pwdreminder']['notallowed'];
+		    break;
 		}
 
 		$update_in_progress = '';
@@ -326,8 +337,8 @@ if ($action == 'forgotpwd') {
 
 			/* Check whether user is banned */
 			if ($user['deactivated']) {
-				$message = $lng['pwdreminder']['notallowed'];
-				redirectTo('index.php', array('showmessage' => '5'));
+				redirectTo('index.php', array('showmessage' => '8'));
+				exit;
 			}
 
 			if (($adminchecked && Settings::Get('panel.allow_preset_admin') == '1') || $adminchecked == false) {

install/froxlor.sql

@@ -538,7 +538,7 @@ INSERT INTO `panel_settings` (`settinggroup`, `varname`, `value`) VALUES
 	('panel', 'password_numeric', '0'),
 	('panel', 'password_special_char_required', '0'),
 	('panel', 'password_special_char', '!?<>§$%+#=@'),
-	('panel', 'version', '0.9.33-rc3');
+	('panel', 'version', '0.9.33.2');
 
 
 DROP TABLE IF EXISTS `panel_tasks`;

install/updates/froxlor/0.9/update_0.9.inc.php

@@ -2884,3 +2884,27 @@ if (isFroxlorVersion('0.9.33-rc2')) {
 	updateToVersion('0.9.33-rc3');
 
 }
+
+if (isFroxlorVersion('0.9.33-rc3')) {
+
+        showUpdateStep("Updating from 0.9.33-rc3 to 0.9.33 final");
+        lastStepStatus(0);
+        updateToVersion('0.9.33');
+
+}
+
+if (isFroxlorVersion('0.9.33')) {
+
+        showUpdateStep("Updating from 0.9.33 to 0.9.33.1");
+        lastStepStatus(0);
+        updateToVersion('0.9.33.1');
+
+}
+
+if (isFroxlorVersion('0.9.33.1')) {
+
+        showUpdateStep("Updating from 0.9.33.1 to 0.9.33.2");
+        lastStepStatus(0);
+        updateToVersion('0.9.33.2');
+
+}

lib/classes/database/class.Database.php

@@ -224,7 +224,7 @@ class Database {
 				&& isset($sql['root_password'])
 				&& (!isset($sql_root) || !is_array($sql_root))
 		) {
-			$sql_root = array(0 => array('caption' => 'Default', 'host' => $sql['host'], 'user' => $sql['root_user'], 'password' => $sql['root_password']));
+			$sql_root = array(0 => array('caption' => 'Default', 'host' => $sql['host'], 'socket' => (isset($sql['socket']) ? $sql['socket'] : null), 'user' => $sql['root_user'], 'password' => $sql['root_password']));
 			unset($sql['root_user']);
 			unset($sql['root_password']);
 		}
@@ -235,11 +235,15 @@ class Database {
 			$user = $sql_root[self::$_dbserver]['user'];
 			$password = $sql_root[self::$_dbserver]['password'];
 			$host = $sql_root[self::$_dbserver]['host'];
+			$socket = isset($sql_root[self::$_dbserver]['socket']) ? $sql_root[self::$_dbserver]['socket'] : null;
+			$port = isset($sql_root[self::$_dbserver]['port']) ? $sql_root[self::$_dbserver]['port'] : '3306';
 		} else {
 			$caption = 'localhost';
 			$user = $sql["user"];
 			$password = $sql["password"];
 			$host = $sql["host"];
+			$socket = isset($sql['socket']) ? $sql['socket'] : null;
+			$port = isset($sql['port']) ? $sql['port'] : '3306';
 		}
 
 		// save sql-access-data if needed
@@ -248,6 +252,8 @@ class Database {
 					'user' => $user,
 					'passwd' => $password,
 					'host' => $host,
+					'port' => $port,
+					'socket' => $socket,
 					'db' => $sql["db"],
 					'caption' => $caption
 			);
@@ -264,10 +270,11 @@ class Database {
 				'charset' => 'utf8'
 		);
 
-		if (!validateLocalHostname($host) && !validate_ip2($host, true, 'invalidip', true)) {
-			$dbconf["dsn"]['unix_socket'] = makeCorrectFile($host);
+		if ($socket != null) {
+			$dbconf["dsn"]['unix_socket'] = makeCorrectFile($socket);
 		} else {
 			$dbconf["dsn"]['host'] = $host;
+			$dbconf["dsn"]['port'] = $port;
 		}
 
 		self::$_dbname = $sql["db"];
@@ -305,6 +312,32 @@ class Database {
 	private static function _showerror($error, $showerror = true) {
 		global $userinfo, $theme, $linker;
 
+		// include userdata.inc.php
+		require FROXLOR_INSTALL_DIR."/lib/userdata.inc.php";
+
+		// le format
+		if (isset($sql['root_user'])
+		    && isset($sql['root_password'])
+		    && (!isset($sql_root) || !is_array($sql_root))
+		) {
+		    $sql_root = array(0 => array('caption' => 'Default', 'host' => $sql['host'], 'socket' => (isset($sql['socket']) ? $sql['socket'] : null), 'user' => $sql['root_user'], 'password' => $sql['root_password']));
+		}
+
+		// hide username/password in messages
+		$error_message = $error->getMessage();
+		$error_trace = $error->getTraceAsString();
+		// error-message
+		$error_message = str_replace($sql['password'], 'DB_UNPRIV_PWD', $error_message);
+		$error_message = str_replace($sql_root[0]['password'], 'DB_ROOT_PWD', $error_message);
+		// error-trace
+		$error_trace = str_replace($sql['password'], 'DB_UNPRIV_PWD', $error_trace);
+		$error_trace = str_replace($sql_root[0]['password'], 'DB_ROOT_PWD', $error_trace);
+
+		if ($error->getCode() == 2003) {
+		    $error_message = "Unable to connect to database. Either the mysql-server is not running or your user/password is wrong.";
+		    $error_trace = "";
+		}
+
 		/**
 		 * log to a file, so we can actually ask people for the error
 		 * (no one seems to find the stuff in the syslog)
@@ -313,11 +346,10 @@ class Database {
 		if (!file_exists($sl_dir)) {
 			@mkdir($sl_dir, 0755);
 		}
-		$sl_file = makeCorrectFile($sl_dir."/sql-error.log");
-		$sqllog = @fopen($sl_file, 'a');
-		@fwrite($sqllog, date('d.m.Y H:i', time())." --- ".str_replace("\n", " ", $error->getMessage())."\n");
-		@fwrite($sqllog, date('d.m.Y H:i', time())." --- DEBUG: \n".$error->getTraceAsString()."\n");
-		@fclose($sqllog);
+		openlog("froxlor", LOG_PID | LOG_PERROR, LOG_LOCAL0);
+		syslog(LOG_WARNING, str_replace("\n", " ", $error_message));
+		syslog(LOG_WARNING, str_replace("\n", " ", "--- DEBUG: ".$error_trace));
+		closelog();
 
 		/**
 		 * log error for reporting
@@ -326,38 +358,17 @@ class Database {
 		$err_file = makeCorrectFile($sl_dir."/".$errid."_sql-error.log");
 		$errlog = @fopen($err_file, 'w');
 		@fwrite($errlog, "|CODE ".$error->getCode()."\n");
-		@fwrite($errlog, "|MSG ".$error->getMessage()."\n");
+		@fwrite($errlog, "|MSG ".$error_message."\n");
 		@fwrite($errlog, "|FILE ".$error->getFile()."\n");
 		@fwrite($errlog, "|LINE ".$error->getLine()."\n");
-		@fwrite($errlog, "|TRACE\n".$error->getTraceAsString()."\n");
+		@fwrite($errlog, "|TRACE\n".$error_trace."\n");
 		@fclose($errlog);
 
 		if ($showerror) {
 
-			// include userdata.inc.php
-			require FROXLOR_INSTALL_DIR."/lib/userdata.inc.php";
-
 			// fallback
 			$theme = 'Sparkle';
 
-			// le format
-			if (isset($sql['root_user'])
-				&& isset($sql['root_password'])
-				&& (!isset($sql_root) || !is_array($sql_root))
-			) {
-				$sql_root = array(0 => array('caption' => 'Default', 'host' => $sql['host'], 'user' => $sql['root_user'], 'password' => $sql['root_password']));
-			}
-
-			// hide username/password in messages
-			$error_message = $error->getMessage();
-			$error_trace = $error->getTraceAsString();
-			// error-message
-			$error_message = str_replace($sql['password'], 'DB_UNPRIV_PWD', $error_message);
-			$error_message = str_replace($sql_root[0]['password'], 'DB_ROOT_PWD', $error_message);
-			// error-trace
-			$error_trace = str_replace($sql['password'], 'DB_UNPRIV_PWD', $error_trace);
-			$error_trace = str_replace($sql_root[0]['password'], 'DB_ROOT_PWD', $error_trace);
-
 			// clean up sensitive data
 			unset($sql);
 			unset($sql_root);
@@ -388,7 +399,8 @@ class Database {
 					die($err_hint);
 				}
 			}
-			die("We are sorry, but a MySQL - error occurred. The administrator may find more information in in the sql-error.log in the logs/ directory");
+			die("We are sorry, but a MySQL - error occurred. The administrator may find more information in the syslog");
 		}
 	}
 }
+

lib/classes/phpinterface/class.phpinterface_fpm.php

@@ -250,7 +250,7 @@ class phpinterface_fpm {
 
 			$php_ini_variables = array(
 					'SAFE_MODE' => 'Off', // keep this for compatibility, just in case
-					'PEAR_DIR' => Settings::Get('system.mod_fcgid_peardir'),
+					'PEAR_DIR' => Settings::Get('phpfpm.peardir'),
 					'TMP_DIR' => $this->getTempDir(),
 					'CUSTOMER_EMAIL' => $this->_domain['email'],
 					'ADMIN_EMAIL' => $admin['email'],

lib/configfiles/freebsd.inc.php

@@ -403,7 +403,8 @@ return array(
 							'chmod 600 /usr/local/etc/libnss-mysql.cfg /usr/local/etc/libnss-mysql-root.cfg'
 						),
 						'restart' => array(
-							'sh /etc/rc.d/nscd restart'
+							'sh /etc/rc.d/nscd restart',
+                                                        'nscd --invalidate=group'
 						)
 					),
 					'logrotate' => array(

lib/configfiles/gentoo.inc.php

@@ -410,7 +410,8 @@ milter_default_action = accept" >> /etc/postfix/main.cf',
 							'rc-update add nscd default'
 						),
 						'restart' => array(
-							'/etc/init.d/nscd restart'
+							'/etc/init.d/nscd restart',
+							'nscd --invalidate=group'
 						)
 					),
 					'logrotate' => array(

lib/configfiles/lucid.inc.php

@@ -393,7 +393,8 @@ return array(
 							'etc_nsswitch.conf' => '/etc/nsswitch.conf',
 						),
 						'restart' => array(
-							'/etc/init.d/nscd restart'
+							'/etc/init.d/nscd restart',
+                                                        'nscd --invalidate=group'
 						)
 					),
 					'logrotate' => array(

lib/configfiles/precise.inc.php

@@ -395,7 +395,8 @@ return array(
 							'etc_nsswitch.conf' => '/etc/nsswitch.conf',
 						),
 						'restart' => array(
-							'/etc/init.d/nscd restart'
+							'/etc/init.d/nscd restart',
+                                                        'nscd --invalidate=group'
 						)
 					),
 					'logrotate' => array(

lib/configfiles/rhel7.inc.php

@@ -48,7 +48,7 @@ return array(
 							(Settings::Get('system.deactivateddocroot') != '') ? 'mkdir -p ' . Settings::Get('system.deactivateddocroot') : ''
 						),
 						'restart' => array(
-							'/usr/bin/systemctl reload-or-restart httpd.service'
+							'systemctl reload-or-restart httpd.service'
 						)
 					),
 				),
@@ -72,7 +72,7 @@ return array(
 							'touch /etc/postfix/mysql-virtual_mailbox_maps.cf',
 							'touch /etc/postfix/mysql-virtual_sender_permissions.cf',
 							'chown root:root /etc/postfix/mysql-*.cf',
-							'chmod 0644 /etc/postfix/mysql-*.cf',
+							'chmod 0600 /etc/postfix/mysql-*.cf',
 						),
 						'files' => array(
 							'etc_postfix_main.cf' => '/etc/postfix/main.cf',
@@ -99,11 +99,12 @@ return array(
 							'systemctl enable dovecot.service',
 						),
 						'commands' => array(
-							'yum install dovecot dovecot-mysql dovecot-pigeonhole',
+							'touch /etc/dovecot/dovecot-sql.conf.ext',
+							'chmod 0600 /etc/dovecot/dovecot-sql.conf.ext',
 						),
 						'files' => array(
 							'etc_dovecot_dovecot.conf' => '/etc/dovecot/dovecot.conf',
-							'etc_dovecot_dovecot-sql.conf.ext' => '/etc/dovecot/dovecot.conf.ext',
+							'etc_dovecot_dovecot-sql.conf.ext' => '/etc/dovecot/dovecot-sql.conf.ext',
 							'etc_dovecot_conf.d_10-auth.conf' => '/etc/dovecot/conf.d/10-auth.conf',
 							'etc_dovecot_conf.d_10-logging.conf' => '/etc/dovecot/conf.d/10-logging.conf',
 							'etc_dovecot_conf.d_10-mail.conf' => '/etc/dovecot/conf.d/10-mail.conf',

lib/configfiles/squeeze.inc.php

@@ -392,7 +392,8 @@ return array(
 							'etc_nsswitch.conf' => '/etc/nsswitch.conf',
 						),
 						'restart' => array(
-							'/etc/init.d/nscd restart'
+							'/etc/init.d/nscd restart',
+                                                        'nscd --invalidate=group'
 						)
 					),
 					'logrotate' => array(

lib/configfiles/trusty.inc.php

@@ -390,7 +390,8 @@ return array(
 							'etc_nsswitch.conf' => '/etc/nsswitch.conf',
 						),
 						'restart' => array(
-							'service nscd restart'
+							'service nscd restart',
+                                                        'nscd --invalidate=group'
 						)
 					),
 					'logrotate' => array(

lib/configfiles/wheezy.inc.php

@@ -397,7 +397,8 @@ return array(
 							'etc_nsswitch.conf' => '/etc/nsswitch.conf',
 						),
 						'restart' => array(
-							'/etc/init.d/nscd restart'
+							'/etc/init.d/nscd restart',
+                                                        'nscd --invalidate=group'
 						)
 					),
 					'logrotate' => array(

lib/functions/formfields/string/function.validateFormFieldString.php

@@ -107,8 +107,14 @@ function validateFormFieldString($fieldname, $fielddata, $newfieldvalue)
 			}
 		}
 		elseif (isset($fielddata['string_type']) && $fielddata['string_type'] == 'validate_ip') {
-			$newfieldvalue = validate_ip2($newfieldvalue);
-			$returnvalue = ($newfieldvalue !== false ? true : 'invalidip');
+		    // check for empty value (it might be allowed)
+		    if (trim($newfieldvalue) == '') {
+		        $newfieldvalue = '';
+		        $returnvalue = 'stringmustntbeempty';
+		    } else {
+		        $newfieldvalue = validate_ip2($newfieldvalue, true);
+		        $returnvalue = ($newfieldvalue !== false ? true : 'invalidip');
+		    }
 		}
 		elseif (preg_match('/^[^\r\n\t\f\0]*$/D', $newfieldvalue)) {
 			$returnvalue = true;

lib/functions/froxlor/function.moveCustomerToAdmin.php

@@ -10,6 +10,9 @@
  * @return true on sucess, error-message on failure
  */
 function moveCustomerToAdmin($id = 0, $adminid = 0) {
+
+    global $log;
+
 	if ($id <= 0 || $adminid <= 0) {
 		return "no valid id's given";
 	}
@@ -23,12 +26,14 @@ function moveCustomerToAdmin($id = 0, $adminid = 0) {
 			'cid' => $id
 	) );
 
+	$log->logAction(ADM_ACTION, LOG_INFO, "moved user #" . $id . " from admin/reseller #".$cAdmin['adminid']." to admin/reseller #".$adminid);
+
 	// Update customer entry
 	$updCustomer_stmt = Database::prepare ( "
 		UPDATE `" . TABLE_PANEL_CUSTOMERS . "` SET `adminid` = :adminid WHERE `customerid` = :cid
 	" );
 	Database::pexecute ( $updCustomer_stmt, array (
-			'adminid' => $cAdmin ['adminid'],
+			'adminid' => $adminid,
 			'cid' => $id
 	) );
 
@@ -37,7 +42,7 @@ function moveCustomerToAdmin($id = 0, $adminid = 0) {
 		UPDATE `" . TABLE_PANEL_DOMAINS . "` SET `adminid` = :adminid WHERE `customerid` = :cid
 	" );
 	Database::pexecute ( $updDomains_stmt, array (
-			'adminid' => $cAdmin ['adminid'],
+			'adminid' => $adminid,
 			'cid' => $id
 	) );
 
@@ -46,7 +51,7 @@ function moveCustomerToAdmin($id = 0, $adminid = 0) {
 		UPDATE `" . TABLE_PANEL_TICKETS . "` SET `adminid` = :adminid WHERE `customerid` = :cid
 	" );
 	Database::pexecute ( $updTickets_stmt, array (
-			'adminid' => $cAdmin ['adminid'],
+			'adminid' => $adminid,
 			'cid' => $id
 	) );
 

lib/functions/system/function.getAvailablePasswordHashes.php

@@ -0,0 +1,46 @@
+<?php
+
+/**
+ * This file is part of the Froxlor project.
+ * Copyright (c) 2015 the Froxlor Team (see authors).
+ *
+ * For the full copyright and license information, please view the COPYING
+ * file that was distributed with this source code. You can also view the
+ * COPYING file online at http://files.froxlor.org/misc/COPYING.txt
+ *
+ * @copyright  (c) the authors
+ * @author     Froxlor team <team@froxlor.org> (2014-)
+ * @license    GPLv2 http://files.froxlor.org/misc/COPYING.txt
+ * @package    Functions
+ *
+ * @since      0.9.33.1
+ */
+
+/**
+ * return an array of available hashes for the crypt() function
+ *
+ * @return array
+ */
+function getAvailablePasswordHashes()
+{
+    global $lng;
+    
+    // get available pwd-hases
+    $available_pwdhashes = array(
+        0 => $lng['serversettings']['systemdefault']
+    );
+    if (defined('CRYPT_MD5') && CRYPT_MD5 == 1) {
+        $available_pwdhashes[1] = 'MD5';
+    }
+    if (defined('CRYPT_BLOWFISH') && CRYPT_BLOWFISH == 1) {
+        $available_pwdhashes[2] = 'BLOWFISH';
+    }
+    if (defined('CRYPT_SHA256') && CRYPT_SHA256 == 1) {
+        $available_pwdhashes[3] = 'SHA-256';
+    }
+    if (defined('CRYPT_SHA512') && CRYPT_SHA512 == 1) {
+        $available_pwdhashes[4] = 'SHA-512';
+    }
+    
+    return $available_pwdhashes;
+}

lib/functions/validate/function.checkMysqlAccessHost.php

@@ -23,7 +23,7 @@ function checkMysqlAccessHost($fieldname, $fielddata, $newfieldvalue, $allnewfie
 
 	foreach ($mysql_access_host_array as $host_entry) {
 
-		if (validate_ip2($host_entry, true, 'invalidip', true) == false
+		if (validate_ip2($host_entry, true, 'invalidip', true, true) == false
 		   && validateDomain($host_entry) == false
 		   && validateLocalHostname($host_entry) == false
 		   && $host_entry != '%'

lib/functions/validate/function.checkPhpInterfaceSetting.php

@@ -21,8 +21,8 @@ function checkPhpInterfaceSetting($fieldname, $fielddata, $newfieldvalue, $allne
 	$returnvalue = array(FORMFIELDS_PLAUSIBILITY_CHECK_OK);
 
 	if ((int)Settings::Get('system.mod_fcgid') == 1) {
-		// now check if we enable a webserver != apache
-		if (strtolower($newfieldvalue) != 'apache2') {
+		// fcgid only works for apache and lighttpd
+		if (strtolower($newfieldvalue) != 'apache2' && strtolower($newfieldvalue) != 'lighttpd') {
 			$returnvalue = array(FORMFIELDS_PLAUSIBILITY_CHECK_ERROR, 'fcgidstillenableddeadlock');
 		}
 	}

lib/functions/validate/function.validate_ip.php

@@ -44,13 +44,21 @@ function validate_ip($ip, $return_bool = false, $lng = 'invalidip') {
 /**
  * Checks whether it is a valid ip
  *
- * @return mixed 	ip address on success, false on failure
+ * @param string $ip ip-address to check
+ * @param bool $return_bool whether to return bool or call standard_error()
+ * @param string $lng index for error-message (if $return_bool is false)
+ * @param bool $allow_localhost whether to allow 127.0.0.1
+ * @param bool $allow_priv whether to allow private network addresses
+ *
+ * @return string|bool ip address on success, false on failure
  */
-function validate_ip2($ip, $return_bool = false, $lng = 'invalidip', $allow_localhost = false) {
+function validate_ip2($ip, $return_bool = false, $lng = 'invalidip', $allow_localhost = false, $allow_priv = false) {
+
+    $filter_lan = $allow_priv ? FILTER_FLAG_NO_RES_RANGE : (FILTER_FLAG_NO_RES_RANGE | FILTER_FLAG_NO_PRIV_RANGE);
 
 	if ((filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV6)
 			|| filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_IPV4))
-			&& filter_var($ip, FILTER_VALIDATE_IP, FILTER_FLAG_NO_RES_RANGE | FILTER_FLAG_NO_PRIV_RANGE)
+			&& filter_var($ip, FILTER_VALIDATE_IP, $filter_lan)
 	) {
 		return $ip;
 	}

lib/tables.inc.php

@@ -51,6 +51,6 @@ define('TABLE_PANEL_DOMAIN_SSL_SETTINGS', 'domain_ssl_settings');
 define('TABLE_DOMAINTOIP', 'panel_domaintoip');
 
 // VERSION INFO
-$version = '0.9.33-rc3';
+$version = '0.9.33.2';
 $dbversion = '2';
 $branding = '';

lng/english.lng.php

@@ -1741,7 +1741,7 @@ $lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'FastCGI IPC dire
 $lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'The directory where the php-fpm sockets will be stored by the webserver.<br />This directory has to be readable for the webserver';
 $lng['panel']['news'] = 'News';
 $lng['error']['sslredirectonlypossiblewithsslipport'] = 'Using the SSL redirect is only possible when the domain has at least one ssl-enabled IP/port combination assigned.';
-$lng['error']['fcgidstillenableddeadlock'] = 'FCGID is currently active.<br />Please deactivate it before switching to another webserver than Apache2';
+$lng['error']['fcgidstillenableddeadlock'] = 'FCGID is currently active.<br />Please deactivate it before switching to another webserver than Apache2 or lighttpd';
 $lng['error']['send_report_title'] = 'Send error report';
 $lng['error']['send_report_desc'] = 'Thank you for reporting this error and helping us to froxlor improve froxlor.<br />This is the email which will be sent to the froxlor developer team:';
 $lng['error']['send_report'] = 'Send report';

lng/german.lng.php

@@ -1468,7 +1468,7 @@ $lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'FastCGI IPC Verz
 $lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'In dieses Verzeichnis werden die php-fpm Sockets vom Webserver abgelegt.<br />Das Verzeichnis muss für den Webserver lesbar sein.';
 $lng['panel']['news'] = 'Neuigkeiten';
 $lng['error']['sslredirectonlypossiblewithsslipport'] = 'Eine SSL-Weiterleitung ist nur möglich, wenn der Domain mindestens eine IP/Port Kombination zugewiesen wurde, bei der SSL aktiviert ist.';
-$lng['error']['fcgidstillenableddeadlock'] = 'FCGID ist derzeit aktiviert.<br />Bitte deaktiviere es, um einen anderen Webserver als Apache2 auswählen zu können.';
+$lng['error']['fcgidstillenableddeadlock'] = 'FCGID ist derzeit aktiviert.<br />Bitte deaktiviere es, um einen anderen Webserver als Apache2 oder lighttpd auswählen zu können.';
 $lng['error']['send_report_title'] = 'Fehler melden';
 $lng['error']['send_report_desc'] = 'Danke, dass Sie uns diesen Fehler melden und damit helfen Froxlor zu verbessern.<br />Folgender Bericht wird per Mail an das Froxlor Entwickler Team gesendet.';
 $lng['error']['send_report'] = 'Fehlerbericht senden';

lng/italian.lng.php

@@ -21,8 +21,7 @@
 /**
  * Global
  */
-
-$lng['translator'] = 'Luca Longinotti, Luca Piona, Emilien';
+$lng['translator'] = 'Luca Longinotti, Luca Piona, Emilien, Christian Munari';
 $lng['panel']['edit'] = 'Modifica';
 $lng['panel']['delete'] = 'Cancella';
 $lng['panel']['create'] = 'Crea';
@@ -34,7 +33,6 @@ $lng['panel']['emptyfordefault'] = 'lasciare vuoto per l\'impostazione di defaul
 $lng['panel']['path'] = 'Percorso';
 $lng['panel']['toggle'] = 'Cambia';
 $lng['panel']['next'] = 'Prossimo';
-//  $lng['panel']['dirsmissing'] = 'Impossibile trovare o leggere la directory!';
 $lng['panel']['dirsmissing'] = 'La cartella fornita non è stata trovata.';
 
 /**
@@ -154,7 +152,7 @@ $lng['ftp']['account_add'] = 'Crea account';
  * MySQL
  */
 
-//  $lng['mysql']['description'] = 'Qui puoi creare e modificare i tuoi database MySQL.<br />I cambiamenti sono effettuati in tempo reale e i databases si possono usare immediatamente.<br />Nel menù di sinistra trovi il tool phpMyAdmin con il quale potrai comodamente amministrare i tuoi databases attraverso il tuo web-browser.<br /><br />Per utilizzare i database nei vostri script PHP, utilizzate le seguenti impostazioni: (I dati scritti in <i>corsivo</i> vanno cambiati con i tuoi!)<br />Hostname: <b><SQL_HOST></b><br />Username: <b><i>L\'username scelto</i></b><br />Password: <b><i>La password scelta per quell\'username</i></b><br />Database: <b><i>Nome del database</i></b>';
+// $lng['mysql']['description'] = 'Qui puoi creare e modificare i tuoi database MySQL.<br />I cambiamenti sono effettuati in tempo reale e i databases si possono usare immediatamente.<br />Nel menù di sinistra trovi il tool phpMyAdmin con il quale potrai comodamente amministrare i tuoi databases attraverso il tuo web-browser.<br /><br />Per utilizzare i database nei vostri script PHP, utilizzate le seguenti impostazioni: (I dati scritti in <i>corsivo</i> vanno cambiati con i tuoi!)<br />Hostname: <b><SQL_HOST></b><br />Username: <b><i>L\'username scelto</i></b><br />Password: <b><i>La password scelta per quell\'username</i></b><br />Database: <b><i>Nome del database</i></b>';
 $lng['mysql']['description'] = 'Qui puoi creare e modificare il tuo database MySQL<br />Le modifiche sono istantanee e puoi usare subito il database.<br />Nel menù a sinistra trovi phpMyAdmin con cui puoi amministrare il tuo database.<br /><br />Per usare i database nei tuoi script php usa le seguenti impostazioni: (Le parole in <i>corsivo</i> devono essere modificate con quello che hai scritto!)<br />Hostname: <b><SQL_HOST></b><br />Utente: <b><i>Nome database</i></b><br />Password: <b><i>La password che hai scelto</i></b><br />Database: <b><i>Nome database</i></b>';
 $lng['mysql']['databasename'] = 'Nome database';
 $lng['mysql']['databasedescription'] = 'Descrizione database';
@@ -667,7 +665,7 @@ $lng['serversettings']['ticket']['noreply_name'] = 'Email del mittente del ticke
 // ADDED IN 1.2.19-svn1
 
 $lng['serversettings']['mod_fcgid']['configdir']['title'] = 'Cartella della configurazione';
-$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Dove vuoi che venga salvata la configurazione di fcgid? Se non ti sei compilato suexec da solo, di solito questo percorso è /var/www/';
+$lng['serversettings']['mod_fcgid']['configdir']['description'] = 'Dove vuoi che venga salvata la configurazione di fcgid? Se non ti sei compilato suexec da solo, di solito questo percorso è /var/www';
 $lng['serversettings']['mod_fcgid']['tmpdir']['title'] = 'Cartella Temp';
 
 // ADDED IN 1.2.19-svn3
@@ -887,7 +885,7 @@ $lng['admin']['show_version_footer']['description'] = 'Mostra la versione di Fro
 $lng['admin']['froxlor_graphic']['title'] = 'Intestazione grafica per Froxlor';
 $lng['admin']['froxlor_graphic']['description'] = 'Quale grafica vuoi mostrare nell\'intestazione?';
 
-//improved froxlor
+// improved froxlor
 
 $lng['menue']['phpsettings']['maintitle'] = 'Configurazioni PHP';
 $lng['admin']['phpsettings']['title'] = 'Configurazione PHP';
@@ -927,7 +925,7 @@ $lng['serversettings']['mod_fcgid']['tmpdir']['description'] = 'Dove va salvata
 $lng['serversettings']['mod_fcgid']['peardir']['title'] = 'Cartella globale di PEAR';
 $lng['serversettings']['mod_fcgid']['peardir']['description'] = 'Quali sono le cartelle globali di PEAR che dovrebbero essere sostituite in ogni configurazione php.ini? Più cartelle devono essere separate da : (due punti).';
 
-//improved Froxlor  2
+// improved Froxlor 2
 
 $lng['admin']['templates']['index_html'] = 'file index per le nuove cartelle create dai clienti';
 $lng['admin']['templates']['SERVERNAME'] = 'Sostituito con il nomeserver.';
@@ -1245,6 +1243,7 @@ $lng['question']['customer_reallyunlock'] = 'Sei sicuro di voler sbloccare il cl
 // ADDED IN FROXLOR 0.9.15-svn1
 $lng['serversettings']['perl_server']['title'] = 'Localizzazione del server Perl';
 $lng['serversettings']['perl_server']['description'] = 'Di default è impostato per utilizzare la guida disponibile sul sito: <a target="blank" href="http://wiki.nginx.org/SimpleCGI">http://wiki.nginx.org/SimpleCGI</a>';
+
 $lng['serversettings']['nginx_php_backend']['title'] = 'Nginx PHP backend';
 $lng['serversettings']['nginx_php_backend']['description'] = 'questo è dove in ascolto il processo PHP per le richieste da nginx, può essere un socket unix combinazione IP:Porta';
 $lng['serversettings']['phpreload_command']['title'] = 'Comando riavvio PHP';
@@ -1332,3 +1331,482 @@ $lng['traffic']['months']['total'] = 'Totale';
 $lng['traffic']['details'] = 'Dettagli';
 $lng['menue']['traffic']['table'] = 'Traffico';
 
+$lng['error']['loginnameiswrong2'] = 'Il nome utente contiente troppi caratteri. Sono permessi soltanto %s caratteri.';
+$lng['error']['ticketnotaccessible'] = 'Non puoi accedere a questo ticket.';
+$lng['question']['admin_customer_alsoremovemail'] = 'Eliminare completamente i dati della posta elettronica dal filesystem??';
+$lng['question']['admin_customer_alsoremoveftphomedir'] = 'Rimuovere anche la cartella homedir dell\'utente FTP?';
+$lng['admin']['templates']['SALUTATION'] = 'Sostituito con un saluto corretto (nome o azienda)';
+$$lng['admin']['templates']['COMPANY'] = 'Sostituisce con il nome dell \'azienda del cliente';
+$lng['serversettings']['bindenable']['title'] = 'Abilita Nameserver';
+$lng['serversettings']['bindenable']['description'] = 'Qui il Nameserver può essere abilitato e disabilitato globalmente.';
+$lng['admin']['serversoftware'] = 'Software per Server';
+$lng['panel']['pathDescriptionEx'] = '<br /><br />Se vuoi redirezionare ad un altro dominio, questo valore deve iniziare con http:// or https://.';
+$lng['panel']['pathDescriptionSubdomain'] = $lng['panel']['pathDescription'] . $lng['panel']['pathDescriptionEx'] . "<br /><br />Se la URL termina con / è considerata una cartella, altrimenti verrà trattata come un file.";
+$lng['admin']['configfiles']['wizard'] = 'Wizard (assistente)';
+$lng['admin']['configfiles']['http'] = 'Server WEB (HTTP)';
+$lng['admin']['configfiles']['dns'] = 'Nameserver (DNS)';
+$lng['admin']['configfiles']['mail'] = 'Server di posta elettronica (IMAP/POP3)';
+$lng['admin']['configfiles']['smtp'] = 'Server di posta elettronica (SMTP)';
+$lng['admin']['configfiles']['ftp'] = 'Server FTP';
+$lng['serversettings']['mysql_access_host']['title'] = 'Hosts Accesso MySQL';
+$lng['serversettings']['webalizer_quiet']['title'] = 'Webalizer output';
+$lng['serversettings']['ssl']['use_ssl']['title'] = 'Abilita utilizzo SSL';
+$lng['serversettings']['ssl']['use_ssl']['description'] = 'Spunta questo se vuoi usare SSL per il tuo server web';
+$lng['serversettings']['ssl']['ssl_cert_file']['title'] = 'Percorso al certificato SSL';
+$lng['serversettings']['ssl']['ssl_cert_file']['description'] = 'Specifica il percorso includendo il nome del file .crt o .pem (certificato principale)';
+$lng['serversettings']['default_vhostconf_domain']['description'] = 'Il contenuto di questo campo verrà incluso direttamente nella configurazione del contenitore del dominio vHost. ATTENZIONE: Non verrano verificati eventuali errori del codice contenuto. Se conterrà degli errori, vi è il rischio che il server WEB non si avvii più!';
+$lng['dns']['standardip'] = 'IP predefinito del server';
+$lng['dns']['cname_record'] = 'Record CNAME';
+$lng['dns']['standardmx'] = 'Record MX predefinito del server';
+$lng['dns']['mxconfig'] = 'Record MX personalizzati';
+$lng['dns']['priority10'] = 'Priorità 10';
+$lng['dns']['priority20'] = 'Priorità 20';
+$lng['serversettings']['ssl']['ssl_key_file']['title'] = 'Percorso al file di chiave SSL';
+$lng['serversettings']['ssl']['ssl_key_file']['description'] = 'Specifica il percorso includendo il nome del file per la chiave privata (abitualmente.key)';
+$lng['serversettings']['ssl']['ssl_ca_file']['title'] = 'Percorso al certificato della CA (autoritá certificatrice) SSL (opzionale)';
+$lng['serversettings']['ssl']['ssl_ca_file']['description'] = 'Autenticazione client, da settare soltanto se desiderato.';
+$lng['cronjob']['cronjobintervalv'] = 'valore di intervallo Runtime';
+$lng['admin']['store_defaultindex'] = 'Archivio del file indice predefinito al percorso radice clienti';
+$lng['admin']['ipsandports']['ssl_cert_chainfile']['title'] = 'Percorso al file catena dei certificati SSL';
+$lng['admin']['ipsandports']['ssl_cert_chainfile']['description'] = 'Principalmente Bundle CA, o similare, presubilmente vuoi impostare questo se hai acquistato un certificato SSL.';
+$lng['serversettings']['phpfpm']['title'] = 'Abilita php-fpm';
+$lng['serversettings']['phpfpm']['description'] = '<b>Questa impostazione richiede una configurazione speciale del server web. Vedi il manuale FPM per <a target="blank" href="http://redmine.froxlor.org/projects/froxlor/wiki/HandbookApache2_phpfpm">Apache2</a> o <a target="blank" href="http://redmine.froxlor.org/projects/froxlor/wiki/HandbookNginx_phpfpm">nginx</a></b>';
+$lng['serversettings']['phpfpm_settings']['aliasconfigdir'] = 'Configurazione cartella Alias per php-fpm';
+$lng['gender']['title'] = 'Titolo';
+$lng['gender']['male'] = 'Sig.';
+$lng['gender']['female'] = 'Sig.ra';
+$lng['gender']['undef'] = '';
+$lng['country']['AF'] = "Afganistan";
+$lng['country']['AX'] = "Isole Aland";
+$lng['country']['AL'] = "Albania";
+$lng['country']['DZ'] = "Algeria";
+$lng['country']['AS'] = "American Samoa";
+$lng['country']['AD'] = "Andorra";
+$lng['country']['AO'] = "Angola";
+$lng['country']['AI'] = "Anguilla";
+$lng['country']['AQ'] = "Antarctica";
+$lng['country']['AG'] = "Antigua and Barbuda";
+$lng['country']['AR'] = "Argentina";
+$lng['country']['AM'] = "Armenia";
+$lng['country']['AW'] = "Aruba";
+$lng['country']['AU'] = "Australia";
+$lng['country']['AT'] = "Austria";
+$lng['country']['AZ'] = "Azerbaijan";
+$lng['country']['BS'] = "Bahamas";
+$lng['country']['BH'] = "Bahrain";
+$lng['country']['BD'] = "Bangladesh";
+$lng['country']['BB'] = "Barbados";
+$lng['country']['BY'] = "Belarus";
+$lng['country']['BE'] = "Belgium";
+$lng['country']['BZ'] = "Belize";
+$lng['country']['BJ'] = "Benin";
+$lng['country']['BM'] = "Bermuda";
+$lng['country']['BT'] = "Bhutan";
+$lng['country']['BO'] = "Bolivia, Stato Plurinazionale della";
+$lng['country']['BQ'] = "Bonaire, Saint Eustatius e Saba";
+$lng['country']['BA'] = "Bosnia e Herzegovina";
+$lng['country']['BW'] = "Botswana";
+$lng['country']['BV'] = "Bouvet Island";
+$lng['country']['BR'] = "Brasile";
+$lng['country']['IO'] = "Territorio Britannico del oceano indiano";
+$lng['country']['BN'] = "Brunei Darussalam";
+$lng['country']['BG'] = "Bulgaria";
+$lng['country']['BF'] = "Burkina Faso";
+$lng['country']['BI'] = "Burundi";
+$lng['country']['KH'] = "Cambogia";
+$lng['country']['CM'] = "Camerun";
+$lng['country']['CA'] = "Canada";
+$lng['country']['CV'] = "Capo Verde";
+$lng['country']['KY'] = "Isole Cayman";
+$lng['country']['CF'] = "Repubblica dell'Africa Centrale";
+$lng['country']['TD'] = "Chad";
+$lng['country']['CL'] = "Chile";
+$lng['country']['CN'] = "Cina";
+$lng['country']['CX'] = "Isola di Natale";
+$lng['country']['CC'] = "Isole Cocos (Keeling)";
+$lng['country']['CO'] = "Colombia";
+$lng['country']['KM'] = "Comoros";
+$lng['country']['CG'] = "Congo";
+$lng['country']['CD'] = "Congo, Repubblica democratica del";
+$lng['country']['CK'] = "Isole Cook";
+$lng['country']['CR'] = "Costa Rica";
+$lng['country']['CI'] = "Costa D'avorio";
+$lng['country']['HR'] = "Croazia";
+$lng['country']['CU'] = "Cuba";
+$lng['country']['CW'] = "Curacao";
+$lng['country']['CY'] = "Cipro";
+$lng['country']['CZ'] = "Repubblica Ceca";
+$lng['country']['DK'] = "Danimarca";
+$lng['country']['DJ'] = "Djibouti";
+$lng['country']['DM'] = "Dominica";
+$lng['country']['DO'] = "Repubblica Dominicana";
+$lng['country']['EC'] = "Ecuador";
+$lng['country']['EG'] = "Egitto";
+$lng['country']['SV'] = "El Salvador";
+$lng['country']['GQ'] = "Guinea Equatoriale";
+$lng['country']['ER'] = "Eritrea";
+$lng['country']['EE'] = "Estonia";
+$lng['country']['ET'] = "Etiopia";
+$lng['country']['FK'] = "Isole Falkland (Malvinas)";
+$lng['country']['FO'] = "Isole Faroe";
+$lng['country']['FJ'] = "Fiji";
+$lng['country']['FI'] = "Finlandia";
+$lng['country']['FR'] = "Francia";
+$lng['country']['GF'] = "Guiana Francese";
+$lng['country']['PF'] = "Polinesia Francese";
+$lng['country']['TF'] = "Territori Francesi del Sud";
+$lng['country']['GA'] = "Gabon";
+$lng['country']['GM'] = "Gambia";
+$lng['country']['GE'] = "Georgia";
+$lng['country']['DE'] = "Germania";
+$lng['country']['GH'] = "Ghana";
+$lng['country']['GI'] = "Gibilterra";
+$lng['country']['GR'] = "Grecia";
+$lng['country']['GL'] = "Groenlandia";
+$lng['country']['GD'] = "Grenada";
+$lng['country']['GP'] = "Guadeloupe";
+$lng['country']['GU'] = "Guam";
+$lng['country']['GT'] = "Guatemala";
+$lng['country']['GG'] = "Guernsey";
+$lng['country']['GN'] = "Guinea";
+$lng['country']['GW'] = "Guinea-Bissau";
+$lng['country']['GY'] = "Guyana";
+$lng['country']['HT'] = "Haiti";
+$lng['country']['HM'] = "Isola Heard e Isola McDonald";
+$lng['country']['VA'] = "Stato del Vaticano";
+$lng['country']['HN'] = "Honduras";
+$lng['country']['HK'] = "Hong Kong";
+$lng['country']['HU'] = "Ungheria";
+$lng['country']['IS'] = "Islanda";
+$lng['country']['IN'] = "India";
+$lng['country']['ID'] = "Indonesia";
+$lng['country']['IR'] = "Iran, Repubblica Islamica del";
+$lng['country']['IQ'] = "Iraq";
+$lng['country']['IE'] = "Irlanda";
+$lng['country']['IM'] = "Isola Man";
+$lng['country']['IL'] = "Israele";
+$lng['country']['IT'] = "ITALIA";
+$lng['country']['JM'] = "Giamaica";
+$lng['country']['JP'] = "Giappone";
+$lng['country']['JE'] = "Jersey";
+$lng['country']['JO'] = "Giordania";
+$lng['country']['KZ'] = "Kazakistan";
+$lng['country']['KE'] = "Kenya";
+$lng['country']['KI'] = "Kiribati";
+$lng['country']['KP'] = "Corea, Repubblica popolare della";
+$lng['country']['KR'] = "Corea, Repubblica della";
+$lng['country']['KW'] = "Kuwait";
+$lng['country']['KG'] = "Kyrgyzstan";
+$lng['country']['LA'] = "Lao, Repubblica popolare del";
+$lng['country']['LV'] = "Lettonia";
+$lng['country']['LB'] = "Libano";
+$lng['country']['LS'] = "Lesotho";
+$lng['country']['LR'] = "Liberia";
+$lng['country']['LY'] = "Libia";
+$lng['country']['LI'] = "Liechtenstein";
+$lng['country']['LT'] = "Lituania";
+$lng['country']['LU'] = "Lussemburgo";
+$lng['country']['MO'] = "Macao";
+$lng['country']['MK'] = "Macedonia";
+$lng['country']['MG'] = "Madagascar";
+$lng['country']['MW'] = "Malawi";
+$lng['country']['MY'] = "Malesia";
+$lng['country']['MV'] = "Maldive";
+$lng['country']['ML'] = "Mali";
+$lng['country']['MT'] = "Malta";
+$lng['country']['MH'] = "Isole Marshall";
+$lng['country']['MQ'] = "Martinique";
+$lng['country']['MR'] = "Mauritania";
+$lng['country']['MU'] = "Mauritius";
+$lng['country']['YT'] = "Mayotte";
+$lng['country']['MX'] = "Messico";
+$lng['country']['FM'] = "Micronesia, Stati Federali del";
+$lng['country']['MD'] = "Moldavia";
+$lng['country']['MC'] = "Monaco";
+$lng['country']['MN'] = "Mongolia";
+$lng['country']['ME'] = "Montenegro";
+$lng['country']['MS'] = "Montserrat";
+$lng['country']['MA'] = "Marocco";
+$lng['country']['MZ'] = "Mozambico";
+$lng['country']['MM'] = "Myanmar";
+$lng['country']['NA'] = "Namibia";
+$lng['country']['NR'] = "Nauru";
+$lng['country']['NP'] = "Nepal";
+$lng['country']['NL'] = "Olanda";
+$lng['country']['NC'] = "Nuova Caledonia";
+$lng['country']['NZ'] = "Nuova Zelanda";
+$lng['country']['NI'] = "Nicaragua";
+$lng['country']['NE'] = "Niger";
+$lng['country']['NG'] = "Nigeria";
+$lng['country']['NU'] = "Niue";
+$lng['country']['NF'] = "Isole Norfolk";
+$lng['country']['MP'] = "Isole Mariana Settentrionali";
+$lng['country']['NO'] = "Norvegia";
+$lng['country']['OM'] = "Oman";
+$lng['country']['PK'] = "Pakistan";
+$lng['country']['PW'] = "Palau";
+$lng['country']['PS'] = "Territorio Occupato della Palestina";
+$lng['country']['PA'] = "Panama";
+$lng['country']['PG'] = "Papua Nuova Guinea";
+$lng['country']['PY'] = "Paraguay";
+$lng['country']['PE'] = "Peru";
+$lng['country']['PH'] = "Filippine";
+$lng['country']['PN'] = "Pitcairn";
+$lng['country']['PL'] = "Polonia";
+$lng['country']['PT'] = "Portogallo";
+$lng['country']['PR'] = "Porto Rico";
+$lng['country']['QA'] = "Qatar";
+$lng['country']['RE'] = "Reunion";
+$lng['country']['RO'] = "Romania";
+$lng['country']['RU'] = "Russia";
+$lng['country']['RW'] = "Ruanda";
+$lng['country']['BL'] = "Saint Barthelemy";
+$lng['country']['SH'] = "Saint Helena, Ascension and Tristan Da Cunha";
+$lng['country']['KN'] = "Saint Kitts and Nevis";
+$lng['country']['LC'] = "Saint Lucia";
+$lng['country']['MF'] = "Saint Martin (French Part)";
+$lng['country']['PM'] = "Saint Pierre and Miquelon";
+$lng['country']['VC'] = "Saint Vincent and the Grenadines";
+$lng['country']['WS'] = "Samoa";
+$lng['country']['SM'] = "San Marino";
+$lng['country']['ST'] = "Sao Tome and Principe";
+$lng['country']['SA'] = "Arabia Saudita";
+$lng['country']['SN'] = "Senegal";
+$lng['country']['RS'] = "Serbia";
+$lng['country']['SC'] = "Seychelles";
+$lng['country']['SL'] = "Sierra Leone";
+$lng['country']['SG'] = "Singapore";
+$lng['country']['SX'] = "Sint Maarten (Dutch Part)";
+$lng['country']['SK'] = "Slovacchia";
+$lng['country']['SI'] = "Slovenia";
+$lng['country']['SB'] = "Isole Solomon";
+$lng['country']['SO'] = "Somalia";
+$lng['country']['ZA'] = "Africa del Sud";
+$lng['country']['GS'] = "South Georgia and the South Sandwich Islands";
+$lng['country']['ES'] = "Spagna";
+$lng['country']['LK'] = "Sri Lanka";
+$lng['country']['SD'] = "Sudan";
+$lng['country']['SR'] = "Suriname";
+$lng['country']['SJ'] = "Svalbard and Jan Mayen";
+$lng['country']['SZ'] = "Swaziland";
+$lng['country']['SE'] = "Svezia";
+$lng['country']['CH'] = "Svizzera";
+$lng['country']['SY'] = "Siria";
+$lng['country']['TW'] = "Taiwan, Provincia della Cina";
+$lng['country']['TJ'] = "Tajikistan";
+$lng['country']['TZ'] = "Tanzania";
+$lng['country']['TH'] = "Tailandia";
+$lng['country']['TL'] = "Timor-Leste";
+$lng['country']['TG'] = "Togo";
+$lng['country']['TK'] = "Tokelau";
+$lng['country']['TO'] = "Tonga";
+$lng['country']['TT'] = "Trinidad and Tobago";
+$lng['country']['TN'] = "Tunisia";
+$lng['country']['TR'] = "Turchia";
+$lng['country']['TM'] = "Turkmenistan";
+$lng['country']['TC'] = "Turks and Caicos Islands";
+$lng['country']['TV'] = "Tuvalu";
+$lng['country']['UG'] = "Uganda";
+$lng['country']['UA'] = "Ucraina";
+$lng['country']['AE'] = "Emirati Arabi Uniti";
+$lng['country']['GB'] = "Gran Bretagna";
+$lng['country']['US'] = "Stati Uniti d'America";
+$lng['country']['UM'] = "Stati Uniti, Isole Minori";
+$lng['country']['UY'] = "Uruguay";
+$lng['country']['UZ'] = "Uzbekistan";
+$lng['country']['VU'] = "Vanuatu";
+$lng['country']['VE'] = "Venezuela";
+$lng['country']['VN'] = "Vietnam";
+$lng['country']['VG'] = "Isole Vergini Brittaniche";
+$lng['country']['VI'] = "Isole Vergini, U.S.";
+$lng['country']['WF'] = "Wallis and Futuna";
+$lng['country']['EH'] = "Sahara Occidentale";
+$lng['country']['YE'] = "Yemen";
+$lng['country']['ZM'] = "Zambia";
+$lng['country']['ZW'] = "Zimbabue";
+$lng['diskquota'] = 'Quota';
+$lng['serversettings']['diskquota_enabled'] = 'Quota attivita?';
+$lng['serversettings']['diskquota_repquota_path']['description'] = 'Percorso a repquota';
+$lng['serversettings']['diskquota_quotatool_path']['description'] = 'Percorso al quotatool';
+$lng['serversettings']['diskquota_customer_partition']['description'] = 'Partizione, sulla quale sono salvati i dati dei clienti';
+$lng['tasks']['diskspace_set_quota'] = 'Setta quota al filesystem';
+$lng['error']['session_timeout'] = 'Valore troppo basso';
+$lng['error']['session_timeout_desc'] = 'Non dovresti settare il timeout della sessione ad un valore minore di 1 minuto.';
+$lng['admin']['assignedmax'] = 'Assegnato / Max';
+$lng['admin']['usedmax'] = 'Usato / Max';
+$lng['admin']['used'] = 'Usato';
+$lng['mysql']['size'] = 'Dimensione';
+$lng['error']['invalidhostname'] = 'Il nome del Host non può essere vuoto o contenere spazi';
+$lng['traffic']['http'] = 'HTTP (MiB)';
+$lng['traffic']['ftp'] = 'FTP (MiB)';
+$lng['traffic']['mail'] = 'Mail (MiB)';
+$lng['serversettings']['mod_fcgid']['idle_timeout']['title'] = 'Timeout Inattività';
+$lng['serversettings']['mod_fcgid']['idle_timeout']['description'] = 'Impostazione Timeout per il Mod FastCGI.';
+$lng['serversettings']['phpfpm_settings']['idle_timeout']['title'] = 'Timeout Inattività';
+$lng['serversettings']['phpfpm_settings']['idle_timeout']['description'] = 'Impostazione Timeout per PHP5 FPM FastCGI.';
+$lng['panel']['cancel'] = 'Annulla';
+$lng['admin']['delete_statistics'] = 'Elimina Statistiche';
+$lng['admin']['speciallogwarning'] = 'AVVISO: Cambiando questa impostazione perderai tutte le vecchie statistiche per questo dominio. Se sei sicuro che vuoi cambiare questo digita "%s" nel campo sottostante e clicca il bottone "elimina".<br /><br />';
+$lng['serversettings']['vmail_maildirname']['title'] = 'nome Maildir';
+$lng['serversettings']['vmail_maildirname']['description'] = 'cartella Maildir nell account utente. Normalmente \'Maildir\', in alcune implementazioni \'.maildir\', e direttamente nella cartella utente se lasciato vuoto.';
+$lng['tasks']['remove_emailacc_files'] = 'Elimina i dati di posta elettronica del cliente.';
+$lng['error']['operationnotpermitted'] = 'Operazione non permessa!';
+$lng['error']['featureisdisabled'] = 'Funzionalità %s è disabilitata. Perfavore contatta il tuo fornitore di servizi.';
+$lng['serversettings']['catchall_enabled']['title'] = 'Usa Catchall';
+$lng['serversettings']['catchall_enabled']['description'] = 'Vuoi offrire ai tuoi clienti la funzionalità di catchall?';
+$lng['serversettings']['apache_24']['title'] = 'Usa impostazioni per Apache 2.4';
+$lng['serversettings']['apache_24']['description'] = '<strong class="red">ATTENZIONE:</strong> spunta soltanto se hai installato la versione 2.4 o superiore di Apache<br />altrimenti il tuo server Web non si avvierà';
+$lng['admin']['tickets_see_all'] = 'Può vedere tutte le categorie di ticket?';
+$lng['serversettings']['nginx_fastcgiparams']['title'] = 'Percorso al file fastcgi_params';
+$lng['serversettings']['nginx_fastcgiparams']['description'] = 'Specifica il percorso al file fastcgi_params di nginx includendo il nome del file';
+$lng['serversettings']['documentroot_use_default_value']['title'] = 'Usa il nome del dominio come valore predefinito per il percorso DocumentRoot (radice dei documenti)';
+$lng['serversettings']['documentroot_use_default_value']['description'] = 'Se abilitato ed il percorso radice DocumentRoot è vuoto, il valore predefinito sarà il nome del (sotto)dominio.<br /><br />Esempio: <br />/var/customers/nome_cliente/example.com/<br />/var/customers/nome_cliente/sottodominio.example.com/';
+$lng['error']['usercurrentlydeactivated'] = 'L\'utente %s è attualmente disabilitato';
+$lng['admin']['speciallogfile']['title'] = 'File file log seperato';
+$lng['admin']['speciallogfile']['description'] = 'Spunta qui per un log di accesso separato per questo dominio';
+$lng['error']['setlessthanalreadyused'] = 'Non puoi impostare dei limiti minori per \'%s\', di quanto questo utente abbia già utilizzato<br />';
+$lng['error']['stringmustntbeempty'] = 'Il valore per il campo %s non può essere vuoto';
+$lng['admin']['domain_editable']['title'] = 'Permetti la modifica del dominio';
+$lng['admin']['domain_editable']['desc'] = 'Se settato a si, il cliente è abilitato a modificare varie impostazioni del dominio.<br />Se settato su no, il cliente non può modificare nulla.';
+$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['title'] = 'Nascondi i sottodominii predefiniti nel riepilogo di configurazione PHP';
+$lng['serversettings']['panel_phpconfigs_hidestdsubdomain']['description'] = 'Se attivato i sottodomini predefiniti dei clienti non saranno visualizzati nel riepilogo della configurazione php<br /><br />Nota: Questo è solo visibile se avete abilitato FCGID o PHP-FPM';
+$lng['serversettings']['passwordcryptfunc']['title'] = 'Scegli quale metodo crittografico deve essere usato per le password';
+$lng['serversettings']['systemdefault'] = 'Predefinito di sistema';
+$lng['serversettings']['panel_allow_theme_change_admin'] = 'Permetti agli amministratori di cambiare il tema';
+$lng['serversettings']['panel_allow_theme_change_customer'] = 'Permetti ai clienti di cambiare il tema';
+$lng['serversettings']['axfrservers']['title'] = 'Server AXFR';
+$lng['serversettings']['axfrservers']['description'] = 'Un elenco separato da virgole di indirizzi IP autorizzati a trasferire zone dns (AXFR).';
+$lng['panel']['ssleditor'] = 'Impostazioni SSL per questo dominio';
+$lng['admin']['ipsandports']['ssl_paste_description'] = 'Incolla il contenuto completo del tuo certificato nella casella di testo';
+$lng['admin']['ipsandports']['ssl_cert_file_content'] = 'Contenuto del certificato ssl';
+$lng['admin']['ipsandports']['ssl_key_file_content'] = 'Contenuto del file di chiave (privata) ssl';
+$lng['admin']['ipsandports']['ssl_ca_file_content'] = 'Contenuto del file ssl CA di autorità di certificazione (opzionale)';
+$lng['admin']['ipsandports']['ssl_ca_file_content_desc'] = '<br /><br />Autenticazione client, imposta questo settaggio soltanto se sai di cosa si tratta.';
+$lng['admin']['ipsandports']['ssl_cert_chainfile_content'] = 'Contenuto del file di catena di certificato (opzionale)';
+$lng['admin']['ipsandports']['ssl_cert_chainfile_content_desc'] = '<br /><br />Abitualmente Bundle CA o similare, probabilmente vuoi impostare questo settaggio se hai acquistato un certificato SSL.';
+$lng['error']['sslcertificateismissingprivatekey'] = 'Devi specificare una chiave privata per il tuo certificato';
+$lng['error']['sslcertificatewrongdomain'] = 'Il certificato fornito non appartiene a questo dominio';
+$lng['error']['sslcertificateinvalidcert'] = 'Il contenuto del certificato fornito non sembra essere un certificato valido';
+$lng['error']['sslcertificateinvalidcertkeypair'] = 'La chiave privata fornita non sembra appartenere al certificato fornito';
+$lng['error']['sslcertificateinvalidca'] = 'Il certificato CA fornito non sembra essere un certificato valido';
+$lng['error']['sslcertificateinvalidchain'] = 'I dati della catena di certificato non sembrano essere un certificato valido';
+$lng['serversettings']['customerssl_directory']['title'] = 'Cartella dei certificati ssl clienti del Webserver';
+$lng['serversettings']['customerssl_directory']['description'] = 'Dove devono esssere creati i certificati ssl cliente?<br /><br /><div class="red">NOTA: Il contenuto di questa cartella viene cancellato regolarmente, onde evitare il salvataggio manuale di dati in essa.</div>';
+$lng['admin']['phpfpm.ininote'] = 'Non tutti i valori che potresti volere settare possono essere usati nella configurazione del pool php-fpm.';
+$lng['crondesc']['cron_mailboxsize'] = 'Calcolo dimensioni caselle di posta';
+$lng['domains']['ipandport_multi']['title'] = 'Indirizzi IP';
+$lng['domains']['ipandport_multi']['description'] = 'Specifica uno o più indirizzi IP per il dominio.<br /><br /><div class="red">NOTA: L\'indirizzo IP non può essere modificato quando il dominio è configurato come <strong>alias-domain</strong> di un altro dominio.</div>';
+$lng['domains']['ipandport_ssl_multi']['title'] = 'Indirizzi IP SSL';
+$lng['domains']['ssl_redirect']['title'] = 'Reindirizzamento SSL';
+$lng['domains']['ssl_redirect']['description'] = 'Questa opzione crea un reindirizzamento per vhosts non-sll in modo che tutte le richieste vengono reindirizzate ai SSL-vhost.<br /><br />praticamente una richiesta a <strong>http</strong>://dominio.tld/ ti reindirizzera a <strong>https</strong>://dominio.tld/';
+
+$lng['admin']['phpinfo'] = 'PHPinfo()';
+$lng['admin']['selectserveralias'] = 'valore ServerAlias per il dominio';
+$lng['admin']['selectserveralias_desc'] = 'Scegli se froxlor deve creare un settaggio wildcard (*.dominio.tld), o un alias WWW (www.dominio.tld) o nessun alias';
+$lng['domains']['serveraliasoption_wildcard'] = 'Wildcard (*.dominio.tld)';
+$lng['domains']['serveraliasoption_www'] = 'WWW (www.dominio.tld)';
+$lng['domains']['serveraliasoption_none'] = 'Nessun alias';
+$lng['error']['givendirnotallowed'] = 'La cartella fornita nel campo %s non è permessa.';
+$lng['serversettings']['ssl']['ssl_cipher_list']['title'] = 'Configura le cifrature SSL permesse';
+$lng['serversettings']['ssl']['ssl_cipher_list']['description'] = 'Questa è una lista di cifrature che vuoi (o non vuoi) usare nelle communicazioni SSL. Per una lista delle cifrature e come includerle od escluderle, vedi le sezioni "CIPHER LIST FORMAT" e "CIPHER STRINGS" sulla <a href="http://openssl.org/docs/apps/ciphers.html">man-page per le cifrature</a>.<br /><br /><b>Il valore predefinito è:</b><pre>ECDHE-RSA-AES128-SHA256:AES128-GCM-SHA256:RC4:HIGH:!MD5:!aNULL:!EDH</pre>';
+$lng['panel']['dashboard'] = 'Cruscotto';
+$lng['panel']['assigned'] = 'Assegnato';
+$lng['panel']['available'] = 'Disponibile';
+$lng['customer']['services'] = 'Servizi';
+$lng['serversettings']['phpfpm_settings']['ipcdir']['title'] = 'Cartella FastCGI IPC';
+$lng['serversettings']['phpfpm_settings']['ipcdir']['description'] = 'La cartella nella quale verrano salvati i socket php-fpm dal server web.<br />Questa cartella deve essere leggibile dal server Web';
+$lng['panel']['news'] = 'Notizie';
+$lng['error']['sslredirectonlypossiblewithsslipport'] = 'L\'utilizzo del reindirizzamento SSL è possibile soltanto quando il dominio ha almeno una combinazione IP/porta assegnata ed abilitata SSL.';
+$lng['error']['fcgidstillenableddeadlock'] = 'FCGID è attualmente attivo.<br />Perfavore disattivalo prima di cambiare ad un server web diverso da Apache2';
+$lng['error']['send_report_title'] = 'Invia rapporto errori';
+$lng['error']['send_report_desc'] = 'Grazie per aver communicato questo errore, aiutandoci a migliorare froxlor.<br />Questa è la mail che verrà inviata agli svillupatori di froxlor:';
+$lng['error']['send_report'] = 'Invia rapporto';
+$lng['error']['send_report_error'] = 'Errore nell invio del rapporto: <br />%s';
+$lng['error']['notallowedtouseaccounts'] = 'Il tuo account non permette l\'utilizzo di IMAP/POP3. Non puoi aggiungere account di posta elettronica.';
+$lng['pwdreminder']['changed'] = 'La tua password è stata aggiornata con successo. Puoi accedere con le tue nuove credenziali.';
+$lng['pwdreminder']['wrongcode'] = 'Ci dispiace, il tuo codice di attivazione non esiste o è già scaduto.';
+$lng['admin']['templates']['LINK'] = 'Sostituito con il link di azzeramento password cliente.';
+$lng['pwdreminder']['choosenew'] = 'Setta la nuova password';
+$lng['serversettings']['allow_error_report_admin']['title'] = 'Permetti agli amministratori/rivenditori di inviare errori di database a Froxlor';
+$lng['serversettings']['allow_error_report_admin']['description'] = 'Attenzione: Non inviarci MAI dati personali (dei clienti)!';
+$lng['serversettings']['allow_error_report_customer']['title'] = 'Permetti ai clienti di inviare errori di database a Froxlor';
+$lng['serversettings']['allow_error_report_customer']['description'] = 'Attenzione: Non inviarci MAI dati personali (dei clienti)!';
+$lng['admin']['phpsettings']['enable_slowlog'] = 'Abilita slowlog (per dominio)';
+$lng['admin']['phpsettings']['request_terminate_timeout'] = 'Richiedi terminate-timeout';
+$lng['admin']['phpsettings']['request_slowlog_timeout'] = 'Richiedi slowlog-timeout';
+$lng['admin']['templates']['SERVER_HOSTNAME'] = 'Sostituisce il nome host del sistema (URL a froxlor)';
+$lng['admin']['templates']['SERVER_IP'] = 'Sostituisce l\'indrizzo IP predefinito del server';
+$lng['admin']['templates']['SERVER_PORT'] = 'Sostituisce la porta predefinita del server';
+$lng['admin']['templates']['DOMAINNAME'] = 'Sostituisce il sottodominio predefinito dei clienti (può essere vuoto se non viene generato)';
+$lng['admin']['show_news_feed'] = 'Mostra il feed notizie sul cruscotto dell \'amministratore';
+$lng['logger']['reseller'] = "Rivenditore";
+$lng['logger']['admin'] = "Amministratore";
+$lng['logger']['cron'] = "Cronjob";
+$lng['logger']['login'] = "Login";
+$lng['logger']['intern'] = "Interno";
+$lng['logger']['unknown'] = "Sconosciuto";
+$lng['serversettings']['mailtraffic_enabled']['title'] = "Analizza traffico posta";
+$lng['serversettings']['mailtraffic_enabled']['description'] = "Abilita l\'analisi dei log del server di posta per calcolare il traffico";
+$lng['serversettings']['mdaserver']['title'] = "tipo MDA";
+$lng['serversettings']['mdaserver']['description'] = "Tipo del Server di consegna di posta";
+$lng['serversettings']['mdalog']['title'] = "log MDA";
+$lng['serversettings']['mdalog']['description'] = "File log del Server di consegna di posta";
+$lng['serversettings']['mtaserver']['title'] = "tipo MTA";
+$lng['serversettings']['mtaserver']['description'] = "Tipo agente di trasferimento di posta";
+$lng['serversettings']['mtalog']['title'] = "log MTA";
+$lng['serversettings']['mtalog']['description'] = "File log dell\'agente di trasferimento di posta";
+$lng['panel']['ftpdesc'] = 'Descrizione FTP';
+$lng['admin']['cronsettings'] = 'Impostazioni Cronjob';
+$lng['serversettings']['system_cronconfig']['title'] = 'File di configurazione Cron';
+$lng['serversettings']['system_cronconfig']['description'] = 'Percorso al file di configurazione del servizio cron. Questo file verrà aggiornato regolarmente ed automaticamente da froxlor.<br />
+Nota: Perfavore <b>sii sicuro</b> di usare lo stesso nome di file come per il cronjob principale di froxlor (predefinito: /etc/cron.d/froxlor)!<br><br>Se usi <b>FreeBSD</b>, qui specifica: <i>/etc/crontab</i>!';
+$lng['tasks']['remove_ftpacc_files'] = 'Elimina i dati account-ftp del cliente.';
+$lng['tasks']['regenerating_crond'] = 'Ricostruisci il file cron.d';
+$lng['serversettings']['system_crondreload']['title'] = 'Commando per riavviare il servizio Cron';
+$lng['serversettings']['system_crondreload']['description'] = 'Specifica il commando da eseguire per riavviare il servizio cron del tuo sistema';
+$lng['admin']['integritycheck'] = 'Validazione Database';
+$lng['admin']['integrityid'] = '#';
+
+$lng['admin']['integrityname'] = 'Nome';
+$lng['admin']['integrityresult'] = 'Risultato';
+$lng['admin']['integrityfix'] = 'Risolvi problemi automaticamente';
+$lng['question']['admin_integritycheck_reallyfix'] = 'Vuoi veramente provare a risolvere i problemi di integrità del database automaticamente?';
+$lng['serversettings']['system_croncmdline']['title'] = 'Commando di esecuzione Cron (binario php)';
+$lng['serversettings']['system_croncmdline']['description'] = 'Commando per eseguire i nostri cronjob. Modificalo soltanto se sai cosa stai facendo (predefinito: "/usr/bin/nice -n 5 /usr/bin/php5 -q")!';
+$lng['error']['cannotdeletehostnamephpconfig'] = 'Questa configurazione PHP è utilizzata dal vhost Froxlor e non può essere eliminata.';
+$lng['error']['cannotdeletedefaultphpconfig'] = 'Questa configurazione PHP è impostata come predefinita e non può essere eliminata.';
+$lng['serversettings']['system_cron_allowautoupdate']['title'] = 'Permetti aggiornamenti automatici del database';
+$lng['serversettings']['system_cron_allowautoupdate']['description'] = '<div class="red"><b>ATTENZIONE:</b></div> Questa impostazione permette al cronjob di bypassare la verifica di versione dei file e database di froxlors ed esegue gli aggiornamenti di database in caso si verificasse un disallineamento di versione.<br><br><div class="red">l\'aggiornamento automatico imposterà sempre i valori predefiniti per nuove impostazioni o modifiche. Questo, non sempre potrebbe essere congruo ed adeguato per il vostro sistema. Pensaci due volte prima di attivare questa opzione</div>';
+$lng['error']['passwordshouldnotbeusername'] = 'La password deve essere diversa dal nome utente.';
+$lng['admin']['customer_show_news_feed'] = "Mostra feed di notizie personalizzati sul cruscotto dei clienti";
+$lng['admin']['customer_news_feed_url'] = "Feed RSS- per il feed di notizie personalizzato";
+$lng['serversettings']['dns_createhostnameentry'] = "Crea la zone/config di bind per il nome host del sistema";
+$lng['serversettings']['panel_password_alpha_lower']['title'] = 'Caratteri minuscoli';
+$lng['serversettings']['panel_password_alpha_lower']['description'] = 'La Password deve contenere almeno una lettera minuscola (a-z).';
+$lng['serversettings']['panel_password_alpha_upper']['title'] = 'Caratteri maiuscoli';
+$lng['serversettings']['panel_password_alpha_upper']['description'] = 'La Password deve contenere almeno una lettere maiuscola (A-Z).';
+$lng['serversettings']['panel_password_numeric']['title'] = 'Numeri';
+$lng['serversettings']['panel_password_numeric']['description'] = 'La Password deve contenere almeno un numero (0-9).';
+$lng['serversettings']['panel_password_special_char_required']['title'] = 'Caratteri speciali';
+$lng['serversettings']['panel_password_special_char_required']['description'] = 'La Password deve contenere almeno uno dei caratteri speciali definiti nel campo sottostante.';
+$lng['serversettings']['panel_password_special_char']['title'] = 'Lista dei caratteri speciali';
+$lng['serversettings']['panel_password_special_char']['description'] = 'Uno di questi caratteri è richiesto se è attivata l\'opzione soprastante.';
+$lng['phpfpm']['use_mod_proxy']['title'] = 'Usa mod_proxy / mod_proxy_fcgi';
+$lng['phpfpm']['use_mod_proxy']['description'] = 'Attiva l\'utilizzo di php-fpm attraverso mod_proxy_fcgi. Richiede almeno apache-2.4.9';
+$lng['error']['no_phpinfo'] = 'Ci dispiace, impossibile leggere phpinfo()';
+$lng['admin']['movetoadmin'] = 'Trasferisci cliente';
+$lng['admin']['movecustomertoadmin'] = 'Trasferisci cliente all\'amministratore/rivenditore selezionato<br /><small>Lascia questo vuoto per nessuna modifica.<br />Se l\'amministratore desiderato non appare nella lista, il suo massimale di clienti e stato ragggiunto.</small>';
+$lng['error']['moveofcustomerfailed'] = 'Trasferimento del cliente all\'amministratore/rivenditore selezionato fallito. Considera che tutte le altre modfiche al cliente sono state applicate con successo a questa fase.<br><br>Messaggio d\'errore: %s';
+$lng['domains']['domain_import'] = 'Importa Dominii';
+$lng['domains']['import_separator'] = 'Separatore';
+$lng['domains']['import_offset'] = 'Offset';
+$lng['domains']['import_file'] = 'File CSV';
+$lng['success']['domain_import_successfully'] = 'Importato %s dominii con successo.';
+$lng['error']['domain_import_error'] = 'Il seguente errore è occorsonell \'importazione di dominii: %s';
+$lng['admin']['note'] = 'Nota';
+$lng['domains']['import_description'] = 'Per ottenere informazioni dettagliate sulla struttura del file di importazione e  su come importare con successo, visita <a href="http://redmine.froxlor.org/projects/froxlor/wiki/DomainBulkActionDoc" target="_blank">http://redmine.froxlor.org/projects/froxlor/wiki/DomainBulkActionDoc</a>';
+$lng['usersettings']['custom_notes']['title'] = 'Note personali';
+$lng['usersettings']['custom_notes']['description'] = 'Sentiti libero di inserire qualsi nota vuoi o necessiti qui. Apparirano nel riepilogo dell\'amministratore/cliente perl \'utente corrispondente.';
+$lng['usersettings']['custom_notes']['show'] = 'Mostra le tue note nel cruscotto dell\'utente';
+$lng['serversettings']['system_send_cron_errors']['title'] = 'Inviaa gli errori cron all \'amministratore di froxlor via e-mail';
+$lng['serversettings']['system_send_cron_errors']['description'] = 'Scegli se ricevere una email sugli errori di cronjob. Ricorda che questo potrebbe causare l\'invio di una mail ogni 5 minuti in dipendenza all \'errore e alle tue impostazioni di cronjob.';

scripts/froxlor_master_cronjob.php

@@ -47,6 +47,8 @@ for ($x = 1; $x < count($argv); $x++) {
 			// really force re-generating of config-files by
 			// inserting task 1
 			inserttask('1');
+			// bind (if enabled, inserttask() checks this)
+			inserttask('4');
 			// also regenerate cron.d-file
 			inserttask('99');
 			addToQueue($jobs_to_run, $crontasks);

scripts/jobs/cron_tasks.inc.http.15.apache_fcgid.php

@@ -58,7 +58,12 @@ class apache_fcgid extends apache
 					$php_options_text.= '    </FilesMatch>' . "\n";
 					// >=apache-2.4 enabled?
 					if (Settings::Get('system.apache24') == '1') {
-						$php_options_text.= '    Require all granted' . "\n";
+					    $mypath_dir = new frxDirectory($domain['documentroot']);
+					    // only create the require all granted if there is not active directory-protection
+					    // for this path, as this would be the first require and therefore grant all access
+					    if ($mypath_dir->isUserProtected() == false) {
+						    $php_options_text.= '    Require all granted' . "\n";
+					    }
 					} else {
 						$php_options_text.= '    Order allow,deny' . "\n";
 						$php_options_text.= '    allow from all' . "\n";
@@ -90,7 +95,12 @@ class apache_fcgid extends apache
 					$php_options_text.= '    </FilesMatch>' . "\n";
 					// >=apache-2.4 enabled?
 					if (Settings::Get('system.apache24') == '1') {
-						$php_options_text.= '    Require all granted' . "\n";
+					    $mypath_dir = new frxDirectory($domain['documentroot']);
+					    // only create the require all granted if there is not active directory-protection
+					    // for this path, as this would be the first require and therefore grant all access
+					    if ($mypath_dir->isUserProtected() == false) {
+						    $php_options_text.= '    Require all granted' . "\n";
+					    }
 					} else {
 						$php_options_text.= '    Order allow,deny' . "\n";
 						$php_options_text.= '    allow from all' . "\n";

scripts/jobs/cron_tasks.inc.http.30.nginx.php

@@ -449,7 +449,7 @@ class nginx {
 
 		// Clean user defined settings
 		$vhost_usr = str_replace("\r", "\n", $vhost_usr); // Remove windows linebreaks
-		$vhost_usr = str_replace(array("{", "}"), array("{\n", "\n}"), $vhost_usr); // Break blocks into lines
+		$vhost_usr = str_replace(array("{ ", " }"), array("{\n", "\n}"), $vhost_usr); // Break blocks into lines
 		$vhost_usr = explode("\n", preg_replace('/[ \t]+/', ' ', trim(preg_replace('/\t+/', '', $vhost_usr)))); // Break into array items
 		$vhost_usr = array_filter($vhost_usr, create_function('$a','return preg_match("#\S#", $a);')); // Remove empty lines
 

templates/Sparkle/webftp/webftp_navigation_element.tpl

@@ -0,0 +1,13 @@
+<div class="menuelement">
+        <h4>
+                {if $navurl != '#'}
+                        <a href="{$navurl}" {$target} class="menu">{$navlabel}</a>
+                {else}
+                        {$navlabel}
+                {/if}
+        </h4>
+        <ul>
+                {$navigation_links}
+        </ul>
+</div>
+

templates/misc/configfiles/debian_wheezy/dovecot/etc_dovecot_conf.d_10-master.conf

@@ -102,6 +102,7 @@ service auth {
   unix_listener auth-client {
     mode = 0660
     user = mail
+    group = Debian-exim
   }
 
   # Auth process is run as this user.

templates/misc/configfiles/gentoo/postfix_courier/etc_postfix_main.cf

@@ -1,3 +1,9 @@
+# Postfix programs paths settings
+command_directory = /usr/sbin
+daemon_directory = /usr/libexec/postfix
+program_directory = /usr/libexec/postfix
+sendmail_path = /usr/sbin/sendmail
+
 ## General Postfix configuration
 # should be the default domain from your provider eg. "server100.provider.tld"
 mydomain = <SERVERNAME>
@@ -30,12 +36,12 @@ smtpd_recipient_restrictions = permit_mynetworks,
 smtpd_sender_restrictions = permit_mynetworks,
 	reject_sender_login_mismatch,
 	permit_sasl_authenticated, 
-	reject_unknown_helo_hostname, 
+	reject_unknown_hostname,
 	reject_unknown_recipient_domain, 
 	reject_unknown_sender_domain
 smtpd_client_restrictions = permit_mynetworks,
 	permit_sasl_authenticated,
-	reject_unknown_client_hostname
+	reject_unknown_hostname
 smtpd_relay_restrictions = permit_mynetworks,
 	permit_sasl_authenticated,
 	defer_unauth_destination
@@ -59,6 +65,7 @@ virtual_gid_maps = mysql:/etc/postfix/mysql-virtual_gid_maps.cf
 
 # Local delivery settings
 local_transport = local
+alias_database = hash:/etc/mail/aliases
 alias_maps = $alias_database
 
 # Default Mailbox size, is set to 0 which means unlimited!

templates/misc/configfiles/rhel7/postfix/etc_postfix_master.cf

@@ -1,4 +1,3 @@
 
 # added for Froxlor
-spamassassin	unix	-	n	n	-	-	pipe flags=R user=spamd argv=/usr/bin/spamc -e /usr/sbin/sendmail -oi -f ${sender} ${recipient}
-dovecot			unix	-	n	n	-	-	pipe flags=DRhu user=vmail:mail argv=/usr/libexec/dovecot/deliver -f ${sender} -d ${recipient}
+dovecot			unix	-	n	n	-	-	pipe flags=DRhu user=vmail:vmail argv=/usr/libexec/dovecot/deliver -f ${sender} -d ${recipient}

templates/misc/configfiles/rhel7/proftpd/etc_proftpd_proftpd.conf

@@ -82,7 +82,7 @@ DefaultServer			on
 # The DebugLevel directive configures the debugging level the server will use when logging.
 # The level parameter must be between 0 and 9.
 # This configuration directive will take precedence over any command-line debugging options used.
-DebugLevel			9
+#DebugLevel			9
 
 # Cause every FTP user except adm to be chrooted into their home directory
 DefaultRoot			~ !adm
@@ -347,7 +347,7 @@ ControlsLog			/var/log/proftpd/controls.log
 
   # Umask 022 is a good standard umask to prevent new dirs and files
   # from being group and world writable
-  Umask				022
+  Umask				077
 
   # Allow users to overwrite files and change permissions
   AllowOverwrite		yes
@@ -419,30 +419,30 @@ ControlsLog			/var/log/proftpd/controls.log
 </IfDefine>
 
 <IfModule mod_sql_mysql.c>
-	SQLLogFile				/var/log/proftpd/sql.log
+	SQLLogFile			/var/log/proftpd/sql.log
 	SQLAuthTypes 			Crypt
 	SQLAuthenticate			users* groups*
 	SQLConnectInfo			<SQL_DB>@<SQL_HOST> <SQL_UNPRIVILEGED_USER> <SQL_UNPRIVILEGED_PASSWORD>
-	SQLUserInfo				ftp_users username password uid gid homedir shell
+	SQLUserInfo			ftp_users username password uid gid homedir shell
 	SQLGroupInfo			ftp_groups groupname gid members
 	SQLUserWhereClause		"login_enabled = 'y'"
 
-	SQLLog					PASS login
+	SQLLog				PASS login
 	#SQLNamedQuery			login UPDATE "last_login=now(), login_count=login_count+1 WHERE username='%u'" ftp_users
 
-	SQLLog					RETR download
+	SQLLog				RETR download
 	#SQLNamedQuery			download UPDATE "down_count=down_count+1, down_bytes=down_bytes+%b WHERE username='%u'" ftp_users
 
-	SQLLog					STOR upload
+	SQLLog				STOR upload
 	#SQLNamedQuery			upload UPDATE "up_count=up_count+1, up_bytes=up_bytes+%b WHERE username='%u'" ftp_users
-	#QuotaEngine				on
-	#QuotaShowQuotas			on
+	#QuotaEngine			on
+	#QuotaShowQuotas		on
 	#QuotaDisplayUnits		Mb
-	#QuotaLock				/var/lock/ftpd.quotatab.lock
+	#QuotaLock			/var/lock/ftpd.quotatab.lock
 	#QuotaLimitTable 		sql:/get-quota-limit
 	#QuotaTallyTable 		sql:/get-quota-tally/update-quota-tally/insert-quota-tally
 	#SQLNamedQuery 			get-quota-limit SELECT "ftp_users.username AS name, ftp_quotalimits.quota_type, ftp_quotalimits.per_session, ftp_quotalimits.limit_type, panel_customers.diskspace*1024 AS bytes_in_avail, ftp_quotalimits.bytes_out_avail, ftp_quotalimits.bytes_xfer_avail, ftp_quotalimits.files_in_avail, ftp_quotalimits.files_out_avail, ftp_quotalimits.files_xfer_avail FROM ftp_users, ftp_quotalimits, panel_customers WHERE ftp_users.username = '%{0}' AND panel_customers.loginname = SUBSTRING_INDEX('%{0}', 'ftp', 1) AND quota_type ='%{1}'"
 	#SQLNamedQuery 			get-quota-tally SELECT "name, quota_type, bytes_in_used,bytes_out_used, bytes_xfer_used, files_in_used, files_out_used,files_xfer_used FROM ftp_quotatallies WHERE name = '%{0}' AND quota_type = '%{1}'"
 	#SQLNamedQuery			update-quota-tally UPDATE "bytes_in_used = bytes_in_used + %{0}, bytes_out_used = bytes_out_used + %{1}, bytes_xfer_used = bytes_xfer_used + %{2}, files_in_used = files_in_used + %{3}, files_out_used= files_out_used + %{4}, files_xfer_used = files_xfer_used + %{5} WHERE name= '%{6}' AND quota_type = '%{7}'" ftp_quotatallies
 	#SQLNamedQuery 			insert-quota-tally INSERT "%{0}, %{1}, %{2}, %{3}, %{4},%{5}, %{6}, %{7}" ftp_quotatallies
-</IfModule>
+</IfModule>

webftp.php

@@ -664,15 +664,24 @@ if (isset($_GET['logoff']) || isset($_POST['logoff'])) {
 				$body .= $smarty->fetch('webftp/webftp_main_multiple.tpl');
 			}
 		}
-		$smarty->assign('completeLink', '<a href="webftp.php?logoff=true">' . _('Logout') . '</a>');
-		$navlinks = $smarty->fetch('navigation_link.tpl');
-		$smarty->assign('completeLink', '<a href="webftp.php?webftp.php?action=mode&amp;mode=FTP_BINARY&amp;currentDir=' . $currentDir . '">' . _('Switch to BINARY mode') . '</a>');
-		$navlinks .= $smarty->fetch('navigation_link.tpl');
-		$smarty->assign('completeLink', '<a href="webftp.php?webftp.php?action=mode&amp;mode=FTP_ASCII&amp;currentDir=' . $currentDir . '">' . _('Switch to ASCII mode') . '</a>');
-		$navlinks .= $smarty->fetch('navigation_link.tpl');
-		$smarty->assign('completeLink', _('Main'));
-		$smarty->assign('navigation_links', $navlinks);
-		$smarty->assign('navigation', $smarty->fetch('navigation_element.tpl'));
+
+                $smarty->assign('target', '');
+                $smarty->assign('active', '');
+
+                $smarty->assign('navurl', 'webftp.php?logoff=true');
+                $smarty->assign('navlabel', _('Logout'));
+                $navlinks = $smarty->fetch('navigation_link.tpl');
+                $smarty->assign('navurl', 'webftp.php?webftp.php?action=mode&amp;mode=FTP_BINARY&amp;currentDir=' . $currentDir);
+                $smarty->assign('navlabel', _('Switch to BINARY mode'));
+                $navlinks .= $smarty->fetch('navigation_link.tpl');
+                $smarty->assign('navurl', 'webftp.php?webftp.php?action=mode&amp;mode=FTP_ASCII&amp;currentDir=' . $currentDir);
+                $smarty->assign('navlabel', _('Switch to ASCII mode'));
+                $navlinks .= $smarty->fetch('navigation_link.tpl');
+                $smarty->assign('navlabel', _('Main'));
+                $smarty->assign('navurl', "#");
+                $smarty->assign('navigation_links', $navlinks);
+                $smarty->assign('navigation', $smarty->fetch('webftp/webftp_navigation_element.tpl'));
+
 	}
 	else {
 		$smarty->assign('errormessage', _('Login failed, please try again') . "\n");